Transient receptor potential cation channel, subfamily A, member 1b

Overview
NameTransient receptor potential cation channel, subfamily A, member 1b
Smed IDSMED30034911
Length (bp)1212
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel, subfamily A, member 1b (SMED30034911) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel, subfamily A, member 1b (SMED30034911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034911SMESG000014208.1 SmedASXL_001621SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034911SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034911SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034911SMESG000014208.1 dd_Smed_v4_28432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034911SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034911SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034911SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034911SMESG000014208.1 dd_Smed_v4_59015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034911SMESG000014208.1 dd_Smed_v6_28432_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034911SMESG000014208.1 dd_Smed_v6_59015_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034911 dd_Smed_v6_72326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 68.5514 bits (166), Expect = 9.499e-12
Identity = 53/172 (30.81%), Postives = 76/172 (44.19%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----DPSSSG--QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +     P+     +   AL +MV   ++ LL HP+    L  KW  +G
Sbjct:  396 LDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYG 567          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 67.3958 bits (163), Expect = 2.180e-11
Identity = 53/172 (30.81%), Postives = 76/172 (44.19%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----DPSSSG--QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +     P+     +   AL +MV   ++ LL HP+    L  KW  +G
Sbjct:  544 LDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYG 715          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331823)

HSP 1 Score: 63.1586 bits (152), Expect = 2.522e-10
Identity = 49/182 (26.92%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-----------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
             D+  NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F  L             G    ++S     AL +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  610 VDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 791          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331825)

HSP 1 Score: 63.1586 bits (152), Expect = 2.712e-10
Identity = 49/182 (26.92%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-----------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
             D+  NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F  L             G    ++S     AL +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  575 VDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 756          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331824)

HSP 1 Score: 60.077 bits (144), Expect = 2.123e-9
Identity = 47/181 (25.97%), Postives = 75/181 (41.44%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----------DPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
             D+  NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F      P+          DP         + +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  610 VDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 790          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331826)

HSP 1 Score: 60.077 bits (144), Expect = 2.491e-9
Identity = 47/181 (25.97%), Postives = 75/181 (41.44%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----------DPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
             D+  NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F      P+          DP         + +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  575 VDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 755          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Match: f (gene:FBgn0262111 transcript:FBtr0304062)

HSP 1 Score: 51.6026 bits (122), Expect = 1.008e-6
Identity = 28/81 (34.57%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  211 INPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKD----VVKYFLNDDNWKKTMEYRHEN 441
            ++PNL D    T LHFAAS GHL V++ L  HGA+   + +  SP ++A  N + +    +V++  + D   K+   RH++
Sbjct:  137 VDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAAENQQVECLNVLVQHGTSVDYNGKSSSQRHKS 217          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 84.7297 bits (208), Expect = 3.679e-17
Identity = 57/177 (32.20%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  214 NPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G
Sbjct:  533 NVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYG 709          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 84.7297 bits (208), Expect = 3.679e-17
Identity = 57/177 (32.20%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  214 NPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G
Sbjct:  533 NVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYG 709          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 84.7297 bits (208), Expect = 3.760e-17
Identity = 57/177 (32.20%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  214 NPNLFDQKK---NTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            N  L D+K    NTALH AA  GH+  +  L   GA    N  + S   EA+ N R++VV   +  +   ++M       +  +  +I++  E    LLD+CITE   + + Q+  I Y F  L A          D + + Q   AL +MV + +L LL HPLS + L+ KW  +G
Sbjct:  546 NVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYG 722          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Zebrafish
Match: trpa1a (transient receptor potential cation channel, subfamily A, member 1a [Source:ZFIN;Acc:ZDB-GENE-050105-6])

HSP 1 Score: 76.6406 bits (187), Expect = 1.441e-14
Identity = 52/175 (29.71%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  220 NLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQR-------YYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGL 717
            N  D   NTALH AA  GH+  ++ L   GA+   N  + S   EA+ N+R++V    +  D  ++ M     N      +  +I++  E    LLD CI E   + +  N  I+Y F  L     +   +G           AL +MV F ++NLL HP+  + L+ KW  +G+
Sbjct:  551 NKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIILNKNDASFLHEAVHNARREVTNMVIESDRCEEAMTTYKPNSTKRCIVMDMIEFLPESFKHLLDTCIRESEEDVNCTNYYIEYNFRWLQHPLQNLKKTGMEKDMAYKPLSALNAMVNFNRVNLLTHPVCKKYLEMKWSAYGI 725          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 79.337 bits (194), Expect = 3.372e-15
Identity = 75/304 (24.67%), Postives = 138/304 (45.39%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDT--VNETTGCVIS------ANQRSRFFQDQYCF-----SFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWR 1059
            D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L        A   + +   +    L +MV  ++++LL HP+    L  KW  +G    L++L +Y L +I ++  I      ++ DT       G V          +  +  Q +  +     + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW 
Sbjct:  506 DKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWE 809          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 78.5666 bits (192), Expect = 5.527e-15
Identity = 73/291 (25.09%), Postives = 133/291 (45.70%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQRSRFFQDQYCFSFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWR 1059
            D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L        A   + +   +    L +MV  ++++LL HP+    L  KW  +G    L++L +Y L +I ++  I     +            V    Q+  +  D    + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW 
Sbjct:  527 DKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLMISNDFYVLIQLLFGIVKEAVQLCQQKLAYIGDGS--NIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWE 815          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 75.8702 bits (185), Expect = 3.678e-14
Identity = 74/302 (24.50%), Postives = 136/302 (45.03%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVIS------ANQRSRFFQDQYCF-----SFIFCALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWR 1059
            D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L        A   + +   +    L +MV  ++++LL HP+    L  KW  +G    L++L +Y L +I ++  I       +T       G V          +  +  Q +  +     + I  ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW 
Sbjct:  549 DKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLMISNDFY--DTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWE 848          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 75.8702 bits (185), Expect = 4.100e-14
Identity = 77/340 (22.65%), Postives = 136/340 (40.00%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG------------LGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQRS----RFFQDQY---CFSFIFC------------------------------ALYV--FLFIKNLRNIPCLN---EWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWR 1059
            D+++NTA+H A   GH + +  L  +GA    N    S   EA+   +KD V   +  + W++ ++ + H +  K  I  +I +  E    LLD+C+TE   +K   +  ++Y F  L        A   + +   +    L +MV  ++++LL HP+    L  KW  +G            LG + + L++           I     +K TD  N +     +   R     +    QY   C   +FC                              ++Y+   +F+ +L + P +    +W F  + +F S+  FL ++Q   S GI + MFW 
Sbjct:  551 DKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMKQECANVSRKLDLLQLKDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWE 890          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 69.3218 bits (168), Expect = 3.882e-12
Identity = 71/296 (23.99%), Postives = 120/296 (40.54%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXX---XXXXXXXXXXXXXXXXXXKNTDTVNETTGC---VISANQRSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMF 1053
             D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G    +++L      ++ +  +   I       +T  +N T+      I   +R+ F        ++     +   +    NIP   +W    + +F  +  FL ++Q   + GI + M 
Sbjct:  545 LDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINGTSSTHEERIDTLKRNYFLDYNNALEWVIYTTSIIFVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVML 836          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 64.6994 bits (156), Expect = 1.051e-10
Identity = 52/177 (29.38%), Postives = 77/177 (43.50%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G
Sbjct:  545 LDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYG 717          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. UniProt/SwissProt
Match: sp|O75762|TRPA1_HUMAN (Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3)

HSP 1 Score: 67.3958 bits (163), Expect = 1.047e-10
Identity = 53/172 (30.81%), Postives = 76/172 (44.19%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENG---KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPD----DPSSSG--QRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D+  NTALHFAA  GH + +  L  H A    N    S    AL N RK+VV   +    W + ++    N    K  I  +I+Y  E    LLD C+     +KS ++  I+Y F  L    +     P+     +   AL +MV   ++ LL HP+    L  KW  +G
Sbjct:  544 LDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYG 715          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. UniProt/SwissProt
Match: sp|Q8BLA8|TRPA1_MOUSE (Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.354e-10
Identity = 52/177 (29.38%), Postives = 77/177 (43.50%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH---IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   + +  W + ++    N  S+   I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G
Sbjct:  545 LDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYG 717          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. UniProt/SwissProt
Match: sp|Q7Z020|TRPA1_DROME (Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4)

HSP 1 Score: 63.1586 bits (152), Expect = 2.718e-9
Identity = 49/182 (26.92%), Postives = 77/182 (42.31%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDV-VKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLD-----------AGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
             D+  NTALH A        I  L   G +   N+ ++S  D A+     +  +    +++   + M  R +       +LI    ++   + DKCIT+    K  ++  IKY F  L             G    ++S     AL +MVT  ++ LL HPLS + LQ KW  +G  F L +
Sbjct:  575 VDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLAN 756          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. UniProt/SwissProt
Match: sp|Q6RI86|TRPA1_RAT (Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.873e-9
Identity = 51/177 (28.81%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHE--NGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA-----------LMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D++ NTALHFAA  GH + +  L  + A    N    S    AL N RK+VV   +    W + ++ + H+  + +  I  +++Y  E    LLD C+     +KS Q+  I+Y F  L      P S  ++              L  MV   ++ LL HP+    L  KW  +G
Sbjct:  545 LDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRSKRWDECLQVFTHDSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQC----PLSMTKKVTPTQDVIYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYG 717          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Match: A0A1I8HFL9 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 4.700e-31
Identity = 67/168 (39.88%), Postives = 104/168 (61.90%), Query Frame = 1
Query:  241 NTALHFAA---SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVD 735
            NTALH+AA   S G    ++ L  + A   +N  + +  D A+  S ++ ++ F ++  W  TM YR ENG++H++ LI+++ E   ++LD  I+    +  D+N  + Y + L+D GPDDP+S   RY ALM+M  FK+L+LLKHPLS+ ++Q KW KF +  LLVD
Sbjct:    1 NTALHYAAKEDSTGR--CVRLLLEYSAPISENNSSETAVDFAIFVSNREALEIFFSEQYWSWTMAYRRENGRTHMDKLIEHSLEFATKVLDYGISTTVRDPMDKNFAVIYNYSLIDPGPDDPASQPHRYLALMTMARFKQLDLLKHPLSSAVMQEKWTKFAITSLLVD 166          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Match: A0A1I8GGI5 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.188e-28
Identity = 58/155 (37.42%), Postives = 95/155 (61.29%), Query Frame = 1
Query:  241 NTALHFAASGGHL-EVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW 702
            NTALH+AA        ++ L  + A   +N  + +  D A+  S ++ ++ F ++  W  T+ YR ENG++H++ LI+++ E   ++LD  I+    +  D+N  + Y + L+D GPDDP+S   RY ALM+M  FK+L+LLKHPLS+ ++Q KW
Sbjct:    1 NTALHYAAKEDSTGRCVRLLLEYSAPISENNNSETAVDFAILVSNREALEIFFSEQYWSWTIAYRRENGRTHMDKLIEHSPEFATKVLDYGISTTVRDPMDKNFAVIYNYSLIDPGPDDPASQPHRYLALMTMARFKQLDLLKHPLSSAVMQEKW 155          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Match: A0A267FPG6 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g2 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.730e-23
Identity = 56/166 (33.73%), Postives = 98/166 (59.04%), Query Frame = 1
Query:  211 INPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW 702
            ++ N  D  +NTALH+A          ++ L ++GA+ Q N    +P D A+ N+    ++ F +D +    M YR ENG +H++ LI+++ +    +L++ +TE  ++  D+N  + Y F  LD GPDDP+S+ +RY AL +MV  +++ LL+HP+   L++ KW
Sbjct:  650 VDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRTWVMTYRKENGYTHLDVLIQHSPQTAELILNQAMTESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKW 815          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Match: A0A267E899 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025935g1 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.980e-23
Identity = 56/166 (33.73%), Postives = 98/166 (59.04%), Query Frame = 1
Query:  211 INPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW 702
            ++ N  D  +NTALH+A          ++ L ++GA+ Q N    +P D A+ N+    ++ F +D +    M YR ENG +H++ LI+++ +    +L++ +TE  ++  D+N  + Y F  LD GPDDP+S+ +RY AL +MV  +++ LL+HP+   L++ KW
Sbjct:  650 VDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRNWVMTYRKENGYTHLDVLIQHSPQTAELILNQAMTESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKW 815          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Match: A0A1I8JLU1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 4.182e-23
Identity = 56/166 (33.73%), Postives = 98/166 (59.04%), Query Frame = 1
Query:  211 INPNLFDQKKNTALHFAA--SGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW 702
            ++ N  D  +NTALH+A          ++ L ++GA+ Q N    +P D A+ N+    ++ F +D +    M YR ENG +H++ LI+++ +    +L++ +TE  ++  D+N  + Y F  LD GPDDP+S+ +RY AL +MV  +++ LL+HP+   L++ KW
Sbjct:  574 VDVNASDSSRNTALHYACKHEDSDASCVELLLKNGAQLQQNYNGETPVDVAVLNNNNPAIQLFFSDAHRTWVMTYRKENGYTHLDVLIQHSPQTAELILNQAMTESGADHMDKNFMVVYNFTDLDPGPDDPASAHRRYLALRTMVKRRRVELLEHPVCQALIESKW 739          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 85.1149 bits (209), Expect = 2.815e-17
Identity = 72/244 (29.51%), Postives = 123/244 (50.41%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQRSRFFQDQYCFSFIFCALYVFLFIKNL 933
            +++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + R++ +    C   +   + V+   K L
Sbjct:  535 NEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVL-VMNVYAICKEL 776          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 84.7297 bits (208), Expect = 3.320e-17
Identity = 72/244 (29.51%), Postives = 123/244 (50.41%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQRSRFFQDQYCFSFIFCALYVFLFIKNL 933
            +++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + R++ +    C   +   + V+   K L
Sbjct:  535 NEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVL-VMNVYAICKEL 776          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 84.7297 bits (208), Expect = 3.320e-17
Identity = 72/244 (29.51%), Postives = 123/244 (50.41%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTME-YRHENG-KSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA-------GPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGCVISANQRSRFFQDQYCFSFIFCALYVFLFIKNL 933
            +++ NTALH AA  GH+  +K L   GA F  N    S   EA+ N +K+V    + ++   + +  ++   G +  +  LI++  E T  LLD C+ E   + ++ N  I Y F  L A          D S + Q   AL +MV + +L LL HP+  + L+ KWK +G    L++L +Y+L ++ +++ I  + P +NT +VN TT  + S + R++ +    C   +   + V+   K L
Sbjct:  535 NEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNT-SVNGTTVTMASVSFRTQSYMISVCIVMVL-VMNVYAICKEL 776          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 72.0182 bits (175), Expect = 4.619e-13
Identity = 50/174 (28.74%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLL--------DAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGL 717
             D   NTALH AA  GH+  ++ L   GA+F  N  + S   EA+ N RK+V    ++ D  ++ +     N      +  +I++  E    LLD CI E   + +     I+Y F  L        +    +     +   AL +MV F ++ LL HP+  + L+ KWK +G+
Sbjct:  526 IDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGM 699          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 71.633 bits (174), Expect = 5.280e-13
Identity = 50/174 (28.74%), Postives = 80/174 (45.98%), Query Frame = 1
Query:  226 FDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSH--IESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLL--------DAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGL 717
             D   NTALH AA  GH+  ++ L   GA+F  N  + S   EA+ N RK+V    ++ D  ++ +     N      +  +I++  E    LLD CI E   + +     I+Y F  L        +    +     +   AL +MV F ++ LL HP+  + L+ KWK +G+
Sbjct:  526 IDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGM 699          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 46.2098 bits (108), Expect = 7.628e-6
Identity = 26/62 (41.94%), Postives = 34/62 (54.84%), Query Frame = 1
Query:  220 NLFDQKKNTALHFAASGGHLEVIKCLCRHGARF---QDNLFNLSPFDEALANSRKDVVKYFL 396
            N  D   NTALH AA  GH+E+++ L  +GA        +F  +P  +A AN   DVVKY L
Sbjct:  358 NDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLL 419          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Nematostella
Match: EDO33180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST04])

HSP 1 Score: 74.3294 bits (181), Expect = 2.070e-14
Identity = 48/173 (27.75%), Postives = 84/173 (48.55%), Query Frame = 1
Query:  214 NPNLFDQKKN----TALHFAASGGHLEVIK-CLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYY-ALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            NPN  + + N    T+LH AA  GH EV+   L     +   N +N +  D A+   R++VV    N   W++ M +R E G + ++ L+        + LD+C+ E  + K D++  + + F  L   PD      +++   L +MV +K++N L H +   ++  KW+  G
Sbjct:   41 NPNCINDEDNADQDTSLHLAAKNGHSEVVDFLLSDPNQKITYNGYNQNGLDVAIEAGRENVVMVIANHTRWRE-MCHRVEEGLTQLQHLVIKMPSAAEKFLDRCVEECGAGK-DEDYSVTFDFMFLQGMPDIRKDDPKKFLDCLHTMVKYKRVNCLSHQVCGAIMNIKWRSVG 211          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Nematostella
Match: EDO27354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9H1])

HSP 1 Score: 54.299 bits (129), Expect = 5.534e-8
Identity = 36/123 (29.27%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  346 FDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
             D A+   R +V K  +  D W + +  R+  G+  +  LI+   ++    LD+CI   P   S Q+  + +   LLD GP     + +   A   MV      LL HP++  LL+ KW  FG
Sbjct:  172 LDVAIDWKRTEVAKVLIQHDRWWEVICTRNSAGELPMVGLIEALPDVAKLALDQCIVRCPLPTSHQDYCLTFHTVLLDPGPCKEGQTSRD--ASEVMVENDCEELLSHPVTQGLLRYKWFAFG 292          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Nematostella
Match: EDO39289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ4])

HSP 1 Score: 51.9878 bits (123), Expect = 2.854e-7
Identity = 43/164 (26.22%), Postives = 74/164 (45.12%), Query Frame = 1
Query:  235 KKNTALHFAASGGHLEVIKCLCRHGARFQDNLFN-LSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYA---LMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            ++ T  H+AA     + +K L + G    D  +N  +P   A    R +  K+ ++          +  +G   +  +I     +  E LD+  T      +D+ N  +Y++ L    PD P + G   YA   L  +V FK+++L+ HP+  RL+  KW KFG
Sbjct:  108 QQQTPTHYAAKNDATKSLKVLIKLGGNMDDRDYNGRTPLQVAAELDRSETAKFLIDQGT---AAGVQDTSGNCSLSIMISKMPPVAKEALDQFHT------TDRANRKQYYY-LNYLEPDLPEN-GHGCYARTPLQCVVLFKQMDLIMHPVFQRLIAIKWSKFG 260          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Nematostella
Match: EDO30220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E6])

HSP 1 Score: 49.2914 bits (116), Expect = 2.005e-6
Identity = 20/63 (31.75%), Postives = 40/63 (63.49%), Query Frame = 1
Query:  220 NLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDN 408
            ++ D++ N+ LH+    GHLE++K L R GA+   N   L+P   A  + + ++V+YF+++++
Sbjct:   48 DMQDKQGNSVLHYGVERGHLEIVKELVRQGAKHLPNKLGLTPLLLASNDCKTEMVEYFISEED 110          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Medaka
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:101174541])

HSP 1 Score: 76.6406 bits (187), Expect = 1.312e-14
Identity = 51/169 (30.18%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  229 DQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEY--RHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDA--GP---DDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFG 714
            D+  NTALH AA  GH+  ++ +   GA    N  + S   EA+ N RKDVV   ++ D  ++ ++      + +  I  +I++  E    LLD C+ E   + +  +  I+Y F  L A   P    D S   Q   A+ +MV + ++ LL HP+  + L  KW  +G
Sbjct:  544 DEDGNTALHIAARAGHVAAVRLMLVKGAELVLNKNHTSFLHEAVQNGRKDVVNAVVDSDRCEEALQLFTPGTSQRCPILDMIEFLPETYKHLLDCCVRESDDDHNSPDYHIEYNFQWLQAPISPQKLSDESLKIQPLVAVNAMVKYNRIELLNHPVCKKYLAMKWVAYG 712          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 351.288 bits (900), Expect = 2.081e-112
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 1
Query:  202 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK 699
            KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK
Sbjct:  554 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK 719          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 353.984 bits (907), Expect = 1.178e-111
Identity = 168/169 (99.41%), Postives = 168/169 (99.41%), Query Frame = 1
Query:  202 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKK 708
            KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK KK
Sbjct:  554 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKDKK 722          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Match: SMESG000014208.1 (SMESG000014208.1)

HSP 1 Score: 353.599 bits (906), Expect = 1.400e-111
Identity = 168/169 (99.41%), Postives = 168/169 (99.41%), Query Frame = 1
Query:  202 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKK 708
            KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRK KK
Sbjct:  548 KNKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKDKK 716          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 256.144 bits (653), Expect = 2.619e-76
Identity = 159/352 (45.17%), Postives = 219/352 (62.22%), Query Frame = 1
Query:  205 NKINPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLGFLLVDXXXXXXXXXXXXXXXXXXXXXKNTDTVNETTGC---------------------------VISA----------NQRSRFFQDQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQHLPSEGIKVFMFWRXXXXXXXXXXXXXXXXXXXXXXXYIINRDQ 1149
            +++N NL+DQ K+TALH AA  GHL+++K L + GA+  +++F  +  D A+ N +  VV++FLN++NWKK M +RH+NG  HI+ LIKYNEEIT+ELLDKCI E  SN  D N EIK+WFG+LD+GPDD +S  +RY AL SM    +L+LLKHPLS +LLQ KW KFGL F L+D I+Y+L++I I+ Y+    P+ +TD+    +GC                           +I+           +QR RFF + + + FI   + VF FIKN   +PCL EW FAP L+F  +   LY+++  P  GI+V MF +V  ++ K F  FF LF GFGF FYIIN  Q
Sbjct:  553 DEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEIKFWFGILDSGPDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIYTPMTDTDSYTSYSGCKQTNSSVSSDKLDAPVGVVLMNSLIYAIITGQLLLLLLKLFSQRIRFFMEVWNYIFITNDILVFFFIKNPLQLPCLYEWQFAPGLIFVVWFLLLYYMRFFPYIGIQVMMFQKVLVSIIKAFAIFFGLFVGFGFGFYIINSSQ 904          
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Match: SMESG000078036.1 (SMESG000078036.1)

HSP 1 Score: 209.92 bits (533), Expect = 3.567e-61
Identity = 97/163 (59.51%), Postives = 126/163 (77.30%), Query Frame = 1
Query:  214 NPNLFDQKKNTALHFAASGGHLEVIKCLCRHGARFQDNLFNLSPFDEALANSRKDVVKYFLNDDNWKKTMEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFGLLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKW 702
            N NL DQ K TALH AA+ GHL+V++CL   GA   DN+F  SP D A++N++++VVK+FLNDDNW+  M YRH+NG SHIE+LIK NE++T+ELLDKCI E  SNK D N E++Y F L+DAGPDDP+S  +RY+AL SM  +K+L LL+HPLS +LL+ KW
Sbjct:  523 NVNLHDQMKVTALHQAAAEGHLQVVQCLWTSGAILSDNMFGQSPLDIAISNNQENVVKFFLNDDNWQNVMAYRHDNGSSHIENLIKSNEDLTLELLDKCIIENTSNKMDPNYEVQYRFSLIDAGPDDPASISERYHALKSMTEYKRLKLLRHPLSAKLLKIKW 685          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRPA19.499e-1230.81transient receptor potential cation channel subfam... [more]
TRPA12.180e-1130.81transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrpA12.522e-1026.92gene:FBgn0035934 transcript:FBtr0331823[more]
TrpA12.712e-1026.92gene:FBgn0035934 transcript:FBtr0331825[more]
TrpA12.123e-925.97gene:FBgn0035934 transcript:FBtr0331824[more]
TrpA12.491e-925.97gene:FBgn0035934 transcript:FBtr0331826[more]
f1.008e-634.57gene:FBgn0262111 transcript:FBtr0304062[more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trpa1b3.679e-1732.20transient receptor potential cation channel, subfa... [more]
trpa1b3.679e-1732.20transient receptor potential cation channel, subfa... [more]
trpa1b3.760e-1732.20transient receptor potential cation channel, subfa... [more]
trpa1a1.441e-1429.71transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trpa13.372e-1524.67transient receptor potential cation channel, subfa... [more]
trpa15.527e-1525.09transient receptor potential cation channel, subfa... [more]
trpa13.678e-1424.50transient receptor potential cation channel, subfa... [more]
trpa14.100e-1422.65transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trpa13.882e-1223.99transient receptor potential cation channel, subfa... [more]
Trpa11.051e-1029.38transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O75762|TRPA1_HUMAN1.047e-1030.81Transient receptor potential cation channel subfam... [more]
sp|Q8BLA8|TRPA1_MOUSE7.354e-1029.38Transient receptor potential cation channel subfam... [more]
sp|Q7Z020|TRPA1_DROME2.718e-926.92Transient receptor potential cation channel subfam... [more]
sp|Q6RI86|TRPA1_RAT2.873e-928.81Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HFL94.700e-3139.88ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8GGI52.188e-2837.42ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FPG63.730e-2333.73ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267E8993.980e-2333.73ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8JLU14.182e-2333.73ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b2.815e-1729.51transient receptor potential cation channel subfam... [more]
trpa1b3.320e-1729.51transient receptor potential cation channel subfam... [more]
trpa1b3.320e-1729.51transient receptor potential cation channel subfam... [more]
trpa1a4.619e-1328.74transient receptor potential cation channel subfam... [more]
trpa1a5.280e-1328.74transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HOS47.628e-641.94Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO331802.070e-1427.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273545.534e-829.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392892.854e-726.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302202.005e-631.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
trpa1b1.312e-1430.18transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel, subfamily A, member 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014208.12.081e-112100.00SMESG000014208.1[more]
SMESG000014208.11.178e-11199.41SMESG000014208.1[more]
SMESG000014208.11.400e-11199.41SMESG000014208.1[more]
SMESG000078033.12.619e-7645.17SMESG000078033.1[more]
SMESG000078036.13.567e-6159.51SMESG000078036.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034911 ID=SMED30034911|Name=Transient receptor potential cation channel, subfamily A, member 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=1212bp
CGAACAATAAATGATGAGAATAACATTAGTTAATTTAATATCCGATTTGC
ATGACAATTTTCTGATTTACTAAAACCACTTTACAAAGACTTTCTTCTAA
AAACTCATTTATCAAAAGCACAATAATTTTATTAACATTTAGCCCGTATA
AAAACGGAATTCCTGTTGCTTACCTAGTTTTTTTACACTAGTTATTTTTT
AAAAAATAAAATAAATCCAAATTTATTTGATCAAAAGAAAAATACTGCGT
TGCATTTCGCAGCTTCTGGAGGTCATTTAGAAGTCATTAAGTGCTTATGC
CGTCACGGAGCAAGGTTTCAAGATAATTTATTTAATCTCTCTCCATTTGA
TGAAGCTCTTGCGAATAGCCGAAAGGACGTGGTCAAATATTTCTTAAACG
ATGACAATTGGAAAAAAACTATGGAATACCGACATGAAAACGGGAAAAGC
CATATCGAGTCTTTGATTAAGTACAATGAAGAAATAACAATTGAACTTCT
CGATAAATGCATAACAGAAATTCCATCAAACAAATCTGATCAAAATAATG
AAATCAAATATTGGTTTGGACTACTAGATGCTGGCCCAGATGATCCATCA
AGTTCCGGGCAACGTTATTATGCATTAATGAGCATGGTTACTTTTAAAAA
ACTAAATCTTCTGAAACATCCTTTATCTACAAGATTACTGCAAAGGAAAT
GGAAAAAATTTGGACTTGGATTTCTTTTAGTCGATTTGATTCTATATATT
TTATATATTATAGCTATTTCTTTTTATATTTTTGCAATTCCTCCAATTAA
GAATACTGATACGGTGAATGAAACAACGGGATGTGTAATTTCTGCCAATC
AAAGATCTAGATTTTTCCAGGATCAATACTGTTTTTCGTTTATTTTTTGC
GCTTTATACGTATTTTTGTTCATTAAAAATCTCCGAAACATTCCTTGTTT
AAATGAATGGACATTTGCTCCGATGCTCTTATTTCAGTCTTATTCCTACT
TTCTTTATTTTATACAACATCTTCCATCAGAAGGAATAAAGGTGTTCATG
TTTTGGAGAGTTTTTAAGACGTTGACAAAAGTATTTTTAACATTTTTTTG
TCTCTTTTTTGGATTTGGATTTGCCTTCTATATTATTAACAGAGATCAGC
TGTTTATTGTAAAAATGGAGTAAATATATTTAAGAATAGCAAACATTTTA
CATTAATTGGAT
back to top

protein sequence of SMED30034911-orf-1

>SMED30034911-orf-1 ID=SMED30034911-orf-1|Name=SMED30034911-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MEYRHENGKSHIESLIKYNEEITIELLDKCITEIPSNKSDQNNEIKYWFG
LLDAGPDDPSSSGQRYYALMSMVTFKKLNLLKHPLSTRLLQRKWKKFGLG
FLLVDLILYILYIIAISFYIFAIPPIKNTDTVNETTGCVISANQRSRFFQ
DQYCFSFIFCALYVFLFIKNLRNIPCLNEWTFAPMLLFQSYSYFLYFIQH
LPSEGIKVFMFWRVFKTLTKVFLTFFCLFFGFGFAFYIINRDQLFIVKME
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR47143FAMILY NOT NAMEDcoord: 59..243
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 149..168
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 101..123