cilia- and flagella-associated protein 77

Overview
Namecilia- and flagella-associated protein 77
Smed IDSMED30034903
Length (bp)909
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 77 (SMED30034903) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 77 (SMED30034903) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 77 (SMED30034903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 77 (SMED30034903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034903h1SMcG0015677 SmedASXL_001658SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30034903h1SMcG0015677 Contig42199uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034903h1SMcG0015677 Contig42199newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30034903h1SMcG0015677 dd_Smed_v6_5179_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034903h1SMcG0015677 OX_Smed_1.0.01607ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30034903h1SMcG0015677 dd_Smed_v4_5179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Human
Match: CFAP77 (cilia and flagella associated protein 77 [Source:HGNC Symbol;Acc:HGNC:33776])

HSP 1 Score: 95.5153 bits (236), Expect = 2.445e-22
Identity = 65/225 (28.89%), Postives = 118/225 (52.44%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKG-------SGVPEAMKWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMK 761
            LG  R++M  N L ++ ++G+ +   + +P     GI F  G        GVPEA+     ++ F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +    +    + P+M +GI  RPSTP  DLL +++   W+      QK +  +++ +++   K  +TRSS LR Y  P     LW MP F+ +V   + +F  +  R+ ++K
Sbjct:   50 LGVVRDSMFQNPLIVKAELGKPRERSYSLP-----GINFNYGLYIRGLDGGVPEAIG---RWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPP-PLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKLEKKQKVVLG-KLYETRSSQLRKYKPPVKLDTLWHMPHFQ-KVGRHLDTFPTEADRQRALK 263          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Human
Match: CFAP77 (cilia and flagella associated protein 77 [Source:HGNC Symbol;Acc:HGNC:33776])

HSP 1 Score: 85.5001 bits (210), Expect = 1.862e-18
Identity = 58/191 (30.37%), Postives = 101/191 (52.88%), Query Frame = 3
Query:  216 GITFEKG-------SGVPEAM-KWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMK 761
            GI F  G        GVPEA+ +W    + F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +    +    + P+M +GI  RPSTP  DLL +++   W+      QK +  +++ +++   K  +TRSS LR Y  P     LW MP F+ +V   + +F  +  R+ ++K
Sbjct:  116 GINFNYGLYIRGLDGGVPEAIGRW----NVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPP-PLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKLEKKQKVVLG-KLYETRSSQLRKYKPPVKLDTLWHMPHFQ-KVGRHLDTFPTEADRQRALK 299          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Human
Match: CFAP77 (cilia and flagella associated protein 77 [Source:HGNC Symbol;Acc:HGNC:33776])

HSP 1 Score: 54.299 bits (129), Expect = 3.679e-8
Identity = 37/135 (27.41%), Postives = 70/135 (51.85%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKG-------SGVPEAMKWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTR 491
            LG  R++M  N L ++ ++G+ +   + +P     GI F  G        GVPEA+     ++ F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +    +    + P+M +GI  R
Sbjct:   50 LGVVRDSMFQNPLIVKAELGKPRERSYSLP-----GINFNYGLYIRGLDGGVPEAIG---RWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPP-PLPPNMTFGIRAR 175          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Zebrafish
Match: CFAP77 (cilia and flagella associated protein 77 [Source:NCBI gene;Acc:558957])

HSP 1 Score: 117.857 bits (294), Expect = 3.248e-31
Identity = 75/228 (32.89%), Postives = 127/228 (55.70%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDK-VFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEK-ELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVS 785
            +G  R++ML+  L ++  +G+SK+     P  + VFG  T  +  GV EA+    ++   T  ++H   ERDFI LNRE V++GLV+++E   +RATHD+ +K  + +        ++SP   + +S RPSTPI +L+  K+   WL+   Q +  +++  +++  +  +  DTR++LLR    P PE    W +PRF  +V A + +FR+   R+ +M     E VS
Sbjct:    6 IGVVRDSMLHRPLLIKPTLGKSKSRGLSYPGPEFVFGTATTVQDGGVQEAIS---NWHTHTMSTTHRAAERDFIALNREGVKSGLVTAKELHQYRATHDIRRKPLTREGFRRSAPPRLSPDDSFFVSNRPSTPISELIEYKYAQRWLEE-QQVRDRVLQAHQHKKAQLGRIQDTRTTLLRKSQ-PLPEAPSTWKLPRF-QKVGAALDTFRDPEARKKAMNAHCSESVS 227          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Zebrafish
Match: CFAP77 (cilia and flagella associated protein 77 [Source:NCBI gene;Acc:558957])

HSP 1 Score: 117.857 bits (294), Expect = 3.248e-31
Identity = 75/228 (32.89%), Postives = 127/228 (55.70%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDK-VFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEK-ELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVS 785
            +G  R++ML+  L ++  +G+SK+     P  + VFG  T  +  GV EA+    ++   T  ++H   ERDFI LNRE V++GLV+++E   +RATHD+ +K  + +        ++SP   + +S RPSTPI +L+  K+   WL+   Q +  +++  +++  +  +  DTR++LLR    P PE    W +PRF  +V A + +FR+   R+ +M     E VS
Sbjct:    6 IGVVRDSMLHRPLLIKPTLGKSKSRGLSYPGPEFVFGTATTVQDGGVQEAIS---NWHTHTMSTTHRAAERDFIALNREGVKSGLVTAKELHQYRATHDIRRKPLTREGFRRSAPPRLSPDDSFFVSNRPSTPISELIEYKYAQRWLEE-QQVRDRVLQAHQHKKAQLGRIQDTRTTLLRKSQ-PLPEAPSTWKLPRF-QKVGAALDTFRDPEARKKAMNAHCSESVS 227          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:Xenbase;Acc:XB-GENE-478699])

HSP 1 Score: 99.7525 bits (247), Expect = 6.946e-24
Identity = 68/217 (31.34%), Postives = 117/217 (53.92%), Query Frame = 3
Query:   57 KKMISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPN-DKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKK--DKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRF 695
            K+  +++NE F        G  R++M +N L  R ++G  +   + +P  D  +G+ ++ +  GV  A+     +++   ++   K ERD++ LNREAV++GLV++ E   +R  H + +   +  TK   ++    +  +M +GISTRPSTPI DLL +++Q  W++     Q + +  +    IK  K  +TR+SLLR Y  P     LW +PRF
Sbjct:   75 KRESAMENERF--------GVVRDSMEDNTLLQRAQLGTVRRASYPLPGADFTYGVKSYIQDGGVALALG---QWNSIEAKTRLRKLERDYVALNREAVKSGLVTAHEHQVYRNHHQIWRPLHEGCTKPQGLN----LPTNMTFGISTRPSTPIGDLLDHRYQRLWVEQQRVAQ-EALLLKSKEKIKKSKVQNTRTSLLRRYQPPGDPAPLWHLPRF 275          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:Xenbase;Acc:XB-GENE-478699])

HSP 1 Score: 90.8929 bits (224), Expect = 4.822e-21
Identity = 60/190 (31.58%), Postives = 103/190 (54.21%), Query Frame = 3
Query:  138 NNCLHMRDKVGRSKTFCHHVPN-DKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVK--KDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRF 695
            N   H + ++G  +   + +P  D  +G+ ++ +  GV  A+     +++   ++   K ERD++ LNREAV++GLV++ E   +R  H + +   +  TK   ++    +  +M +GISTRPSTPI DLL +++Q  W++     Q + +  +    IK  K  +TR+SLLR Y  P     LW +PRF
Sbjct:   36 NPVPHNQAQLGTVRRASYPLPGADFTYGVKSYIQDGGVALALG---QWNSIEAKTRLRKLERDYVALNREAVKSGLVTAHEHQVYRNHHQIWRPLHEGCTKPQGLN----LPTNMTFGISTRPSTPIGDLLDHRYQRLWVEQQRVAQ-EALLLKSKEKIKKSKVQNTRTSLLRRYQPPGDPAPLWHLPRF 217          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Mouse
Match: Cfap77 (cilia and flagella associated protein 77 [Source:MGI Symbol;Acc:MGI:2685669])

HSP 1 Score: 102.834 bits (255), Expect = 4.076e-25
Identity = 72/237 (30.38%), Postives = 125/237 (52.74%), Query Frame = 3
Query:   90 VDTATGI----LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKG-------SGVPEAMKWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDL-MEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMK 761
            VD  TG+    LG  R++M  N L ++ ++G+ +     +P     GI F  G        GVPEA+     ++ F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +         I P+M +GI +RPSTP  DLL +++Q  W+      Q+ + MEK++  ++      +TRSS LR Y  P     LW MP F+ +V + +++F  +  R+ ++K
Sbjct:   39 VDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLP-----GINFNYGLYIRGLDGGVPEAIG---HWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPP--PIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILGKL--YETRSSQLRKYKPPVKLDALWHMPHFK-KVASHLATFPTEADRQRALK 262          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Mouse
Match: Cfap77 (cilia and flagella associated protein 77 [Source:MGI Symbol;Acc:MGI:2685669])

HSP 1 Score: 98.5969 bits (244), Expect = 1.032e-23
Identity = 67/215 (31.16%), Postives = 112/215 (52.09%), Query Frame = 3
Query:   90 VDTATGI----LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKG-------SGVPEAMKWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFR 698
            VD  TG+    LG  R++M  N L ++ ++G+ +     +P     GI F  G        GVPEA+     ++ F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +         I P+M +GI +RPSTP  DLL +++Q  W+      Q+ +  +++ ++I   K  +TRSS LR Y  P     LW MP F+
Sbjct:   39 VDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLP-----GINFNYGLYIRGLDGGVPEAIG---HWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQ--KEPPPIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILG-KLYETRSSQLRKYKPPVKLDALWHMPHFK 242          
BLAST of cilia- and flagella-associated protein 77 vs. UniProt/SwissProt
Match: sp|A2BFC9|CFA77_DANRE (Cilia- and flagella-associated protein 77 OS=Danio rerio OX=7955 GN=cfap77 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.452e-30
Identity = 75/228 (32.89%), Postives = 127/228 (55.70%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDK-VFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEK-ELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVS 785
            +G  R++ML+  L ++  +G+SK+     P  + VFG  T  +  GV EA+    ++   T  ++H   ERDFI LNRE V++GLV+++E   +RATHD+ +K  + +        ++SP   + +S RPSTPI +L+  K+   WL+   Q +  +++  +++  +  +  DTR++LLR    P PE    W +PRF  +V A + +FR+   R+ +M     E VS
Sbjct:    6 IGVVRDSMLHRPLLIKPTLGKSKSRGLSYPGPEFVFGTATTVQDGGVQEAIS---NWHTHTMSTTHRAAERDFIALNREGVKSGLVTAKELHQYRATHDIRRKPLTREGFRRSAPPRLSPDDSFFVSNRPSTPISELIEYKYAQRWLEE-QQVRDRVLQAHQHKKAQLGRIQDTRTTLLRKSQ-PLPEAPSTWKLPRF-QKVGAALDTFRDPEARKKAMNAHCSESVS 227          
BLAST of cilia- and flagella-associated protein 77 vs. UniProt/SwissProt
Match: sp|Q6ZQR2|CFA77_HUMAN (Cilia- and flagella-associated protein 77 OS=Homo sapiens OX=9606 GN=CFAP77 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.943e-18
Identity = 58/191 (30.37%), Postives = 101/191 (52.88%), Query Frame = 3
Query:  216 GITFEKG-------SGVPEAM-KWPKSYSAFTKE-SSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMK 761
            GI F  G        GVPEA+ +W    + F ++ +  ++  R++I +NR AV+ GLV++RE   +R  +D+   D+  +    +    + P+M +GI  RPSTP  DLL +++   W+      QK +  +++ +++   K  +TRSS LR Y  P     LW MP F+ +V   + +F  +  R+ ++K
Sbjct:  116 GINFNYGLYIRGLDGGVPEAIGRW----NVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQLNDIRISDQDDRRMKKEPP-PLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIKLEKKQKVVLG-KLYETRSSQLRKYKPPVKLDTLWHMPHFQ-KVGRHLDTFPTEADRQRALK 299          
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Match: R7T8V9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_21391 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 2.646e-44
Identity = 90/242 (37.19%), Postives = 142/242 (58.68%), Query Frame = 3
Query:   78 NEEFVDTATGILGNKRETMLNNCLHMRDKVGR--SKTFCHHVPNDKVFGI-TFEKGSGVPEAMK-WPKSYSAFTKES---SHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNA-IDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDH-----LSQKQKDLMEKERNRMIKSFKPS---DTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELS 755
             E F  TATG+LG KR+TML+N LH+R+K+GR   + + ++      +G+    +  G  EA+  WP     +            ERDFI LN+ AV NG+ +S++ + FRAT+DV KK + TKS   +   RKI  +MVYG++TRP+TPI  L+ +++Q++WL+      L+Q+ K  M++ R + +   KP    +TR+SL+R Y VP  +  LW +P+F  +    + +F  DR R+L+
Sbjct:    5 GEYFEHTATGVLGEKRDTMLHNQLHLRNKLGRPMERGYINYPGEQYRYGVPNATRDGGASEALSGWPNRGGLYFHRKDTIGDEPLERDFISLNKSAVLNGITNSQDQTQFRATNDVRKKVQDTKSEQRVKTPRKIPVNMVYGVATRPATPIDQLIQHRYQDKWLEETRSADLAQRAKSEMQRRRIQALSRLKPGKVCNTRTSLMRVYQVPVEDAPLWHLPKFAKKAQPHLKTFATDRARDLA 246          
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Match: A0A267EZS7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034181g1 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.764e-44
Identity = 88/244 (36.07%), Postives = 138/244 (56.56%), Query Frame = 3
Query:   81 EEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSH-----NKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKK-DKSTKSNAIDGNRKISP-SMVYGISTRPSTPIHDLLANKFQNEWL-DHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPE---KELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGE 776
            + +  TATG+LG+KR TML N +H R ++ R+KT CHH P +   GI T    S +P+A  W  +  A    SS       +  +DF+ LNR+A R+G  + RE   FRA HD  K+ ++  +++        +P    +G+  RPSTPIH+L+A KFQN+W+ D +S  Q       +  ++   +P +TR+S+LR+Y++PA +     LW MPRF     +R+ +FR++R R L+ +    E
Sbjct:    6 DRYTYTATGVLGDKRPTMLENEIHQRSQLARAKTHCHHFPPNMTMGISTARDHSALPKAFSWTDAPVAANAGSSSLLSRPKQQPKDFVSLNRDAARSGYATMRENRDFRAMHDYRKQPERDRRASGTGAATSRAPVDAAHGVGNRPSTPIHELIAYKFQNDWIRDQVSGNQARAAATPKKPLM--CQPYETRASMLRSYLLPAEQHASASLWKMPRFERSARSRLDTFRSERQRSLAFELHEAE 247          
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Match: A0A1I8I157 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034181g2 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 7.454e-44
Identity = 88/244 (36.07%), Postives = 138/244 (56.56%), Query Frame = 3
Query:   81 EEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSH-----NKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKK-DKSTKSNAIDGNRKISP-SMVYGISTRPSTPIHDLLANKFQNEWL-DHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPE---KELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGE 776
            + +  TATG+LG+KR TML N +H R ++ R+KT CHH P +   GI T    S +P+A  W  +  A    SS       +  +DF+ LNR+A R+G  + RE   FRA HD  K+ ++  +++        +P    +G+  RPSTPIH+L+A KFQN+W+ D +S  Q       +  ++   +P +TR+S+LR+Y++PA +     LW MPRF     +R+ +FR++R R L+ +    E
Sbjct:    6 DRYTYTATGVLGDKRPTMLENEIHQRSQLARAKTHCHHFPPNMTMGISTARDHSALPKAFSWTDAPVAANAGSSSLLNRPKQQPKDFVSLNRDAARSGYATMRENRDFRAMHDYRKQPERDRRASGTGAATSRAPVDAAHGVGNRPSTPIHELIAYKFQNDWIRDQVSGNQARAAATPKKPLM--CQPYETRASMLRSYLLPAEQHTSASLWKMPRFERSARSRLDTFRSERQRSLAFELHEAE 247          
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Match: A0A1I8JH59 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006478g1 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.343e-43
Identity = 88/244 (36.07%), Postives = 136/244 (55.74%), Query Frame = 3
Query:   81 EEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSH-----NKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSM--VYGISTRPSTPIHDLLANKFQNEWL-DHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPE---KELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGE 776
            + +  TATG+LG+KR TML N +H R ++ R+KT CHH P +   GI T    + +P+A  W  +  A    SS       +  +DF+ LNR+A R+G  + RE   FRA HD  K+ +  +  +  G     P +   +G+  RPSTPIH+L+A KFQN+W+ D +S  Q          ++   +P +TR+S+LR+Y++PA +     LW MPRF     +R+ +FR++R R L+ +    E
Sbjct:    6 DRYTYTATGVLGDKRPTMLENEIHQRSQLARAKTHCHHFPPNMTMGISTTRDHTALPKAFSWTDAPVAANAGSSSLLSRPKQQPKDFVSLNRDAARSGYATMRENRDFRAMHDYRKQPERDRRASGTGAATSRPPVDAAHGVGNRPSTPIHELIAYKFQNDWIRDQVSGNQARAAATPMKPLM--CQPYETRASMLRSYLLPAEQHASASLWKMPRFERSARSRLDTFRSERQRSLAFELHEAE 247          
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Match: A0A1I8ITQ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.668e-43
Identity = 88/244 (36.07%), Postives = 138/244 (56.56%), Query Frame = 3
Query:   81 EEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSH-----NKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKK-DKSTKSNAIDGNRKISP-SMVYGISTRPSTPIHDLLANKFQNEWL-DHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPE---KELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGE 776
            + +  TATG+LG+KR TML N +H R ++ R+KT CHH P +   GI T    S +P+A  W  +  A    SS       +  +DF+ LNR+A R+G  + RE   FRA HD  K+ ++  +++        +P    +G+  RPSTPIH+L+A KFQN+W+ D +S  Q       +  ++   +P +TR+S+LR+Y++PA +     LW MPRF     +R+ +FR++R R L+ +    E
Sbjct:    6 DRYTYTATGVLGDKRPTMLENEIHQRSQLARAKTHCHHFPPNMTMGISTARDHSALPKAFSWTDAPVAANAGSSSLLNRPKQQPKDFVSLNRDAARSGYATMRENRDFRAMHDYRKQPERDRRASGTGAATSRAPVDAAHGVGNRPSTPIHELIAYKFQNDWIRDQVSGNQARAAATPKKPLM--CQPYETRASMLRSYLLPAEQHTSASLWKMPRFERSARSRLDTFRSERQRSLAFELHEAE 247          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Cavefish
Match: si:ch211-215c18.3 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000027.1:2410739:2426522:-1 gene:ENSAMXG00000009656.2 transcript:ENSAMXT00000009927.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:si:ch211-215c18.3)

HSP 1 Score: 94.7449 bits (234), Expect = 6.309e-23
Identity = 60/200 (30.00%), Postives = 106/200 (53.00%), Query Frame = 3
Query:  165 VGRSKTFCHHVPN-DKVFGI-TFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSM 758
            +G+S++     P  D V+G  T  +  GV E   W    ++    SS  K ERDF+ LNRE V++G+V++R+  H+RATHD+ +   + +        +I   + +G+ T PS  I D+L  +F  +WL+    K+K L+ + + + ++  +  DTR++LL+           W +PRF  ++   + +FR+   RE +M
Sbjct:    3 LGKSQSRRLSCPGPDFVYGAPTIVRDGGVAEISNW--DTASLNTSSSARKAERDFVALNREGVKSGMVTARDLRHYRATHDIQRPIVTDRHPPT----RIPQDIPFGVPT-PSESIADMLQYRFAQKWLEEQQAKEKTLLGR-KPKKVQLGRIRDTRTTLLQKARPLEQPPSTWQLPRF-QQIGPALDTFRDPEARERAM 193          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Nematostella
Match: EDO43313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ2])

HSP 1 Score: 125.561 bits (314), Expect = 1.436e-34
Identity = 75/232 (32.33%), Postives = 127/232 (54.74%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITF-----EKGSGVPEAMKWPKSYSAFTKESSHN--KTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVS 785
            LG  R+++LNN L  + ++GR    C  +P D   G T+      K SG  +A+ W    SA  ++ SH   K  RDF  LN+ AV+ GL +++E   +RATHDV +KD S         +++ P+MV+G+ T+PSTP++DLL +K+Q+ WL+   + +  +  +++ +        +TR+SLLR Y  P     LW M +F N++     +FR+++ +  +  +   +  S
Sbjct:    9 LGVHRDSLLNNPLLQKTELGRPLRRCFTLPPD---GFTYGKPNGNKDSGAADALVW---RSAPPQQFSHKEKKKPRDFQSLNKSAVQVGLTTAQEHFQYRATHDVRRKD-SGNERTTQKIKRLPPTMVFGVPTKPSTPVYDLLGHKYQDRWLEERRKAEDGMRARQKQKRHVDKNIYETRASLLRKYQPPVDPPPLWHMAKF-NKIPPVTVTFRSEKAKSAAFDHHATDSTS 232          
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Medaka
Match: ENSORLT00000029839.1 (cilia and flagella associated protein 77 [Source:NCBI gene;Acc:101172143])

HSP 1 Score: 74.7146 bits (182), Expect = 1.659e-15
Identity = 61/221 (27.60%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  111 LGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKV-FGITFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRA--THDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLM-EKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMK 761
            LG  R++ML N L ++  +GR+ +     P   V  GI       V E +    S+              +F+ LNR+AVR G+V+S+E S +RA      ++   S+K N     R + P +++G++ +PS  + DLL++ + + WL+      K+L   +E  + +K   P++TR+ LLR        K+   +P F  +V   +++FR+ + RE +++
Sbjct:    6 LGVVRKSMLTNPLLIKPPLGRACSRGLFFPEPDVPCGIRSHCNGSVAEVL----SHWEVQPRPKELLQSTNFMSLNRDAVRAGVVTSKEMSQYRAQRAKAPIQSWSSSKDNPNASGRSV-PDIMFGVTHKPSDKMADLLSHTYGHLWLE------KELSRPREPGKRVKPLVPAETRTVLLRKSRSLPIIKQPVKLPEF-AQVAPALNTFRDPKDREQALR 214          
BLAST of cilia- and flagella-associated protein 77 vs. Planmine SMEST
Match: SMESG000042608.1 (SMESG000042608.1)

HSP 1 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 242/244 (99.18%), Postives = 243/244 (99.59%), Query Frame = 3
Query:   63 MISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVSGIA 794
            MISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAID NRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPR+RNRVDARISSFRNDRIRELSMKYDVGEPVSGIA
Sbjct:    1 MISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKVFGITFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLVSSREFSHFRATHDVVKKDKSTKSNAIDANRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRYRNRVDARISSFRNDRIRELSMKYDVGEPVSGIA 244          
BLAST of cilia- and flagella-associated protein 77 vs. Planmine SMEST
Match: SMESG000064718.1 (SMESG000064718.1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.851e-15
Identity = 66/241 (27.39%), Postives = 110/241 (45.64%), Query Frame = 3
Query:   54 LKKMISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCH-HVPNDKVFGITFE-KGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLV--SSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHDLLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPAPEKELWTMPRFRNRVDARISSFRNDRIRELSMKY 764
             KK    D  ++   A G+LG  RE ML      R   G+  T      P    +G+ +    +GV + M+               K+    I   +EA+ NG+   +S+ + H     D V      ++       K    + +G   RPS+P+ D++++K++N+W +   Q+     ++ + +  K  +P D+ +S+LRTY  P P KELW MP+F +RV AR+  F  D  R+   KY
Sbjct:    3 FKKTTLKDLMKYEYVAPGLLGLGRENMLKMETLQRAPTGKFVTRGRPKQPPGFRYGMLYPYDPNGVAKCMQ------------QKVKSNPGGIVARKEAMDNGIKMDTSKHWPHKGKNMDPVAMYWQKRTV------KFPKCITFGRPFRPSSPMGDVMSHKYKNDWDEWAIQENLKATDEWKRKRSKVTRPWDSIASVLRTYTKPKPVKELWHMPKF-SRVPARVLPFWEDDDRKAIKKY 224          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CFAP772.445e-2228.89cilia and flagella associated protein 77 [Source:H... [more]
CFAP771.862e-1830.37cilia and flagella associated protein 77 [Source:H... [more]
CFAP773.679e-827.41cilia and flagella associated protein 77 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP773.248e-3132.89cilia and flagella associated protein 77 [Source:N... [more]
CFAP773.248e-3132.89cilia and flagella associated protein 77 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fgfr46.946e-2431.34fibroblast growth factor receptor 4 [Source:Xenbas... [more]
fgfr44.822e-2131.58fibroblast growth factor receptor 4 [Source:Xenbas... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cfap774.076e-2530.38cilia and flagella associated protein 77 [Source:M... [more]
Cfap771.032e-2331.16cilia and flagella associated protein 77 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A2BFC9|CFA77_DANRE2.452e-3032.89Cilia- and flagella-associated protein 77 OS=Danio... [more]
sp|Q6ZQR2|CFA77_HUMAN8.943e-1830.37Cilia- and flagella-associated protein 77 OS=Homo ... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T8V92.646e-4437.19Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267EZS75.764e-4436.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I1577.454e-4436.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JH591.343e-4336.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8ITQ71.668e-4336.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-215c18.36.309e-2330.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO433131.436e-3432.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000029839.11.659e-1527.60cilia and flagella associated protein 77 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 77 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000042608.10.000e+099.18SMESG000042608.1[more]
SMESG000064718.14.851e-1527.39SMESG000064718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034903 ID=SMED30034903|Name=cilia- and flagella-associated protein 77|organism=Schmidtea mediterranea sexual|type=transcript|length=909bp
CATATTTACATTGTTTTAACTAAATCATCCATAGCGAAATAAAATCCGAA
AACTTAAAGAAAATGATAAGTTTGGATAATGAAGAATTTGTTGATACCGC
TACTGGTATTTTGGGTAATAAGCGAGAAACTATGTTGAATAATTGCTTAC
ATATGAGAGACAAAGTTGGTAGATCAAAGACATTTTGTCACCACGTTCCA
AATGATAAAGTTTTCGGAATAACATTCGAAAAAGGCAGTGGAGTACCAGA
AGCTATGAAATGGCCAAAGTCATACAGTGCTTTTACAAAAGAATCTTCAC
ATAATAAAACTGAAAGAGATTTTATTGGATTGAACAGAGAAGCAGTTCGT
AATGGATTGGTAAGTTCTCGAGAATTCAGTCACTTCAGGGCGACTCACGA
TGTCGTCAAGAAAGATAAATCAACTAAATCAAACGCCATTGATGGAAATC
GAAAAATATCACCAAGTATGGTATATGGAATAAGTACTAGGCCGTCAACC
CCTATTCATGATTTGCTAGCTAATAAATTTCAGAATGAATGGCTGGACCA
TTTAAGTCAAAAACAAAAGGATTTAATGGAAAAAGAAAGAAACAGAATGA
TAAAATCTTTTAAACCAAGTGATACTCGATCCTCATTATTGAGGACATAC
ATGGTTCCGGCACCAGAGAAAGAATTATGGACAATGCCACGATTTAGAAA
CAGGGTTGATGCTCGTATAAGCTCGTTTCGAAACGACCGAATAAGGGAAT
TGTCAATGAAATATGATGTTGGGGAACCAGTTTCGGGAATCGCATAAGAA
ATTGTATTACAATTGTTTCAGTTTGTTTATCATTTGTGCTTTGACATCAT
GAAATTGTATACTTAGAAACCACTTTATCACTTTCTAAGATAATTATTGT
TGACTTTTT
back to top

protein sequence of SMED30034903-orf-1

>SMED30034903-orf-1 ID=SMED30034903-orf-1|Name=SMED30034903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MISLDNEEFVDTATGILGNKRETMLNNCLHMRDKVGRSKTFCHHVPNDKV
FGITFEKGSGVPEAMKWPKSYSAFTKESSHNKTERDFIGLNREAVRNGLV
SSREFSHFRATHDVVKKDKSTKSNAIDGNRKISPSMVYGISTRPSTPIHD
LLANKFQNEWLDHLSQKQKDLMEKERNRMIKSFKPSDTRSSLLRTYMVPA
PEKELWTMPRFRNRVDARISSFRNDRIRELSMKYDVGEPVSGIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005929cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029147CFAP77
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029147Cilia- and flagella-associated protein 77PFAMPF14825DUF4483coord: 21..170
e-value: 2.6E-38
score: 131.3
IPR029147Cilia- and flagella-associated protein 77PANTHERPTHR28617FAMILY NOT NAMEDcoord: 17..233