RNA cytidine acetyltransferase

Overview
NameRNA cytidine acetyltransferase
Smed IDSMED30034901
Length (bp)2696
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA cytidine acetyltransferase (SMED30034901) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA cytidine acetyltransferase (SMED30034901) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA cytidine acetyltransferase (SMED30034901) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA cytidine acetyltransferase (SMED30034901) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034901

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034901SMESG000026216.1 Contig5790newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034901SMESG000026216.1 Contig5790uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034901SMESG000011518.1 Contig5790newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034901SMESG000011518.1 Contig5790uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30034901SMESG000026216.1 SmedASXL_017793SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034901SMESG000026216.1 SmedASXL_017793SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA cytidine acetyltransferase vs. Ensembl Human
Match: NAT10 (N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:29830])

HSP 1 Score: 160.229 bits (404), Expect = 1.414e-39
Identity = 181/817 (22.15%), Postives = 362/817 (44.31%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVIL-------------ISNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--------NCVDTLANCKPFQVF--ANIQIAE-------SYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSH--HVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-----YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   +E ++  GLV++             ++ ++ ++++ E   ++  +F +RF   L++    LV  +  N          ++ L    P +    +++++ E       + P+ +    C+T DQ  A+   I+ +         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R      ++  + ++ T +    +  ++ +    +T   + +   I +   DA+E  LND+ CL      +          P P  CEL YV++ TLF  H A+E+ L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  +       R+V++     ++ +GYG   +++L  Y+    P +      T    H +S   +S         + +P LL+ +N  P    ++DY+   +     LL FWK+  F PV ++        E  C M+   +    D  D+       +++   R   ++ +       +L   ++ NR   NM    +  +  E+L++      LK+L  + +N+  +  + D+I  +++IYF   +  L L+      L+G GLQ KS  +L  E+ L
Sbjct:   34 YYN-----ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGIS--------EKTLRSTVALT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSAQSQVSTTAENKTTTTARLASA---RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSG-----CPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAE--RLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDE--DEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNR---NMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIEL 814          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Human
Match: NAT10 (N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:29830])

HSP 1 Score: 159.844 bits (403), Expect = 2.088e-39
Identity = 181/817 (22.15%), Postives = 362/817 (44.31%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVIL-------------ISNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--------NCVDTLANCKPFQVF--ANIQIAE-------SYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSH--HVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-----YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   +E ++  GLV++             ++ ++ ++++ E   ++  +F +RF   L++    LV  +  N          ++ L    P +    +++++ E       + P+ +    C+T DQ  A+   I+ +         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R      ++  + ++ T +    +  ++ +    +T   + +   I +   DA+E  LND+ CL      +          P P  CEL YV++ TLF  H A+E+ L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  +       R+V++     ++ +GYG   +++L  Y+    P +      T    H +S   +S         + +P LL+ +N  P    ++DY+   +     LL FWK+  F PV ++        E  C M+   +    D  D+       +++   R   ++ +       +L   ++ NR   NM    +  +  E+L++      LK+L  + +N+  +  + D+I  +++IYF   +  L L+      L+G GLQ KS  +L  E+ L
Sbjct:  106 YYN-----ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGIS--------EKTLRSTVALT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSAQSQVSTTAENKTTTTARLASA---RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSG-----CPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAE--RLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDE--DEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNR---NMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Human
Match: NAT10 (N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:29830])

HSP 1 Score: 148.288 bits (373), Expect = 5.672e-36
Identity = 156/663 (23.53%), Postives = 295/663 (44.49%), Query Frame = 1
Query:  565 CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSH--HVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-----YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            C+T DQ  A+   I+ +         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R      ++  + ++ T +    +  ++ +    +T   + +   I +   DA+E  LND+ CL      +          P P  CEL YV++ TLF  H A+E+ L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  +       R+V++     ++ +GYG   +++L  Y+    P +      T    H +S   +S         + +P LL+ +N  P    ++DY+   +     LL FWK+  F PV ++        E  C M+   +    D  D+       +++   R   ++ +       +L   ++ NR   NM    +  +  E+L++      LK+L  + +N+  +  + D+I  +++IYF   +  L L+      L+G GLQ KS  +L  E+ L
Sbjct:  102 CKTLDQAKAVLKFIEGIS--------EKTLRSTVALT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSAQSQVSTTAENKTTTTARLASA---RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGC-----PLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAE--RLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDE--DEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNR---NMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIEL 733          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Celegans
Match: nath-10 (RNA cytidine acetyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O01757])

HSP 1 Score: 172.17 bits (435), Expect = 1.211e-43
Identity = 200/840 (23.81%), Postives = 368/840 (43.81%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFESKME-LIQCFIENIQANGLVIL-------------ISNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRN------IAN---NCVDTLANCKPFQVFANIQIA-------ESYPI----KLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRN-------------QNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCL-----QRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIE-----DHEKNEKETIMK---ELQKQT---ELVELKNGK--SLRIVKLITQAKFKKLGYGKHMVKMLHKYFM-------QNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-------YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIE--DLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISG-LNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E  ++L   + V +++DFE+    L+   IE I+  G+VIL             IS ++  +++ E    +T +F +RF   L++ + +LV  +      I++   N     A+ K  Q  ++ ++A       E+ PI       +T+ Q  AL   +D +         ++Q   + SL  G +GRGK+ A+ L +A AI +G T+I+V +PS ++L +   F+     +L YQ+ +    IQ  N             +    +++  SPT   K+   +           L+ I EA  +    + +++S  P + + S +  G+  TG ++  ++ +  R  +  GE           K G S    +NK   KT   ++M   I +   D +E  LN + CL     Q +++C           P P+ CEL  V++ TLFS H A+E  L++ + I+ S   K S   L+ LSD PAH+LF L  P  +++K +P+VL +  + +E     D+ +N  E+  +   +L   T   + ++ + G     RIV++     ++ +GYG   V+++ +Y++       +   A A  +      V     +            +P LL  ++     P ++DY+   F     LL FWK+  F PV I+  S     E  C ++        D  +E +       ++E   R+  ++  D       +   +L  ++K+    +K   IE  +L   L    L++++ + +N+     + DI+  VA++ F + +   L LA      L+  GLQ K  + ++ E+ L
Sbjct:  105 YYN-----ETEKILGNTFGVLVLQDFEAMTPNLLARTIETIEGGGMVILLMQSVRSLRQLYTISMDVHNRYRTEAHNEITARFNERFILSLASCSSVLVLDDQLRVLPISSHIENVEAIPASQKKIQSESDAELASLKEAMKETKPIGPLLSRARTACQAKALLRFLDVI--------TEKQSNVTCSLTAG-RGRGKSAAVGLSLAGAIAFGYTNIFVTSPSPENLKTLFEFVVKGFDALDYQEHTDYELIQSANPEFKNCLVRINVFREHKQTIQYISPTDVQKLGQCE-----------LIVIDEAAAIPLPLVKELIS-GPYISFLSSTINGYEGTGRSLSLKLLQQLRQQSAGGEA----------KEGKS---ASNK--GKTLHEMHMEESIRYKPGDKIEKWLNRLLCLDATNCQLKLECG---------TPPPAACELYIVNRDTLFSFHDASEAFLQQVMAIFVSAHYKNSPNDLQMLSDAPAHNLFVLMAPIDKSRKTIPEVLAVVQVCLEGRLDSDNIQNGLESGKRAAGDLLPWTVSQQFMDKQFGTLCGGRIVRVAVHPDYQSMGYGGRAVQLIEQYYLGLATSLDEEEKAPAPPSKTVIKQVKDGHTVELLEERIEPRADLPPLLQRLDER--KPERLDYLGVSFGLTVPLLKFWKRNEFVPVYIRQNSNDITGEHTCIILKGLEHGGSDSDEEPSATWLPVYWREFRRRIVNLLSFDFSSFPAQMALSLLQLKNKHVEKQMKRLVIERSELAIHLSNTDLRRMSQYGRNMVDSHIITDILPIVAKLNFEQRLPQELKLAVTQSAILLARGLQHKHFEDISKELDL 892          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Fly
Match: l(1)G0020 (gene:FBgn0027330 transcript:FBtr0071280)

HSP 1 Score: 197.593 bits (501), Expect = 8.052e-52
Identity = 192/811 (23.67%), Postives = 343/811 (42.29%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCK------------PF----------------------------QVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS--IQIRNQN----RSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYF------MQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMI--SDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRD-KYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEM 2451
            E + VL + Y VC+++DFE+    L+   +E ++  GL+IL+    T +  +++        KRF     T+A   VT       + +LA+CK            P                             +    +Q A +  + LC+T DQ +A+   I++L        V +QL+  +SL    +GRGK+ A+ L +A+A+ +G  +IYV +P  ++L +   F+     +L YQ+ +    IR+ N    ++I     + +S   +++I          A L+ I EA  +    + K++   P +V+ + +  G+  TG ++  ++                            I Q+    DN     + +   I + +ND +E  L ++ CL                 P P  CEL YVD+  LFS H AAE  L + + IY S   K +   L+ +SD PAHHLFCL  P +    +P++L +  +++E               +K   + I   + +Q    +      +RIV++ T   ++++GYGK  +++L  Y+      +++ P VA+         + + +LS    +     ++P LL  ++     P  +DYI   +    ELL FWK   F PV +   S    +E  C M+   + +  +G       YQ+   RV  ++     + +  L   +L N+      + LK      L  +     L++L S+ +    F  + D++  +AQ+YF   I GL L    +  L+  G+Q K+   L  E+
Sbjct:  106 ETHAVLGRTYGVCVLQDFEALTPNLLARTVETVEGGGLIILLLK--TLQSLKQLYTMSMDVHKRF----RTEAHQTVTCRFNERLILSLADCKRCLVVNDDLTVLPLSSKTINVEPVNPAGAGRSPNEASLKELKESLLTVQPAGAL-VNLCKTYDQANAVAQFIEAL--------VDKQLKPPMSLT-AARGRGKSAALGLSIAAAVAFGYVNIYVTSPHPENLITLFEFVLKGFDALEYQEHADYTIIRSTNADYKKAIIRINITRSSRQTIQYIAPSDTHLLNAADLLLIDEAAAIPLPLVKKMI--GPYLVFMASTINGYEGTGRSLSLKL----------------------------ISQLQK--DNNARPPLKLEESIRYQENDDIEKWLINLLCLDASTVPSISSG-----CPTPDACELYYVDRDALFSYHKAAEAFLHRLVSIYVSSHYKNTPNDLQMMSDAPAHHLFCLLGPVQRMDALPEILVVIQVALEGQISAQSISDSLGRGKKAAGDLIPWNVAEQYGDRDFPKLCGVRIVRVATHPNYQRMGYGKRAIQLLKDYYARKHTNLEDGP-VASKDAGKGIEEVEEEELSLLKEQIRPRSRIPTLLQRLHER--VPEHVDYIGTSYGLTTELLKFWKNAGFVPVYLSQKSNELTAEHSCIMLHTPNATPWLG-----LYYQDFRRRVLKLMGKTFREFETKLCLALLKNKSVDTEGSALKVLDKPMLDVYFLPHDLQRLESYARQQSEFRLIIDLLTDIAQLYFQGRIDGLQLDLVQQGILLALGVQGKTVDALGLEL 855          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Fly
Match: l(1)G0020 (gene:FBgn0027330 transcript:FBtr0344164)

HSP 1 Score: 197.208 bits (500), Expect = 9.577e-52
Identity = 192/811 (23.67%), Postives = 343/811 (42.29%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCK------------PF----------------------------QVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS--IQIRNQN----RSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYF------MQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMI--SDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRD-KYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEM 2451
            E + VL + Y VC+++DFE+    L+   +E ++  GL+IL+    T +  +++        KRF     T+A   VT       + +LA+CK            P                             +    +Q A +  + LC+T DQ +A+   I++L        V +QL+  +SL    +GRGK+ A+ L +A+A+ +G  +IYV +P  ++L +   F+     +L YQ+ +    IR+ N    ++I     + +S   +++I          A L+ I EA  +    + K++   P +V+ + +  G+  TG ++  ++                            I Q+    DN     + +   I + +ND +E  L ++ CL                 P P  CEL YVD+  LFS H AAE  L + + IY S   K +   L+ +SD PAHHLFCL  P +    +P++L +  +++E               +K   + I   + +Q    +      +RIV++ T   ++++GYGK  +++L  Y+      +++ P VA+         + + +LS    +     ++P LL  ++     P  +DYI   +    ELL FWK   F PV +   S    +E  C M+   + +  +G       YQ+   RV  ++     + +  L   +L N+      + LK      L  +     L++L S+ +    F  + D++  +AQ+YF   I GL L    +  L+  G+Q K+   L  E+
Sbjct:  106 ETHAVLGRTYGVCVLQDFEALTPNLLARTVETVEGGGLIILLLK--TLQSLKQLYTMSMDVHKRF----RTEAHQTVTCRFNERLILSLADCKRCLVVNDDLTVLPLSSKTINVEPVNPAGAGRSPNEASLKELKESLLTVQPAGAL-VNLCKTYDQANAVAQFIEAL--------VDKQLKPPMSLT-AARGRGKSAALGLSIAAAVAFGYVNIYVTSPHPENLITLFEFVLKGFDALEYQEHADYTIIRSTNADYKKAIIRINITRSSRQTIQYIAPSDTHLLNAADLLLIDEAAAIPLPLVKKMI--GPYLVFMASTINGYEGTGRSLSLKL----------------------------ISQLQK--DNNARPPLKLEESIRYQENDDIEKWLINLLCLDASTVPSISSG-----CPTPDACELYYVDRDALFSYHKAAEAFLHRLVSIYVSSHYKNTPNDLQMMSDAPAHHLFCLLGPVQRMDALPEILVVIQVALEGQISAQSISDSLGRGKKAAGDLIPWNVAEQYGDRDFPKLCGVRIVRVATHPNYQRMGYGKRAIQLLKDYYARKHTNLEDGP-VASKDAGKGIEEVEEEELSLLKEQIRPRSRIPTLLQRLHER--VPEHVDYIGTSYGLTTELLKFWKNAGFVPVYLSQKSNELTAEHSCIMLHTPNATPWLG-----LYYQDFRRRVLKLMGKTFREFETKLCLALLKNKSVDTEGSALKVLDKPMLDVYFLPHDLQRLESYARQQSEFRLIIDLLTDIAQLYFQGRIDGLQLDLVQQGILLALGVQGKTVDALGLEL 855          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Zebrafish
Match: nat10 (N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1543])

HSP 1 Score: 152.91 bits (385), Expect = 1.998e-37
Identity = 180/814 (22.11%), Postives = 359/814 (44.10%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYN-LTQFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPF-------------QVFANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDE-----AAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRD-KYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   +E ++  G+V+++             + ++ ++++ E   + + +F +RF   LS+    +V  +  N         N KP              Q   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A L+ I EA  +    + K+L   P +V+ + +  G+  TG ++  ++ +  R      ++  +  N + +    S  ++      ++   + +   I + Q D +E  LND+ CL      +          P P  C+L YV++ TLF  H A+E  L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  E       RIV++     ++ +GYG   +++L +Y+    P         +  + S S  + S LE +   +     + +        ++DY+   +    +LL FWKK  F PV ++        E  C M+ D +    D  D+     A +++   R  +++         TL   +L N+  K + T +   T  +L +      LK+L  + +N+  +  + D+I  +A+++F +    ++L+      L+G GLQ KS  +L  E+ L
Sbjct:  108 YYN-----ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGIVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVIGRFNERFILSLSSCKSCVVIDDQLNILPISSHATNIKPIPPKKQDDGLSPREQELKDLKESLQDTQPVGVLVDGCKTMDQAKAVLKFIEAIS--------EKTLRSTVALT-AARGRGKSAALGLAMAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVVRVNIFKEHRQTIQYIHPADAVKLGQAELLVIDEAAAIPLPLVKKLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSSESQQNLSAENRNTSTARLAAA---RSLHEVTLHESIRYGQGDHVERWLNDLLCLDCLSVPRIISG-----CPLPQTCDLYYVNRDTLFCYHKASEAFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNSLPEVLAVLQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDSEFAGLSGGRIVRIAVNPDYQGMGYGTRALQLLQRYYEGQFPLWDEQEQTMTSAITSVSSEAVSLLEEVVSPRKDLPPLLLKLNERRAERLDYLGVSYGLTPQLLKFWKKAGFVPVYLRQTPNDLTGEHSCIMLKDLNSE--DSTDQNQWLSAFWKDFRRRFLSLMSFQFSKFSSTLALNILQNKSAKDDSTAV--LTSAELAATFTPYDLKRLEMYSRNMVDYHLIMDMIPVIARMHFLKQFGDISLSVAQSALLLGIGLQHKSVDELEKEIGL 888          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Zebrafish
Match: nat10 (N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1543])

HSP 1 Score: 138.658 bits (348), Expect = 7.026e-33
Identity = 183/849 (21.55%), Postives = 364/849 (42.87%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYN-LTQFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPF-------------QVFANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDHEKNEKETIMKELQK------------------QTELVELKNGKSLRI--------------VKLITQAKF----------------KKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDE-----AAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRD-KYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   +E ++  G+V+++             + ++ ++++ E   + + +F +RF   LS+    +V  +  N         N KP              Q   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A L+ I EA  +    + K+L   P +V+ + +  G+  TG ++  ++ +  R      ++  +  N + +    S  ++      ++   + +   I + Q D +E  LND+ CL      +          P P  C+L YV++ TLF  H A+E  L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E   +  +++I+  L +                   +E   L  G+ +RI              V  I   +F                 ++GYG   +++L +Y+    P         +  + S S  + S LE +   +     + +        ++DY+   +    +LL FWKK  F PV ++        E  C M+ D +    D  D+     A +++   R  +++         TL   +L N+  K + T +   T  +L +      LK+L  + +N+  +  + D+I  +A+++F +    ++L+      L+G GLQ KS  +L  E+ L
Sbjct:  108 YYN-----ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGIVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVIGRFNERFILSLSSCKSCVVIDDQLNILPISSHATNIKPIPPKKQDDGLSPREQELKDLKESLQDTQPVGVLVDGCKTMDQAKAVLKFIEAIS--------EKTLRSTVALT-AARGRGKSAALGLAMAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVVRVNIFKEHRQTIQYIHPADAVKLGQAELLVIDEAAAIPLPLVKKLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSSESQQNLSAENRNTSTARLAAA---RSLHEVTLHESIRYGQGDHVERWLNDLLCLDCLSVPRIISG-----CPLPQTCDLYYVNRDTLFCYHKASEAFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNSLPEVLAVLQVCLEG--EISRQSILSSLSRGKKASGDLIPWTVSEQFQDSEFAGLSGGRIVRIAVNPDYQGVNYFSFVLYIIPIRFIISMCCDIPRVIDFVILQMGYGTRALQLLQRYYEGQFPLWDEQEQTMTSAITSVSSEAVSLLEEVVSPRKDLPPLLLKLNERRAERLDYLGVSYGLTPQLLKFWKKAGFVPVYLRQTPNDLTGEHSCIMLKDLNSE--DSTDQNQWLSAFWKDFRRRFLSLMSFQFSKFSSTLALNILQNKSAKDDSTAV--LTSAELAATFTPYDLKRLEMYSRNMVDYHLIMDMIPVIARMHFLKQFGDISLSVAQSALLLGIGLQHKSVDELEKEIGL 921          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:NCBI gene;Acc:779537])

HSP 1 Score: 197.978 bits (502), Expect = 1.113e-51
Identity = 198/860 (23.02%), Postives = 387/860 (45.00%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFAN---------------IQIAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMIS---DCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   KL+    S  LN  E   F       +I Y  Y    E +++L   Y +C+++DFE+    L+   +E ++  G+V+L+             + ++ ++++ E   ++  +F +RF   L++    +V  +  N       +AN KP    A                + + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     SL YQ+      IQ  N     ++   +    H+  +++I          A LV I EA  +    +  ++   P +V+ + +  G+  TG ++  ++ +  R      ++ ++ +  T +    +  ++ +    +T   + +   I +   D +E  LND+ CL    DC  + +   +  P P  C+L Y+++ TLF  H A+E  L++ + +Y +   K S   L+ +SD PAHHLFCL  P    +  VP+VL +  + +E               +K   + I   + +Q +  +  +    R+V++     ++ +GYG   ++++  Y+    P +   A N    + S S  + S LE     +  +P LL+ ++  P    K+DY+   +    +LL FWK+  F PV ++        E  C M+    +      + +  A +++  +R  +++ +       +L   +L NR   N+    E  I   +L++ L    LK+L  + +N+  +  + D+I  +A++YF + + GL+L+      L+G GLQ KS  +L  E+ L
Sbjct:   59 YKKELGFSSNRKKKMRKLQKRIKSGSLNIKEDDPFELFVAATNIRYCYYN---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVLLLRTMSSLKQLYTMTMDVHSRYRTEAHQDVVVRFNERFILSLASCKTCMVIDDQLNILPISSHIANIKPIPPKAQDASLSPEEQELQDVKLSLQDTQPVGVLVENCKTLDQAKAVLKFIEAVS--------EKTLRSTVTLT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDSLQYQEHMDYEIIQSLNPEFEKAVVRVNVFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKNLM--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSADSQVTVTAENKSTASNRLASA---RTLHEVTLQESIRYAPGDPVEKWLNDMLCL----DC-MNISRIISGCPLPETCDLYYINRDTLFCYHKASESFLQRLMALYVASHYKNSPNDLQMMSDAPAHHLFCLLPPVPPTQNSVPEVLAVVQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDPDFGSLSGGRVVRIAVHPDYQGMGYGSRALRLVQMYYEGQFPCLEENATNKPQEITSVSSEAVSLLEESLTPRKNLPPLLLRLSERPAE--KLDYLGVSYGLTPKLLKFWKRAGFVPVYLRQTPNDLTGEHSCVMLKTLHEDEESDQEPWLTAFWKDFRKRFLSLLSYQFSTFAPSLALNILQNR---NIKKESENLISRSELEAGLTPYDLKRLEMYSRNMVDYHLIMDLIPSLARMYFLQQLGGLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:NCBI gene;Acc:779537])

HSP 1 Score: 197.978 bits (502), Expect = 1.139e-51
Identity = 198/860 (23.02%), Postives = 387/860 (45.00%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFAN---------------IQIAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMIS---DCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   KL+    S  LN  E   F       +I Y  Y    E +++L   Y +C+++DFE+    L+   +E ++  G+V+L+             + ++ ++++ E   ++  +F +RF   L++    +V  +  N       +AN KP    A                + + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     SL YQ+      IQ  N     ++   +    H+  +++I          A LV I EA  +    +  ++   P +V+ + +  G+  TG ++  ++ +  R      ++ ++ +  T +    +  ++ +    +T   + +   I +   D +E  LND+ CL    DC  + +   +  P P  C+L Y+++ TLF  H A+E  L++ + +Y +   K S   L+ +SD PAHHLFCL  P    +  VP+VL +  + +E               +K   + I   + +Q +  +  +    R+V++     ++ +GYG   ++++  Y+    P +   A N    + S S  + S LE     +  +P LL+ ++  P    K+DY+   +    +LL FWK+  F PV ++        E  C M+    +      + +  A +++  +R  +++ +       +L   +L NR   N+    E  I   +L++ L    LK+L  + +N+  +  + D+I  +A++YF + + GL+L+      L+G GLQ KS  +L  E+ L
Sbjct:   61 YKKELGFSSNRKKKMRKLQKRIKSGSLNIKEDDPFELFVAATNIRYCYYN---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVLLLRTMSSLKQLYTMTMDVHSRYRTEAHQDVVVRFNERFILSLASCKTCMVIDDQLNILPISSHIANIKPIPPKAQDASLSPEEQELQDVKLSLQDTQPVGVLVENCKTLDQAKAVLKFIEAVS--------EKTLRSTVTLT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDSLQYQEHMDYEIIQSLNPEFEKAVVRVNVFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKNLM--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSADSQVTVTAENKSTASNRLASA---RTLHEVTLQESIRYAPGDPVEKWLNDMLCL----DC-MNISRIISGCPLPETCDLYYINRDTLFCYHKASESFLQRLMALYVASHYKNSPNDLQMMSDAPAHHLFCLLPPVPPTQNSVPEVLAVVQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDPDFGSLSGGRVVRIAVHPDYQGMGYGSRALRLVQMYYEGQFPCLEENATNKPQEITSVSSEAVSLLEESLTPRKNLPPLLLRLSERPAE--KLDYLGVSYGLTPKLLKFWKRAGFVPVYLRQTPNDLTGEHSCVMLKTLHEDEESDQEPWLTAFWKDFRKRFLSLLSYQFSTFAPSLALNILQNR---NIKKESENLISRSELEAGLTPYDLKRLEMYSRNMVDYHLIMDLIPSLARMYFLQQLGGLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 888          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:NCBI gene;Acc:779537])

HSP 1 Score: 197.593 bits (501), Expect = 1.599e-51
Identity = 198/860 (23.02%), Postives = 387/860 (45.00%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFAN---------------IQIAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMIS---DCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   KL+    S  LN  E   F       +I Y  Y    E +++L   Y +C+++DFE+    L+   +E ++  G+V+L+             + ++ ++++ E   ++  +F +RF   L++    +V  +  N       +AN KP    A                + + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     SL YQ+      IQ  N     ++   +    H+  +++I          A LV I EA  +    +  ++   P +V+ + +  G+  TG ++  ++ +  R      ++ ++ +  T +    +  ++ +    +T   + +   I +   D +E  LND+ CL    DC  + +   +  P P  C+L Y+++ TLF  H A+E  L++ + +Y +   K S   L+ +SD PAHHLFCL  P    +  VP+VL +  + +E               +K   + I   + +Q +  +  +    R+V++     ++ +GYG   ++++  Y+    P +   A N    + S S  + S LE     +  +P LL+ ++  P    K+DY+   +    +LL FWK+  F PV ++        E  C M+    +      + +  A +++  +R  +++ +       +L   +L NR   N+    E  I   +L++ L    LK+L  + +N+  +  + D+I  +A++YF + + GL+L+      L+G GLQ KS  +L  E+ L
Sbjct:   59 YKKELGFSSNRKKKMRKLQKRIKSGSLNIKEDDPFELFVAATNIRYCYYN---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVLLLRTMSSLKQLYTMTMDVHSRYRTEAHQDVVVRFNERFILSLASCKTCMVIDDQLNILPISSHIANIKPIPPKAQDASLSPEEQELQDVKLSLQDTQPVGVLVENCKTLDQAKAVLKFIEAVS--------EKTLRSTVTLT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDSLQYQEHMDYEIIQSLNPEFEKAVVRVNVFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKNLM--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSADSQVTVTAENKSTASNRLASA---RTLHEVTLQESIRYAPGDPVEKWLNDMLCL----DC-MNISRIISGCPLPETCDLYYINRDTLFCYHKASESFLQRLMALYVASHYKNSPNDLQMMSDAPAHHLFCLLPPVPPTQNSVPEVLAVVQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDPDFGSLSGGRVVRIAVHPDYQGMGYGSRALRLVQMYYEGQFPCLEENATNKPQEITSVSSEAVSLLEESLTPRKNLPPLLLRLSERPAE--KLDYLGVSYGLTPKLLKFWKRAGFVPVYLRQTPNDLTGEHSCVMLKTLHEDEESDQEPWLTAFWKDFRKRFLSLLSYQFSTFAPSLALNILQNR---NIKKESENLISRSELEAGLTPYDLKRLEMYSRNMVDYHLIMDLIPSLARMYFLQQLGGLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:NCBI gene;Acc:779537])

HSP 1 Score: 197.208 bits (500), Expect = 2.081e-51
Identity = 198/860 (23.02%), Postives = 387/860 (45.00%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFAN---------------IQIAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMIS---DCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   KL+    S  LN  E   F       +I Y  Y    E +++L   Y +C+++DFE+    L+   +E ++  G+V+L+             + ++ ++++ E   ++  +F +RF   L++    +V  +  N       +AN KP    A                + + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     SL YQ+      IQ  N     ++   +    H+  +++I          A LV I EA  +    +  ++   P +V+ + +  G+  TG ++  ++ +  R      ++ ++ +  T +    +  ++ +    +T   + +   I +   D +E  LND+ CL    DC  + +   +  P P  C+L Y+++ TLF  H A+E  L++ + +Y +   K S   L+ +SD PAHHLFCL  P    +  VP+VL +  + +E               +K   + I   + +Q +  +  +    R+V++     ++ +GYG   ++++  Y+    P +   A N    + S S  + S LE     +  +P LL+ ++  P    K+DY+   +    +LL FWK+  F PV ++        E  C M+    +      + +  A +++  +R  +++ +       +L   +L NR   N+    E  I   +L++ L    LK+L  + +N+  +  + D+I  +A++YF + + GL+L+      L+G GLQ KS  +L  E+ L
Sbjct:   59 YKKELGFSSNRKKKMRKLQKRIKSGSLNIKEDDPFELFVAATNIRYCYYN---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVLLLRTMSSLKQLYTMTMDVHSRYRTEAHQDVVVRFNERFILSLASCKTCMVIDDQLNILPISSHIANIKPIPPKAQDASLSPEEQELQDVKLSLQDTQPVGVLVENCKTLDQAKAVLKFIEAVS--------EKTLRSTVTLT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDSLQYQEHMDYEIIQSLNPEFEKAVVRVNVFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKNLM--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSADSQVTVTAENKSTASNRLASA---RTLHEVTLQESIRYAPGDPVEKWLNDMLCL----DC-MNISRIISGCPLPETCDLYYINRDTLFCYHKASESFLQRLMALYVASHYKNSPNDLQMMSDAPAHHLFCLLPPVPPTQNSVPEVLAVVQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDPDFGSLSGGRVVRIAVHPDYQGMGYGSRALRLVQMYYEGQFPCLEENATNKPQEITSVSSEAVSLLEESLTPRKNLPPLLLRLSERPAE--KLDYLGVSYGLTPKLLKFWKRAGFVPVYLRQTPNDLTGEHSCVMLKTLHEDEESDQEPWLTAFWKDFRKRFLSLLSYQFSTFAPSLALNILQNR---NIKKESENLISRSELEAGLTPYDLKRLEMYSRNMVDYHLIMDLIPSLARMYFLQQLGGLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Match: nat10 (N-acetyltransferase 10 (GCN5-related) [Source:NCBI gene;Acc:779537])

HSP 1 Score: 197.208 bits (500), Expect = 2.086e-51
Identity = 203/865 (23.47%), Postives = 386/865 (44.62%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFAN---------------IQIAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQE--MCERVGTVILHDLWDTDV------TLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   KL+    S  LN  E   F       +I Y  Y    E +++L   Y +C+++DFE+    L+   +E ++  G+V+L+             + ++ ++++ E   ++  +F +RF   L++    +V  +  N       +AN KP    A                + + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     SL YQ+      IQ  N     ++   +    H+  +++I          A LV I EA  +    +  ++   P +V+ + +  G+  TG ++  ++ +  R      ++ ++ +  T +    +  ++ +    +T   + +   I +   D +E  LND+ CL    DC  + +   +  P P  C+L Y+++ TLF  H A+E  L++ + +Y +   K S   L+ +SD PAHHLFCL  P    +  VP+VL +  + +E               +K   + I   + +Q +  +  +    R+V++     ++ +GYG   ++++  Y+    P +   A N    + S S  + S LE     +  +P LL+ ++  P    K+DY+   +    +LL FWK+  F PV ++        E  C M+           DE + QE  +      +I+   + TD       +L   +L NR   N+    E  I   +L++ L    LK+L  + +N+  +  + D+I  +A++YF + + GL+L+      L+G GLQ KS  +L  E+ L
Sbjct:   59 YKKELGFSSNRKKKMRKLQKRIKSGSLNIKEDDPFELFVAATNIRYCYYN---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVLLLRTMSSLKQLYTMTMDVHSRYRTEAHQDVVVRFNERFILSLASCKTCMVIDDQLNILPISSHIANIKPIPPKAQDASLSPEEQELQDVKLSLQDTQPVGVLVENCKTLDQAKAVLKFIEAVS--------EKTLRSTVTLT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDSLQYQEHMDYEIIQSLNPEFEKAVVRVNVFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKNLM--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSADSQVTVTAENKSTASNRLASA---RTLHEVTLQESIRYAPGDPVEKWLNDMLCL----DC-MNISRIISGCPLPETCDLYYINRDTLFCYHKASESFLQRLMALYVASHYKNSPNDLQMMSDAPAHHLFCLLPPVPPTQNSVPEVLAVVQVCLEGEISRQSILSSLSRGKKASGDLIPWTVSEQFQDPDFGSLSGGRVVRIAVHPDYQGMGYGSRALRLVQMYYEGQFPCLEENATNKPQEITSVSSEAVSLLEESLTPRKNLPPLLLRLSERPAE--KLDYLGVSYGLTPKLLKFWKRAGFVPVYLRQTPNDLTGEHSCVMLKTLHE------DEESDQEPWLTAFWKVLIISIEFHTDFRNTFAPSLALNILQNR---NIKKESENLISRSELEAGLTPYDLKRLEMYSRNMVDYHLIMDLIPSLARMYFLQQLGGLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 885          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Mouse
Match: Nat10 (N-acetyltransferase 10 [Source:MGI Symbol;Acc:MGI:2138939])

HSP 1 Score: 156.377 bits (394), Expect = 1.699e-38
Identity = 184/858 (21.45%), Postives = 371/858 (43.24%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN-----NCVDTLANCKPFQVFANIQIA------------ESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-----YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   +L+    S  LN  +   F       +I Y  Y    E +++L   + +C+++DFE+    L+   +E ++  GLV+++             + ++ ++++ E   ++  +F +RF   L++    LV  +  +     + V ++    P     N+  A            ++ P+ +    C+T DQ  A+   I+ +         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      +Q  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R      ++  + ++ T +    +  ++ +    +T   + +   I +   DA+E  LND+ CL      +          P P  CEL YV++ TLF  H A+E+ L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  +       R+V++     ++ +GYG   +++L  Y+    P +      T   + + S  + S LE +   +     + +        ++DY+   +     LL FWK+  F PV ++        E  C M+   +    D  ++ A     +++   R   ++ +        L   ++ NR+    + L     E L++      LK+L  + +N+  +  + D+I  ++++YF   +  L+L+      L+G GLQ KS  +L  E+ L
Sbjct:   59 YKKELGFSSHRKKRMRQLQKKIKSGTLNLKQDDPFELFVAATNIRYCYYN---ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLDILPISSHVASIEALPPQAPDENLSPAALELLELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGIS--------EKTLRSTVALT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIVQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSAQSQVSTTAENKTTTTARLASA---RTLHEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSG-----CPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVVQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGKFPCLEEKVLETPQEIRTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLADE--DEAEQGAWLAAFWKDFRRRFLALLSYQFSTFSPALSLNIIQNRN-VAKSALPALGREHLEALFLPYDLKRLEMYSRNMVDYHLIMDLIPAISRLYFLNQLGDLSLSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9W3C1|NAT10_DROME (RNA cytidine acetyltransferase OS=Drosophila melanogaster OX=7227 GN=l(1)G0020 PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 8.071e-51
Identity = 192/811 (23.67%), Postives = 343/811 (42.29%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCK------------PF----------------------------QVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS--IQIRNQN----RSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYF------MQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMI--SDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRD-KYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEM 2451
            E + VL + Y VC+++DFE+    L+   +E ++  GL+IL+    T +  +++        KRF     T+A   VT       + +LA+CK            P                             +    +Q A +  + LC+T DQ +A+   I++L        V +QL+  +SL    +GRGK+ A+ L +A+A+ +G  +IYV +P  ++L +   F+     +L YQ+ +    IR+ N    ++I     + +S   +++I          A L+ I EA  +    + K++   P +V+ + +  G+  TG ++  ++                            I Q+    DN     + +   I + +ND +E  L ++ CL                 P P  CEL YVD+  LFS H AAE  L + + IY S   K +   L+ +SD PAHHLFCL  P +    +P++L +  +++E               +K   + I   + +Q    +      +RIV++ T   ++++GYGK  +++L  Y+      +++ P VA+         + + +LS    +     ++P LL  ++     P  +DYI   +    ELL FWK   F PV +   S    +E  C M+   + +  +G       YQ+   RV  ++     + +  L   +L N+      + LK      L  +     L++L S+ +    F  + D++  +AQ+YF   I GL L    +  L+  G+Q K+   L  E+
Sbjct:  106 ETHAVLGRTYGVCVLQDFEALTPNLLARTVETVEGGGLIILLLK--TLQSLKQLYTMSMDVHKRF----RTEAHQTVTCRFNERLILSLADCKRCLVVNDDLTVLPLSSKTINVEPVNPAGAGRSPNEASLKELKESLLTVQPAGAL-VNLCKTYDQANAVAQFIEAL--------VDKQLKPPMSLT-AARGRGKSAALGLSIAAAVAFGYVNIYVTSPHPENLITLFEFVLKGFDALEYQEHADYTIIRSTNADYKKAIIRINITRSSRQTIQYIAPSDTHLLNAADLLLIDEAAAIPLPLVKKMI--GPYLVFMASTINGYEGTGRSLSLKL----------------------------ISQLQK--DNNARPPLKLEESIRYQENDDIEKWLINLLCLDASTVPSISSG-----CPTPDACELYYVDRDALFSYHKAAEAFLHRLVSIYVSSHYKNTPNDLQMMSDAPAHHLFCLLGPVQRMDALPEILVVIQVALEGQISAQSISDSLGRGKKAAGDLIPWNVAEQYGDRDFPKLCGVRIVRVATHPNYQRMGYGKRAIQLLKDYYARKHTNLEDGP-VASKDAGKGIEEVEEEELSLLKEQIRPRSRIPTLLQRLHER--VPEHVDYIGTSYGLTTELLKFWKNAGFVPVYLSQKSNELTAEHSCIMLHTPNATPWLG-----LYYQDFRRRVLKLMGKTFREFETKLCLALLKNKSVDTEGSALKVLDKPMLDVYFLPHDLQRLESYARQQSEFRLIIDLLTDIAQLYFQGRIDGLQLDLVQQGILLALGVQGKTVDALGLEL 855          
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Match: sp|Q55EJ3|NAT10_DICDI (RNA cytidine acetyltransferase OS=Dictyostelium discoideum OX=44689 GN=nat10 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.648e-46
Identity = 186/834 (22.30%), Postives = 366/834 (43.88%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYN--LTQFTKRFYSQLSTKADLLVTRN------IANNCVDTLANCKPFQVFANIQIAE-----------SYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTH----KVRFIDFR-----------QNFAKY-DAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP--SENKKYVPQVLCIAHISIEDHEKNEK--ETIMKELQKQTELV-----------ELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYF---MQNPPAV----------AAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVG-----DRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGL------KECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            E++++L   + + +++DFE+    L+   IE ++  GL++L+             + ++ T+ + E S    + +F +RF   L      LV  +      I++      A  +  +    +++ E              I+  +T DQ +AL + IDS+         ++ LRS+V+L  G +GRGK+ A+ L +++A+ +G ++I+V +P+ ++L +  +F+     S+ Y +           +  EL   T+       +R   FR           Q++ K   A LV I EA  +    +  +L   P +V+ S +  G+  TG ++  ++ +  R  + +   ++N  N+ +           N I  +    I +  PI ++  D +E  LN++ CL   I       +     P PS C+L YV++ TLFS H A+E  L+K +G++ S   K S   L  +SD P HHLF L  P    N   +P++LC   +S+E     E    +I +  Q   +L+           +      +RIV++ T   ++K+GYG   +++L +Y+   + N   V              +  S  + +  + + S L  +   K  +P LL  ++     P K+ Y+   +    +L  FW K  + PV ++  S     E  C M+ + +         D + ++ +Q+  +R   ++ ++  + + ++   +L+ +   N   +       E T  +++       LK+L S+  NI  +  V D++  ++++YF+  +   +++      L+  GLQ K+   L  E+ L
Sbjct:  109 ESHKILGNTFGMLVLQDFEAITPNLLARTIETVEGGGLIVLLLKTMDSLKQLYTMTMDVHTRFRSENSKGEVVCRFNERFLLSLGKSEQCLVMDDELNILPISSQSRSIEAKQQILETPEQVELREFKQQVKDTDIAGALIENTKTMDQATALLTFIDSIS--------EKTLRSTVTLTAG-RGRGKSAALGLAISAAVAFGYSNIFVSSPTPENLNTLFQFVFKGFDSMEYVEH----------VDYELVKSTNPEFHDAIIRVNIFRSHRQTIQYIQPQDYQKLGQAELVVIDEAAAIPLPLVKNLLG--PYLVFMSSTINGYEGTGRSLSLKLIKQLREQSTV---VSNSSNKAL-----------NSITGRMLREIELNEPIRYSARDPIERWLNELLCLDSTI-----AKSSPTGCPHPSACQLYYVNRDTLFSYHKASEAFLQKMVGLFVSSHYKNSPNDLLLMSDAPDHHLFVLLGPIDENNTTGLPEILCAVQVSLEGEIAKESILNSIKRGYQASGDLIPWTLTQQYQDEDFPRLSGVRIVRIATHPDYQKMGYGSKALELLTQYYQGEITNLDEVNQEEEEEDEEKVDQNKGSSKISTVKKDNASLLTEVIRPKSNIPPLLFKLSER--KPEKLHYMGVSYGLTQQLYQFWSKSKYLPVYLRLTSNDITGEHTCIMLRELNNEQNNTICKDGWLQSFHQDFKKRFINLLGYEFRNFNSSIALNILYEKKVNNTVAVASSTTKNELTQNEMELLFSSYDLKRLESYSNNIVDYHVVIDLLPSLSKLYFTNKLKIEDISLIQSAILLALGLQHKTVDNLIGELNL 900          
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Match: sp|O01757|NAT10_CAEEL (RNA cytidine acetyltransferase OS=Caenorhabditis elegans OX=6239 GN=nath-10 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.540e-42
Identity = 200/840 (23.81%), Postives = 368/840 (43.81%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFESKME-LIQCFIENIQANGLVIL-------------ISNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRN------IAN---NCVDTLANCKPFQVFANIQIA-------ESYPI----KLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRN-------------QNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCL-----QRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIE-----DHEKNEKETIMK---ELQKQT---ELVELKNGK--SLRIVKLITQAKFKKLGYGKHMVKMLHKYFM-------QNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-------YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIE--DLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISG-LNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E  ++L   + V +++DFE+    L+   IE I+  G+VIL             IS ++  +++ E    +T +F +RF   L++ + +LV  +      I++   N     A+ K  Q  ++ ++A       E+ PI       +T+ Q  AL   +D +         ++Q   + SL  G +GRGK+ A+ L +A AI +G T+I+V +PS ++L +   F+     +L YQ+ +    IQ  N             +    +++  SPT   K+   +           L+ I EA  +    + +++S  P + + S +  G+  TG ++  ++ +  R  +  GE           K G S    +NK   KT   ++M   I +   D +E  LN + CL     Q +++C           P P+ CEL  V++ TLFS H A+E  L++ + I+ S   K S   L+ LSD PAH+LF L  P  +++K +P+VL +  + +E     D+ +N  E+  +   +L   T   + ++ + G     RIV++     ++ +GYG   V+++ +Y++       +   A A  +      V     +            +P LL  ++     P ++DY+   F     LL FWK+  F PV I+  S     E  C ++        D  +E +       ++E   R+  ++  D       +   +L  ++K+    +K   IE  +L   L    L++++ + +N+     + DI+  VA++ F + +   L LA      L+  GLQ K  + ++ E+ L
Sbjct:  105 YYN-----ETEKILGNTFGVLVLQDFEAMTPNLLARTIETIEGGGMVILLMQSVRSLRQLYTISMDVHNRYRTEAHNEITARFNERFILSLASCSSVLVLDDQLRVLPISSHIENVEAIPASQKKIQSESDAELASLKEAMKETKPIGPLLSRARTACQAKALLRFLDVI--------TEKQSNVTCSLTAG-RGRGKSAAVGLSLAGAIAFGYTNIFVTSPSPENLKTLFEFVVKGFDALDYQEHTDYELIQSANPEFKNCLVRINVFREHKQTIQYISPTDVQKLGQCE-----------LIVIDEAAAIPLPLVKELIS-GPYISFLSSTINGYEGTGRSLSLKLLQQLRQQSAGGEA----------KEGKS---ASNK--GKTLHEMHMEESIRYKPGDKIEKWLNRLLCLDATNCQLKLECG---------TPPPAACELYIVNRDTLFSFHDASEAFLQQVMAIFVSAHYKNSPNDLQMLSDAPAHNLFVLMAPIDKSRKTIPEVLAVVQVCLEGRLDSDNIQNGLESGKRAAGDLLPWTVSQQFMDKQFGTLCGGRIVRVAVHPDYQSMGYGGRAVQLIEQYYLGLATSLDEEEKAPAPPSKTVIKQVKDGHTVELLEERIEPRADLPPLLQRLDER--KPERLDYLGVSFGLTVPLLKFWKRNEFVPVYIRQNSNDITGEHTCIILKGLEHGGSDSDEEPSATWLPVYWREFRRRIVNLLSFDFSSFPAQMALSLLQLKNKHVEKQMKRLVIERSELAIHLSNTDLRRMSQYGRNMVDSHIITDILPIVAKLNFEQRLPQELKLAVTQSAILLARGLQHKHFEDISKELDL 892          
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Match: sp|P87115|NAT10_SCHPO (RNA cytidine acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nat10 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 5.655e-39
Identity = 186/836 (22.25%), Postives = 363/836 (43.42%), Query Frame = 1
Query:   76 YRIDLVSF-SKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFANIQ----------------------IAESYP----IKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSS----IQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENK-KYVPQVLCIAHISIEDHEKNEKETIMKELQKQ------------TELVELKNGKSL---RIVKLITQAKFKKLGYGKHMVKMLHKYF-------MQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLF---NRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFS 2352
            Y+ DL+ F S   K  +K+K      + +   +  F    +  +I Y  Y+   E+ ++L + Y + +++DFE+    L+   IE ++  G+V+L+             S +I ++++ E   ++T +F +RF   L    + LV        +D   N  P     N++                      + E +P    + + +T DQ  A+ + ++S+        V++ L+ +VSL  G +GRGK+ A+ L +A+AI +G ++I++ +PS ++L +   F+     +L Y++      IQ  N     ++   +    H+  +++I    +     A LV I EA  +    + K++   P +V+ + +  G+  TG ++  ++ +  R  + I     N+ +++            + I  +T   I +  PI +   D +E  LN + CL       +        +P PS C L  V + TLFS H  +E  L++ + +Y +   K S   L+ +SD PAH LF L  P + K   +P  +C+  +++E      +E+IM  L +             ++  + +N  +L   RIV++    +  K+GYG   +++LH+YF        +   AV  +        +  + L    +     + MP LL+ ++ L   P  + Y+   +     L  FWK+  + P+ ++  +     E  C M+    GR  +     A Q    R  +++ +   +        VL    N  KY +    + T E++ +  +   LK+L S+  N+  +  + D++  +A +YFS
Sbjct:   59 YKKDLLGFTSHRKKRENKIKKEIKRGIRDPNSEDPFELFCSITNIRYCYYK---ESEKILGQTYGMLVLQDFEALTPNLLARTIETVEGGGIVVLLLHKLNSLKQLYTMSMDIHSRYRTEAHSDVTARFNERFILSLGNCENCLV--------IDDELNVLPISGGKNVKALPPTLEEDNSTQNSIKELQESLGEDHPAGALVGVTKTLDQARAVLTFVESI--------VEKSLKGTVSLTAG-RGRGKSAALGLAIAAAIAHGYSNIFITSPSPENLKTLFEFIFKGFDALNYEEHVDYDIIQSTNPAYHNAIVRVNIFRDHRQTIQYISPEDSNVLGQAELVVIDEAAAIPLPLVRKLIG--PYLVFMASTINGYEGTGRSLSLKLLQQLREQSRIYSGSGNNKSDS-----------QSHISGRTLKEISLDEPIRYAMGDRIELWLNKLLCLDA---ASYVSRMATQGFPHPSECSLYRVSRDTLFSYHPISEAFLQRMMSLYVASHYKNSPNDLQLMSDAPAHQLFVLLPPVDLKNPKLPDPICVIQLALEG--SISRESIMNSLSRGQRAGGDLIPWLISQQFQDENFAALGGARIVRIAVSPEHVKMGYGTRAMQLLHEYFEGKFISASEEFKAVKHSLKRIGDEEIENTALQTEKIHVRDAKTMPPLLLKLSELQPEP--LHYVGVSYGLTPSLQKFWKREGYCPLYLRQTANDLTGEHTCVMLRVLEGRDSEWLGAFA-QNFYRRFLSLLGYQFREFAAITALSVLDACNNGTKYVVNSTSKLTNEEINNVFESYDLKRLESYSNNLLDYHVIVDLLPKLAHLYFS 853          
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9H0A0|NAT10_HUMAN (RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 1.003e-38
Identity = 181/817 (22.15%), Postives = 362/817 (44.31%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVIL-------------ISNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--------NCVDTLANCKPFQVF--ANIQIAE-------SYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSH--HVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAA-----YQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTI--EDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   +E ++  GLV++             ++ ++ ++++ E   ++  +F +RF   L++    LV  +  N          ++ L    P +    +++++ E       + P+ +    C+T DQ  A+   I+ +         ++ LRS+V+L    +GRGK+ A+ L +A A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R      ++  + ++ T +    +  ++ +    +T   + +   I +   DA+E  LND+ CL      +          P P  CEL YV++ TLF  H A+E+ L++ + +Y +   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E               +K   + I   + +Q +  +       R+V++     ++ +GYG   +++L  Y+    P +      T    H +S   +S         + +P LL+ +N  P    ++DY+   +     LL FWK+  F PV ++        E  C M+   +    D  D+       +++   R   ++ +       +L   ++ NR   NM    +  +  E+L++      LK+L  + +N+  +  + D+I  +++IYF   +  L L+      L+G GLQ KS  +L  E+ L
Sbjct:  106 YYN-----ETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGIS--------EKTLRSTVALT-AARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQ-----QSAQSQVSTTAENKTTTTARLASA---RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSG-----CPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAE--RLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDE--DEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNR---NMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Match: A0A224XDX0 (Putative conserved plasma membrane protein (Fragment) OS=Panstrongylus lignarius OX=156445 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 9.038e-58
Identity = 197/802 (24.56%), Postives = 358/802 (44.64%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITT-------------KHKREISYNLT-QFTKRFYSQLSTKADLLVT----------------RNIANNCVDTLANCKPFQVFANIQIAE--SYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRN--QNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFY---PEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYV-PQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXX-XXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTG-LKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            E  ++L + + VC+++DFE+    L+   IE ++  GLVIL+   +T+             +++ E   ++  +F +RF   LS+    LV                 +++ +N +   ++    ++  N++  +  S  I  C+T DQ  A+   ID++         ++ LR +VSL    +GRGK+ A+ + VA AI +G ++I+V +PS  +L +F  F+      LGYQ+      +Q  N   N+++       T+   +++I    +     A L+ I EA  +    +  +  F P +++ S +  G+  TG ++  ++ +  R  +    T +ND + T  K              +T   I +   I +   DA+E  L ++ CL        D  N    +   P PS C+L Y+++ TLF  H A+E  L K + +Y S   K S   L+ +SD PAHHLFCL  P + KK V P+VLC+  + +E                K   + I   +  Q +  E      LRIV++ T   ++ +GYG   + +L+ Y+    P +      T      ++   +  +        +P LL+ +     AP K+DY+   +     LL FWKK +F PV ++  S     E  C M+   S      +    + +   R  +++ +       +L   V+FN+ + +M+  LK+   E+L   +    LK+L  +  N+  +  + D++  +A+++F   +  +         LVG GLQ K+  ++A E+ L
Sbjct:  109 ETQKILGQTFGVCVLQDFEAITPNLLARTIETVEGGGLVILLLRTLTSLKQLYDMTMDVHERYRTEAHTDVVGRFNERFLLSLSSCKRCLVVDDQLKILPISSHVFDIQSMPDNAIVNQSDEDLKKLQDNLRDTQPVSSLINCCKTLDQAKAVLKFIDAIS--------EKSLRYTVSLT-AARGRGKSAALGIAVAGAIAFGYSNIFVTSPSPDNLKTFFEFVFKGFDVLGYQEHLDYGLVQSTNVEHNKALIRVNVFKTNRQTIQYISPLDSNKLSHAELLVIDEAAAIPLPYVKNM--FGPYLIFLSSTINGYEGTGRSLSLKLLQELRKQS----TGSNDASNTPSK--------------RTLYEITLEESIRYKPGDAVEQWLTELLCL--------DATNSERLWSGVPSPSECDLYYINRDTLFCFHKASEAFLHKIMALYVSSHYKNSPNDLQLMSDAPAHHLFCLLGPVDPKKTVLPEVLCVIQVCLEGQISKRSVNVSLSHGNKPTGDLIPWTIAHQFQDDEFPTLSGLRIVRIATHPDYQSMGYGARALSLLNDYYSLKIPVLDDLKTTTGQQRNDRNGEEDLYNEIIEPRSSLPPLLMKLGER--APEKLDYLGVSYGLTLPLLRFWKKADFVPVYLRQTSNDLTGEHSCIMLKSLSENENASWLNQYWLDFRRRFISLLSYQFRVFTTSLALGVIFNKQEKDMSSCLKK---EELDCHITKYDLKRLELYCNNVADYHLIMDLMPSLAKLFFLDQLGHIKCTAIQLALLVGVGLQHKTVDEVAKELDL 868          
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Match: A0A069DZP1 (Putative conserved plasma membrane protein (Fragment) OS=Panstrongylus megistus OX=65343 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 1.621e-57
Identity = 197/814 (24.20%), Postives = 355/814 (43.61%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITT-------------KHKREISYNLT-QFTKRFYSQLSTKADLLVT----------------RNIANNCV------------DTLANCKPFQVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRN--QNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFY---PEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYV-PQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPA---VAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNM-TGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            E  ++L + + VC+++DFE+    L+   IE ++  GLVIL+   +T+             +++ E   ++  +F +RF   LS+    LV                 +++ +N +            DTL + +P     N           C+T DQ  A+   ID++         ++ L+ +VSL    +GRGK+ A+ + VA AI +G ++I+V +PS  +L +F  F+      LGYQ+      +Q  N   N+++       T+   +++I    +     A L+ I EA  +    +  +  F P +++ S +  G+  TG ++  ++ +  R  +    T +ND + T  K              +T   I +   I +   DA+E  L ++ CL        D  N    +   P PS C+L Y+++ TLF  H A+E  L K + +Y S   K S   L+ +SD PAHHLFCL  P + KK V P+VLC+  + +E                K   + I   +  Q +  E      LRIV++ T   ++ +GYG   + +L+ Y+    P    +    D   +      +    +        +P LL+ +     AP K+DY+   +     LL FWKK +F PV ++  S     E  C M+   S      +    + +   R  +++ +       +L   V+FN+ + ++ +GLK+   E+L   +    LK+L  +  N+  +  + D++  +A+++F   +  +         LVG GLQ K+  +++ E+ L
Sbjct:  109 ETQKILGQTFGVCVLQDFEAITPNLLARTIETVEGGGLVILLLRTLTSLKQLYDMTMDVHERYRTEAHTDVVGRFNERFLLSLSSCKRCLVVDDQLKILPISSHVFDIQSMPDNGIVNQSDEDLKKLQDTLRDTQPVSSLINC----------CKTLDQAKAVLKFIDAIS--------EKSLKYTVSLT-AARGRGKSAALGIAVAGAIAFGYSNIFVTSPSPDNLKTFFEFVFKGFDVLGYQEHLDYGLVQSTNVEHNKALIRVNVFKTNRQTIQYISPLDSNKLSHAELLVIDEAAAIPLPYVKNM--FGPYLIFLSSTINGYEGTGRSLSLKLLQELRKQS----TGSNDASNTPSK--------------RTLHEITLEESIRYKPGDAVEQWLTELLCL--------DATNSERLWSGVPSPSECDLYYINRDTLFCYHKASEAFLHKIMALYVSSHYKNSPNDLQLMSDAPAHHLFCLLGPVDPKKTVLPEVLCVIQVCLEGQISKRSVNVSLSHGNKPTGDLIPWTMAHQFQDDEFPTLSGLRIVRIATHPDYQSMGYGARALSLLNDYYSLKIPVLDDLKTTTDQQRNVFSRNGEEDLYNEIIEPRSSLPPLLMKLGER--APEKLDYLGVSYGLTLPLLRFWKKADFVPVYLRQTSNDLTGEHSCIMLKSLSENENASWLNQYWLDFRRRFISLLSYQFRVFPTSLALGVIFNKQEKDVSSGLKK---EELDYHITKYDLKRLELYCNNVADYHLIMDLLPSLAKLFFLDQLGHVKCTAIQLALLVGVGLQHKTVDEVSKELDL 870          
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Match: A0A0V0GAB4 (Putative conserved plasma membrane protein (Fragment) OS=Triatoma dimidiata OX=72491 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.104e-56
Identity = 193/803 (24.03%), Postives = 355/803 (44.21%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITT-------------KHKREISYNLT-QFTKRFYSQLSTKADLLVT----------------RNIANNCVDTLANCKPFQVFANIQIAE--SYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRN--QNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFY---PEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYV-PQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPA---VAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            E  ++L + + VC+++DFE+    L+   +E ++  GLVIL+   +T+             +++ E   ++  +F +RF   LS+    LV                 +++ +N +   ++    ++  N++  +  S  I  C+T DQ  A+   ID++         ++ LR ++SL    +GRGK+ A+ + VA AI +G ++I+V +PS  +L +F  F+      LGYQ+      +Q  N   N+++       T+   +++I    +     A L+ I EA  +    +  +  F P +++ S +  G+  TG ++  ++ +  R  +    T +ND + T  K              +T   I +   I +   DA+E  L ++ CL        D  N    +   P PS C+L Y+++ TLF  H A+E  L K + +Y S   K S   L+ +SD PAHHLFCL  P + KK V P+VLC+  + +E                K   + I   +  Q +  E      LRIV++ T   ++ +GYG   + +L+ Y+    P    +    D   +      +    +        +P LL+ +     AP K+DY+   +     LL FWKK +F PV ++  S     E  C M+   S      + +  + +   R  +++ +       +L   V+FN+ + +++       E+L   +    LK+L  +  N+  +  V D++  +A+++F   +  +         LVG GLQ K+  ++A E+ L
Sbjct:  109 ETQKILGQTFGVCVLQDFEAITPNLLARTVETVEGGGLVILLLRTLTSLKQLYDMTMDVHERYRTEAHTDVVGRFNERFLLSLSSCKRCLVVDDQLKILPISSHVFDIQSMPDNGIVNQSDEDLKKLQDNLRDTQPVSSLINCCKTLDQAKAVLKFIDAIS--------EKSLRYTLSLT-AARGRGKSAALGIAVAGAIAFGYSNIFVTSPSPDNLKTFFEFVFKGFDVLGYQEHLDYGLVQSTNVEHNKALIRVNVFKTNRQTIQYISPLDSNKLSHAELLVIDEAAAIPLPYVKNM--FGPYLIFLSSTINGYEGTGRSLSLKLLQELRKQS----TGSNDASNTPSK--------------RTLYEITLEESIRYKPGDAVEQWLTELLCL--------DATNSERLWSGVPSPSECDLYYINRDTLFCYHKASEAFLHKIMALYVSSHYKNSPNDLQLMSDAPAHHLFCLLGPVDPKKTVLPEVLCVIQVCLEGQISKRSVNVSLSHGNKPTGDLIPWTIAHQFQDDEFPTLSGLRIVRIATHPDYQSMGYGARALSLLNDYYSLKIPVLDDLKTTTDQQGNDFSKNGKEDLYNEIIEPRSSLPPLLMKLGER--APEKLDYLGVSYGLTLPLLRFWKKADFVPVYLRQTSNDLTGEHSCIMLKSLSETENASWLKQYWLDSRRRFISLLSYQFRVFPTSLALGVIFNKQEKDISSC--VKKEELDYHITKYDLKRLELYCNNVADYHLVMDLMPSLAKLFFLDQLGHIKCTAIQLALLVGVGLQHKTVDEVARELDL 870          
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Match: A0A1D2NJL5 (N-acetyltransferase 10 (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_01280 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.872e-54
Identity = 177/804 (22.01%), Postives = 354/804 (44.03%), Query Frame = 1
Query:  235 ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPFQVFANIQIAESYPIK-----------------LCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTHKVRFI-DFRQNFA--------KYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSE-NKKYVPQVLCIAHISIEDH--EKNEKETIMKELQKQTELV-----------ELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADN-TSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQE----MCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEM 2451
            E  ++L   + +C+++DFE+    L+   IE ++  G+++L+             + ++ ++++ E   ++  +F +RF   L +    +V  +  N        AN  P +   N + +E+  +K                  C+T DQ  A+   ID++         ++ L ++VSL    +GRGK+ A+ L +A+A+ +G ++IYV +PS ++L +   F+     +L YQ+       Q+ +   + A      +V F  D RQ           K     + +I+      + + K L F P +++ S +  G+  TG ++  ++ +  R    + E       +  +K+G       NKI  ++   + +   I +   D++E  L ++ CL   +             P P +CEL Y+ + TLFS H A+E+ L++ + +Y +   K S   L+ +SD PAHHLFCL  P + N+K +P+VLC+  I +E    +++ K+ + +  +   +L+           +  +    R+V++ T   ++ +GYG   +++L +Y+      V+  + +  S  +          +      +     + +     AP  I Y+   +    +LL FWK+    PV ++        E  C MI      V  +   +  QE     C R  +++ +        L   +L N++ Y     KE +  +LQ  +    +K+L  + +N+  +  + D++  +A++YF+  +  L ++      ++G GLQ K+   LA E+
Sbjct:  109 ETYKILGNTFGMCVLQDFEALTPNLLARTIETVEGGGIIVLLLRSVNSLKQLYAMTMDVHSRYRTEAHQDVVGRFNERFILSLGSCEKCIVMDDSLNILPLSSYAANISPVETNYNEETSEALELKSLQESLQDTQPVGVLVNRCKTLDQAKAVLKFIDAIS--------EKSLNATVSLT-AARGRGKSAALGLSIAAAVAFGYSNIYVTSPSPENLKTLFEFVFKGFDALEYQEHIDYDLTQSTNPDFQKA----IVRVNFFRDHRQTIQYIHPADAQKLGQAELLVIDEAAAIPLPLVKAL-FGPYLIFLSSTINGYEGTGRSLSLKLIQQLREHGSVAE-------KGSEKTG-------NKISGRSLHELTLEESIRYKPGDSVERWLTNLLCLDATLTPPLTSG-----CPPPRDCELFYISRDTLFSYHKASEMFLQQIMSLYVASHYKNSPNDLQLMSDAPAHHLFCLLGPVDPNRKALPEVLCVLQICLEGEISKRSIKDGLQRGKRASGDLIPWTVAQQFQDDDFPSLSGARVVRIATHPDYQGMGYGSRAIELLQQYYENKMVDVSEGSGSFVSEEIDPTEDHELGIVTETVAPRKNLPPLLLKLTERAPEGIHYLGVSYGMTLQLLKFWKRLGLLPVYLRQTPNDLTGEHSCIMIKILESPVMQKLSSSWLQEYFRDFCRRFISLLGYQFRTFSPALALSILQNKN-YTSVDSKEISQTELQVHVTPYDVKRLELYARNMTDYHVIMDLVPMLAKLYFTNKMGDLRVSAVQSAIMLGLGLQHKTVDDLAKEL 878          
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Match: A0A016VPI7 (RNA cytidine acetyltransferase OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0006.g2859 PE=3 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 2.206e-53
Identity = 204/839 (24.31%), Postives = 369/839 (43.98%), Query Frame = 1
Query:  154 LNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEITT----------KHKREISYNLTQ----FTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFANIQIAESYP-IKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSS--------------------VSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTG---TTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQR-RIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH--EKNEKETIMKELQKQTELVELKNGKSL-----------RIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAI-SP--SEMECTMISDCSGRV---GDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKE----CTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHIS-GLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            ++EG+  + + S       Y+N  QNI     L   Y + +++DFE+    L+   IE I+  G+++L+   + +           H R  + + TQ    F +RF   L++  D++V        VD   +  P  + ++I   E  P       S  E+ L++L D +++   +  +  + R++                       I   +GRGK+ ++ L +A A+ +G ++I+V +PS ++L +   F+     ++GYQ+      IQ  N     +L   +    H+  +++I          A LV + EA  +  + + K L F P +V+ S +  G+  TG   +    +  R     +  GE L           G  + ++T            M   I +   D +E  LN + CL    I+ K          P PS CEL +V++ TLFS H A+E  L++ + IY +   K S   L+ LSD PAHHLF L  P  E++  VP+VL +A + +E +  E+  +  I    +   +L+     +             R+V++     F+ +GYG   +++L +Y++ + P++      T   V   + ++    +      +P LL+ ++     P ++DY+   F    +LL FWKK  F PV ++   SP   E  C M+      V      +  A +QE  +R+ +++  +     + L   +L  R+K  +  LK      T E L  FL    LK+L+ F +N+   + + D++  ++Q+YF   ++ G+ L+      L+G GLQ KS + +  E+ L
Sbjct:   84 ISEGDPFEVFISTTKIRYCYYNETQNI-----LGNTYGMLVLQDFEALTPNLLARTIETIEGGGIIVLLMKTVNSLRQLYTIAMDVHNRYRTESHTQIVARFNERFILSLASCRDIVV--------VDDQLHILP--ISSHITSLEPVPQSSKGALSPSEAELKALKDGMKDTKPIGPLLNKCRTACQGKALLRLLDVITDKDLNVTCSITAARGRGKSASLGLALAGAVAFGYSNIFVTSPSPENLKTLFEFVVKGFDTMGYQEHIDYELIQSTNPEFQKALVRVNVFREHRQTIQYIHPSDAGKLGQAELVVVDEAAAIP-LPLVKELIFGPYIVFLSSTINGYEGTGRSLSLKLLQQLRQQSAGSAKGEKL-------ATSKGRKLHELT------------MEESIRYKPGDEIEQWLNRVLCLNAANINTKLSCGT-----PPPSECELYFVNRDTLFSFHKASESFLQQIMAIYVAAHYKNSPNDLQMLSDAPAHHLFALMSPVKEDQSSVPEVLALAQVCLEGNLSEETVRGAIGSGKRAAGDLLPWTISQQFMDREFPTLCGGRVVRIAVHPDFQSMGYGSRTLELLEEYYLGHIPSIEENVKETVKTVKDGNTVALLEEQIAPRTDLPPLLMRLSER--KPERLDYLGVSFGLTLDLLKFWKKSGFVPVYLRQTPSPLTGEYTCAMLKRLHAEVDPSSSSWLAAYFQEFRKRLISLLSFEFEKLPINLGLSLLQTRNKEVVAALKNDRKVITREQLSMFLSNVDLKRLSEFARNLVDHQMITDLLPIISQLYFGDRLNEGVKLSTAQAAVLLGLGLQHKSAETVQEELDL 880          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Cavefish
Match: nat10 (N-acetyltransferase 10 [Source:NCBI gene;Acc:103034875])

HSP 1 Score: 179.489 bits (454), Expect = 5.299e-46
Identity = 181/811 (22.32%), Postives = 365/811 (45.01%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPF-------------QVFANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGD-RFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   Y +C+++DFE+    L+   +E ++  G+V+++             + ++ ++++ E   ++  +F +RF   LS+    +V  +  N       +AN KP              Q   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L VA A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    + K+L   P +V+ + +  G+  TG ++  ++ +  R  +   +   +  N T   + ++          ++   + ++  I +   D +E  LN++ CL    DC     +  +  P P  C+L YV++ TLF  H A+E  L++ + +Y +   K S   L+ LSD PAHHLFCL  P S     +P+VL +  + +E               +K   + I   + +Q +  E       R+V++     ++ +GYG   +++L  Y+    P +      T+  + S S  + S LE +   +  +P LL+ ++       ++DY+   +    +LL FWKK  F PV ++        E  C M+ + +    + ++  A +++   R  +++ +        L   +L N+ K            +L +      LK+L  + +N+  +  + D++  VA+++F + +  ++L+      L+G GLQ K+   L  E+ L
Sbjct:  108 YYN-----ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVVGRFNERFILSLSSCQTCVVIDDQLNVLPISKHIANVKPVPPKNQEEGQSSGEQELQDLKESLQDTQPVGVLVDCCKTMDQAKAVLKFIEAIS--------EKTLRSTVALT-AARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDALQYQEHLDYEIIQSLNPEFNKAVVRVNIFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKKLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSADSQQSLSAENRTTSTARLAA--------ARSLHEVSLSESIRYAPGDPVEKWLNELLCL----DC-LSVPHIISGCPLPETCDLYYVNRDTLFCYHKASEAFLQRLMALYVASHYKNSPNDLQLLSDAPAHHLFCLLPPVSPTHNSLPEVLAVVQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDAEFGGLSGGRVVRIAVNPDYQGMGYGSRALQLLELYYKGQFPVLDERERPTASKITSVSSEAVSLLEEVVSPRTDLPPLLLKLSERTAE--RLDYLGVSYGLTPQLLKFWKKAGFVPVYLRQTPNDLTGEHSCVMLKELNTEDSEGQWLPAFWKDFRRRFLSLLSYQFSTFSSPLALNILQNK-KIKDDSPAALNSGELAAQFTPYDLKRLEMYSRNMVDYHLIMDMVPAVARMFFLKQLGDISLSAAQSALLLGVGLQHKTVDDLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Cavefish
Match: nat10 (N-acetyltransferase 10 [Source:NCBI gene;Acc:103034875])

HSP 1 Score: 179.104 bits (453), Expect = 9.590e-46
Identity = 181/811 (22.32%), Postives = 365/811 (45.01%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPF-------------QVFANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDH-------------EKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGD-RFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   Y +C+++DFE+    L+   +E ++  G+V+++             + ++ ++++ E   ++  +F +RF   LS+    +V  +  N       +AN KP              Q   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ A+ L VA A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    + K+L   P +V+ + +  G+  TG ++  ++ +  R  +   +   +  N T   + ++          ++   + ++  I +   D +E  LN++ CL    DC     +  +  P P  C+L YV++ TLF  H A+E  L++ + +Y +   K S   L+ LSD PAHHLFCL  P S     +P+VL +  + +E               +K   + I   + +Q +  E       R+V++     ++ +GYG   +++L  Y+    P +      T+  + S S  + S LE +   +  +P LL+ ++       ++DY+   +    +LL FWKK  F PV ++        E  C M+ + +    + ++  A +++   R  +++ +        L   +L N+ K            +L +      LK+L  + +N+  +  + D++  VA+++F + +  ++L+      L+G GLQ K+   L  E+ L
Sbjct:  108 YYN-----ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVVGRFNERFILSLSSCQTCVVIDDQLNVLPISKHIANVKPVPPKNQEEGQSSGEQELQDLKESLQDTQPVGVLVDCCKTMDQAKAVLKFIEAIS--------EKTLRSTVALT-AARGRGKSAALGLAVAGAVAFGYSNIFVTSPSPDNLHTLFEFIFKGFDALQYQEHLDYEIIQSLNPEFNKAVVRVNIFKEHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKKLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSADSQQSLSAENRTTSTARLAA--------ARSLHEVSLSESIRYAPGDPVEKWLNELLCL----DC-LSVPHIISGCPLPETCDLYYVNRDTLFCYHKASEAFLQRLMALYVASHYKNSPNDLQLLSDAPAHHLFCLLPPVSPTHNSLPEVLAVVQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDAEFGGLSGGRVVRIAVNPDYQGMGYGSRALQLLELYYKGQFPVLDERERPTASKITSVSSEAVSLLEEVVSPRTDLPPLLLKLSERTAE--RLDYLGVSYGLTPQLLKFWKKAGFVPVYLRQTPNDLTGEHSCVMLKELNTEDSEGQWLPAFWKDFRRRFLSLLSYQFSTFSSPLALNILQNK-KIKDDSPAALNSGELAAQFTPYDLKRLEMYSRNMVDYHLIMDMVPAVARMFFLKQLGDISLSAAQSALLLGVGLQHKTVDDLEKEIEL 886          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Sea Lamprey
Match: nat10 (N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1543])

HSP 1 Score: 168.318 bits (425), Expect = 5.243e-43
Identity = 182/823 (22.11%), Postives = 364/823 (44.23%), Query Frame = 1
Query:  211 YFNYEQNIENNEVLNKVYQVCIIKDFESKME-LIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTR---NIANNCVDTLA-----------NCKPFQV-FANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENC-----LNDIFCLQR-RIDCKFDENNKNNFYPEPSNCEL-MYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSE-NKKYVPQVLCIAHISIEDHEKNEKETIMKELQK---------------QTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXK--MPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMI----SDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+N     E +++L   + +C+++DFE+    L+   IE ++  GL +++             + ++ T+ + E   ++  +F +RF   L++    +V     NI      TL+           +  P ++   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ AM L +ASA+ +G ++I+V +PS  +L +   FL     +L YQ+      IQ  N   + ++   +    H+  +++I          A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R  +   +      N+    S ++          ++   + +   I +   D +E         D   +QR  + C           P P  C+L  YV++ TLF  H A+E  L + + +Y +   K S   L+ LSD PAHHLFCL  P +  +  +P+VL +  + +E   +  +++IM  L +               Q +  +  +    RIV++     ++ +GYG   +++L  Y+    P +   A  T  H+ S +  +   LE     +  +P LL  ++  P    ++DY+   F    +LL FWK+  F PV ++        E  C M+     D      + +  A +++   R  T++ +        +   +L NR+       +  +  +L++      LK+L  + +N+  +  + D++ G+A++YF+  +  ++L+      L+G GLQ K+ ++L  E+ L
Sbjct:  108 YYN-----ETHKILGNTFGMCVLQDFEAMTPNLLARTIETVEGGGLAVILLRTMNSLKQLYTMTMDVHTRFRTESHQDVVGRFNERFILSLASCKTCMVIDDQLNILPLSTHTLSISPLPPKPQDESLSPSEIELGDLKESLQDTQPVGVLVSCCKTLDQAKAVLKFIEAIS--------EKTLRSTVALT-AARGRGKSAAMGLAIASAVAFGYSNIFVTSPSPDNLHTLFEFLFKGFDALQYQEHLDYEIIQSTNPEFNKAIVRVNIYKEHRQTIQYIHPGDAAKLGQAELVVIDEAAAIPLPLVKSLL--GPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSSQSQVTMKAENKNTAVSKLA--------SARSLHEVTLDESIRYAPGDPVEKWLNDLLCLDCLNIQRVSVGC-----------PVPDTCDLYYYVNRDTLFCYHKASEAFLHRLMSLYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVQATQNALPEVLAVIQVCLEG--EISQQSIMSSLARGKRAAGDLIPWTISEQFQDPDFGSLSGGRIVRIAVHPDYQGMGYGSRALRLLQMYYEGKFPCLDETASQTQGHISSIASDAVGLLEETLTPRRDLPPLLHKLSERPTE--RLDYLGVSFGLTPQLLKFWKRSGFTPVYLRQTPNDLTGEHSCIMLKVLNEDEQMERPENWLAAYWKDFRRRFVTLLSYQFSGFLPAVSLNILQNRNVKEKPA-QALSKSELEATFSPYDLKRLEMYSRNMVDYHLIMDLVPGIARLYFTHRLPDMSLSAAQLALLLGVGLQHKAVEQLEKEIDL 890          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Yeast
Match: KRE33 (Protein required for biogenesis of the small ribosomal subunit; heterozygous mutant shows haploinsufficiency in K1 killer toxin resistance; essential gene; NAT10, the human homolog, implicated in several types of cancer and premature aging. [Source:SGD;Acc:S000005076])

HSP 1 Score: 153.295 bits (386), Expect = 1.676e-38
Identity = 144/596 (24.16%), Postives = 268/596 (44.97%), Query Frame = 1
Query:  181 YQSF-NPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNL-TQFTKRFYSQLSTKADLLVTRNIANNC-VDTLANCKPF-------------------QVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNK-----IDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNK--NNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKK--YVPQVLCIAHISIEDHEKNEKETIMKELQK---------------QTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYF 1770
            ++SF +  +I Y  Y+   E+ ++L   Y +CI++DFE+    L+   IE ++  G+V+++             + ++  +++ E   ++  +F +RF   L +  + LV  +  N   +    N KP                    +   ++Q A S  + L +T +Q  A+ S ID++         ++ L  +V+L  G +GRGK+ A+ + +A+A+ +G ++I+V +PS ++L +   F+     +LGYQ+      IQ  N + + ++        H+  +++I  + +     A LV I EA  +    +  +L   P +V+ + +  G+  TG ++  ++ +  R         NN       ++ +  R    K       ++    I +  PI +   D +E  LN + CL    D    +N +      P PS C L  V++ TLFS H  +E  LEK + +Y S   K S   L+ +SD PAH LF L  P + K    +P  LC+  I++E   +  KE++   L +               Q +  E  +    RIV++ T  ++  +GYG   +++L  YF
Sbjct:   94 FESFISNQNIRYVYYK---ESEKILGNTYGMCILQDFEALTPNLLARTIETVEGGGIVVILLKSMSSLKQLYTMTMDVHARYRTEAHGDVVARFNERFILSLGSNPNCLVVDDELNVLPLSGAKNVKPLPPKEDDELPPKQLELQELKESLEDVQPAGSL-VSLSKTVNQAHAILSFIDAIS--------EKTLNFTVALTAG-RGRGKSAALGISIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHIDYDIIQSTNPDFNKAIVRVDIKRDHRQTIQYIVPQDHQVLGQAELVVIDEAAAIPLPIVKNLLG--PYLVFMASTINGYEGTGRSLSLKLIQQLRN-------QNNTSGRESTQTAVVSRDNKEKDSHLHSQSRQLREISLDEPIRYAPGDPIEKWLNKLLCL----DVTLIKNPRFATRGTPHPSQCNLFVVNRDTLFSYHPVSENFLEKMMALYVSSHYKNSPNDLQLMSDAPAHKLFVLLPPIDPKDGGRIPDPLCVIQIALEG--EISKESVRNSLSRGQRAGGDLIPWLISQQFQDEEFASLSGARIVRIATNPEYASMGYGSRAIELLRDYF 661          

HSP 2 Score: 48.1358 bits (113), Expect = 6.984e-6
Identity = 44/192 (22.92%), Postives = 84/192 (43.75%), Query Frame = 1
Query: 1921 PFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEV---------LFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHIS-GLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            P  + Y+   +     L  FWK  +F PV ++  +     E  C M++   GR  +   E A ++  +R  +++ +D           V         L + +K++   L    ++D+ S  D   LK+L+S+  N+  +  + D+I  +A +YF   +   + L+      L+  GLQ K+   +A E+ L
Sbjct:  717 PHYLHYLGVSYGLTQSLHKFWKNNSFVPVYLRQTANDLTGEHTCVMLNVLEGRESNWLVEFA-KDFRKRFLSLLSYDFHKFTAVQALSVIESSKKAQDLSDDEKHDNKELTRTHLDDIFSPFD---LKRLDSYSNNLLDYHVIGDMIPMLALLYFGDKMGDSVKLSSVQSAILLAIGLQRKNIDTIAKELNL 904          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Nematostella
Match: EDO49259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ2])

HSP 1 Score: 186.037 bits (471), Expect = 1.836e-48
Identity = 196/879 (22.30%), Postives = 378/879 (43.00%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFA-NIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASV---------------------KQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQ--NRSI-----------SLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFT---GIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSE-NKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQT------------------ELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXX---XXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTM---ISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ +L   S   K   +L+    S  L+  +   F    +  +I Y  Y+   E +++L   Y +C+++DFE+    L+   +E ++  G+V+++             S ++  +++ E   ++  +F +RF   LS+    +V        +D   N  P    + NI+     P K    +  E  L+ L DSL++   + S+                     ++ LR++VSL    +GRGK+ A+ L +ASA+ +G ++++V +PS ++L +   F+     +L YQ+      +Q  N   N+++           +++   P+  HK+             A L+ I EA  +    +  +L   P +V+ S +  G+  TG ++  ++ +  R  +   G+  T      +T +  G      T  +  +  + + +   I +   DA+E  LN + CL   +       N     P P +CEL YV++ TLFS H A+E+ L++ + +Y +   K +   L+ LSD PAHH+FCL  P + +   +P+V C+  + +E      K TIM  L +                    E   L  G   R+V++ T    + +GYG+  +  L +Y+    P ++      + H+   ++       +        +P LL+ +   P    ++DY+   +    +LL FWK+  F PV ++  +     E  C M   + +      D + +A   +   R  +++         +L   +L  +DK      +  +  +L   L    +K+L+ + +N+     + D++  VA+ YF R +  ++L+      L+G GLQ K+  +L  E+ L
Sbjct:   59 YKKELGFSSHRKKRMKQLQKKIKSGTLDMNKDDPFELFVSSTNIRYCYYK---ETHKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVILLRTMSSLKQLYTMSMDVHARYRTESHQDVVGRFNERFILSLSSCKSCMV--------IDDQLNILPLTSHSLNIKAVPPKP-KEESLTPSEVELKELKDSLQDTQPVGSLINCCRTLDQAKALLKFIEAISEKTLRTTVSLT-AARGRGKSAAIGLALASAVAFGYSNMFVTSPSPENLHTLFEFVFKGFDALDYQEHIDYELVQSTNPEFNKAVVRINIFRDHRQTIQYIHPSDAHKLG-----------QAELLCIDEAAAIPLPLVKNLL--GPYLVFMSSTINGYEGTGRSLSLKLLQQLRQQSVPQGVTST------KTAEAGG-----ATTAVMGRMLSEVTLEESIRYAPGDAVEKWLNKLLCLDATV-----AQNITGGCPLPESCELYYVNRDTLFSYHKASEVFLQRLMALYVASHYKNTPDDLQLLSDAPAHHIFCLLGPVDPSSPALPEVYCVLQVCLEG--DISKSTIMSSLSRGKRASGDLIPWTVSQQFNDHEFASLSGG---RVVRIATHPDVQGMGYGRKALSSLVQYYEGKIPNLSENGQTETSHLGIPTESEADNLLAESITPRANLPPLLLKLGERPAE--RLDYLGVSYGLTAQLLRFWKRSCFVPVYLRQTANDLTGEHSCIMLRILGEIDAEQSDDWLKAYTVDFRRRFLSLLSFQFRSFPASLGLSIL--QDKSLKDHNQVLSRAELDFTLTNYDMKRLDMYSRNMVDHHLIMDLVPAVARFYFLRKLD-ISLSAIQSAILLGVGLQHKTFDQLEKELEL 885          
BLAST of RNA cytidine acetyltransferase vs. Ensembl Medaka
Match: nat10 (N-acetyltransferase 10 [Source:NCBI gene;Acc:101169447])

HSP 1 Score: 181.8 bits (460), Expect = 1.319e-46
Identity = 190/868 (21.89%), Postives = 382/868 (44.01%), Query Frame = 1
Query:   76 YRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI-------------SNEITTKHKREISYNLT-QFTKRFYSQLSTKADLLVTRNIAN--NCVDTLANCKPF-------------QVFANIQ--IAESYPIKL----CQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD----SSIQIRNQNRSISLELASPTSTHK--VRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQP-SENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQTELVELKNGKSL------------------------RIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAIS---PSEMECTMISDCSGRVG---DRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFN-RDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVL 2457
            Y+ DL   S   K   +L+    +  LN  +   F       +I Y  Y    E +++L   + +C+++DFE+    L+   IE ++  G+++++             + ++  +++ E   ++  +F +RF   LS+  + +V  +  N       + N KP              Q   +++  + ++ P+ +    C+T DQ  A+   I+++         ++ LRS+V+L    +GRGK+ AM L VA A+ +G ++I+V +PS  +L +   F+     +L YQ+      IQ  N   + ++   +    H+  +++I          A L+ I EA  +    + K+L   P +V+ + +  G+  TG ++  ++ +  R  +   +   +  N T   + ++          ++   + +   I +   D +E  LN++ CL    DC  +     +  P P  C+L YV++ TLF  H A+E  L++ + +Y S   K S   L+ LSD PAHHLFCL  P    +  +P+VL +  + +E            E+ +QT L  L  GK                          R+V++     ++ +GYG   +++L  Y+    P +     +T+  ++  S  + S LE +   +     + +        ++DY+   +    +LL FWKK  + PV ++        E  C M+ + +        ++  A +++   R  +++ +       +L   +L N + K  +T L   +I +L+S      LK+L  + +++  +  + D+I  +A+++F + +  ++L+      L+G GLQ K+ ++L  E+ L
Sbjct:   61 YKKDLGFSSNRKKRMRQLQKKIKTGTLNLNQDDPFELFIAATNIRYCYYN---ETHKILGNTFGMCVLQDFEALTPNLLARTIETVEGGGIIVILLRTMKSLKQLYTMTMDVHARYRTEAHQDVVGRFNERFILSLSSCKNCVVIDDQLNILPVSSHMTNIKPVPPKTQEDGLSPREQELKDLKESLQDTQPVGVLVDCCRTMDQAKAVLKFIEAVS--------EKTLRSTVALT-AARGRGKSAAMGLSVAGAVAFGYSNIFVTSPSPDNLHTMFEFIFKGFDALQYQEHLDYEIIQSLNPEFNKAVVRVNIFKEHRQTIQYIHPGDAVKLGQAELLVIDEAAAIPLPLVKKLL--GPYLVFMASTINGYEGTGRSLSLKLLQQLRQQSADSQQSLSAENRTTSTARLAA--------ARSLHEVSLHESIRYAPADPVEKWLNELLCL----DC-LNIPRLISGCPLPQTCDLYYVNRDTLFCYHKASEAFLQRLMALYVSSHYKNSPNDLQMLSDAPAHHLFCLLPPVPATQNSLPEVLAVVQVCLEG-----------EISRQTILNSLSRGKKASGDLIPWTVSEQFQDPDFGCLSGGRVVRIAVNPDYQGMGYGSRALQLLQMYYEGKFPTMEEGTASTNTEIVPVSSEAVSLLEEVVTPRKELPPLLLKLTERRAERLDYLGVSYGLTTQLLRFWKKGGYTPVYLRQTPNDLTGEHSCVMLKELNTEEAPEQGQWLSAFWKDFRRRFLSLLSYRFSSFHPSLALSILQNKKSKEEVTAL---SISELESTFTPYDLKRLELYSRSMVDYHLIMDLIPALARMFFLKQLGDVSLSAAQCALLLGIGLQHKTVEQLEKEIEL 887          
BLAST of RNA cytidine acetyltransferase vs. Planmine SMEST
Match: SMESG000026216.1 (SMESG000026216.1)

HSP 1 Score: 1749.56 bits (4530), Expect = 0.000e+0
Identity = 860/870 (98.85%), Postives = 865/870 (99.43%), Query Frame = 1
Query:   31 MNNLTRKIICIGIQNYRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFESKMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAISPSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVLMERIQNSHFIDPFIFKKDVDKKSPLLLSHIRECARVFLNHVSRIVEESANEIPAKKRRLEM 2640
            MNNLTRKIICIGIQNYR DLVSFSKLIKNFDKLKILFCSNLLNEGE+TQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFESKMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFANIQI+ESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEG+KGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLT FCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDA+ENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPA AAAADNTSHHV SKSQLSESSLECISIEKMPKLLVNINNLPVAPFKIDYISCKF ANFELLSFWKKCNFYPVQIKAISPSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFN+DKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVLMERIQNSHFIDPFIFKKDVDKKSPLLLSHIRECARVFLNHVSRIVEESANEIPAKKRRLEM
Sbjct:    1 MNNLTRKIICIGIQNYRNDLVSFSKLIKNFDKLKILFCSNLLNEGEKTQFYQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFESKMELIQCFIENIQANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIANNCVDTLANCKPFQVFANIQISESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGMKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTGFCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDAIENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQTELVELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAAAAAADNTSHHVFSKSQLSESSLECISIEKMPKLLVNINNLPVAPFKIDYISCKFQANFELLSFWKKCNFYPVQIKAISPSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNKDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVLMERIQNSHFIDPFIFKKDVDKKSPLLLSHIRECARVFLNHVSRIVEESANEIPAKKRRLEM 870          
BLAST of RNA cytidine acetyltransferase vs. Planmine SMEST
Match: SMESG000026207.1 (SMESG000026207.1)

HSP 1 Score: 192.2 bits (487), Expect = 2.849e-50
Identity = 203/920 (22.07%), Postives = 392/920 (42.61%), Query Frame = 1
Query:   25 LSMNN---LTRKIICIGIQNYRIDLVSFSKLIKNFD---KLKILFC-----SNLLNEGEQTQFYQ------SFNPHDIEYFNYEQNI------ENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILI---SNEITTK-------HKREISYNLT----QFTKRFYSQLSTKADLLVTRN------IANNCVDTLANCKPFQVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYCMASVKQQLRSSVSLIEGVK---------------------------GRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQDSSIQIR--------NQNRSISLELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNK----NNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDHEKN--EKETIMKELQKQTELV-----------ELKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXX----XXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAI---SPSEMECTMISDCSG--RVGDRFD--EAAYQEMCERVGTVILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNSFIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSCKKLASEMVLME 2463
            +S+NN   L ++   I I ++  + V    LI+NFD   + K+L+C     S +   G+  + ++      + N  + E F +  +I      + + VL   +   I++DF+      I   IE ++  GL+I +    NEI+         HK+  ++       +F  RF+  L T  D  V  N      I  N + +++     Q+    +       KL    ++          L+N+  + + + Q R+ +SL+E  K                           GRGK+  + + +A  I  G++ I+V +P+++++ +  +F+ + L+ L YQ++   ++             + +E+        VR++      +     L+ I E   +    + K+L+     ++ S +  G+  TG ++        +    I E   +D+                   N  F  I +  PI +++ D +E+ +N++ CL    DC+ + N+     NN  P  S+C+L Y+++  LFS    +E  L++ +GIY S   K +   L+ LSD  +H LFCL +P      +P V  +  I+ E        K  + K ++   +++           +       RIV++     F++ GYG   +K+L++YF Q   + AA    T+ H + KS  S     +      ++K+  LLV ++++P     +DYIS  F    ELL FWKK NF P+ ++     +  E  C M+   S    V   F   +A   +   R   ++       D  LV E++  + K ++    E T  DL ++       +L+ +++ +  +  + D+++ ++ +  ++    L L K+ +L LV  GLQ K+  +L  ++  ++
Sbjct:   10 ISVNNCKILHKRSTFILIGSHATEQVPVIFLIRNFDINDEPKVLWCFKRENSFIKRSGKNNRKFEKSCKKMNLNNDNFENFTFMYDINWCHYNDTDNVLGTTFDAVILQDFDCLTPNKIAKVIETVRGGGLIIFLLPNINEISELGSLSMDCHKKYQTFAYGDVDYRFNYRFFYSLITFQDCFVLDNNLQILPINANAIKSISAVDESQIAKKDKSLLKLKKKLKDEHEK----------LQNIINICATRDQTRALISLVEAFKSKSDVNPSFKKPKFIKNPFLAMVTSGRGRGKSALLGMAIAVGIHCGMSRIFVTSPNLENVVTLMQFVINGLVQLSYQENRDFVKRCKPLEGVKCQGIVEIEIMKDCQRKIVRYLSPNDYSSLDKIDLLCIDETAAIPLPIVKKLLAVKSDFIFMSSTMHGYEGTGRSL------SLKLMKQIKEGFASDVK------------------NDRFLEISLKEPIRYSKEDNVESWMNNLLCL----DCENELNDSSYSLNNNQPSLSDCQLFYINRDVLFSCGETSERFLQRIMGIYVSSHYKNTPNDLQMLSDCSSHALFCLAKPILMDDGLPIVCAVLQIAFEGSIDPVIAKSNLAKGVRPSGDMIPWTIVQQFNQYDFVKLAGARIVRIAVHPNFQRQGYGGQALKLLYEYFNQGKTSSAAKVQKTTLHDIVKSNSSYNNFSTVNNIPPVDKLGHLLVKLSDIPAE--SLDYISVSFGLTSELLRFWKKNNFIPIYLRQTINDATGEHSCVMLRQLSKSESVEGNFQWLQAYNNDFIRRFCNLLPGPFKKIDSVLVLELIHQKSKVDICVNTEVTPNDLNTYFTENDFIRLDQYVKGVTDYHGIMDLVHRLSILTHTKRFPNLKLPKFQDLVLVSLGLQYKTVDELVEDLAALK 889          
BLAST of RNA cytidine acetyltransferase vs. Planmine SMEST
Match: SMESG000066293.1 (SMESG000066293.1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.461e-21
Identity = 155/678 (22.86%), Postives = 288/678 (42.48%), Query Frame = 1
Query:  196 PHDIEYFNYEQNIENNEVLNKVYQVCIIKDFES-KMELIQCFIENIQANGLVILISNEIT----------TKHKREISYNLTQFTKRF-YSQLSTKADLLVTRNIA------------NNCVDTLANCKPFQVFANIQIAES--YP-IKLCQTSDQESALQSLIDSLENVYCMASVK-QQLRSSV-SLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQSLTSFCRFLRHSLLSLGYQD------SSIQIRNQNRSIS-LELASPTSTHKVRFIDFRQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGTTVFSRVSRPFR-TFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSIYMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELMYVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFCLQQPSENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQT---------------ELVE--LKNGKSLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVXXXXXXXXXXXXXXXXXKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSFWKKCNFYPVQIKAISPSEMECTMISDCSG 2067
            P DI +  Y+   +   +L K + +CI +D+E     +I   +E +   GLVI +S  ++          T  K + + N  +F KRF  S LS+K  + +                 N       N     +  ++++++S  YP + +C T DQ   L +L  S+   +  ++     +R  V +L+   +GRGK+ A+ L + +A++ GLT I V APS +++++  ++++  L +L Y +      S+  + +  ++I+ +EL     T  +R++         D  ++ I EA  +    +   L     +V+ S +  G+  +G  + +++    R  +T +     N  NE      M I     K        I +  PI + +ND +E  L    C+    + K D  N  +    P  C L+ V++  L   + A+E +L+K + IY++   + S   LK L D+    + CL   S + K  P VL I  IS   +E N  +  + E  + T               E +E   K    LRI  + T   +   G+G   + +L +Y         A   ++SH +   S +               LL+ +++LP   F I+YI      + +L+ F+++ + + V     + +E    + +DC G
Sbjct:   94 PSDIRWCLYK---DTQNILGKTFDICIFQDYELLTPNVIARGMETVAGGGLVIFLSPSLSELELFFNTSFTGSKSQ-NCNAQRFLKRFTVSLLSSKFCICIDDEFKLLNKKKKPIKLKNENAAVKTNKDLILLKESLKLSDSLFYPMVNICATYDQAKCLHTLCSSIRMFHHPSNRDYNDVRCGVIALVTAARGRGKSAALGLALCAALETGLTQICVTAPSPENISTLWQYVKLGLKALNYTEHIDFTISTSVLNDGVKAITKVELKRSKFTQIIRYV-VPSETESLDCDILCIDEAAAIPLNILQMYLRSFSGLVFVSSTISGYEGSGMMLSTKLFEELRQNYTAV-----NTSNE------MEILLENTK---GRLYEINLEEPIRYGKNDPVEAYLYKTLCM----NYKQDPLNVIDESVTPDQCHLVVVNRDVLLDNNKASEQMLQKIMSIYSASNHQNSPDDLKLLVDDECSRIICLTNSSVDSKN-PNVLVIIQIS---YEGNSIQDFINESLRNTGKRPVVDVLCDTIVEEFLESNFKRLSGLRINMIATDPNYVNRGFGSRALTLLIEY---------ATNLHSSHPINGDSSM------------FNSLLLPMSDLP--KFPINYIGVLTELSVKLIKFFQRVDDFMVVFLESAINE----ITADCRG 717          
The following BLAST results are available for this feature:
BLAST of RNA cytidine acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NAT101.414e-3922.15N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NAT102.088e-3922.15N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGN... [more]
NAT105.672e-3623.53N-acetyltransferase 10 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nath-101.211e-4323.81RNA cytidine acetyltransferase [Source:UniProtKB/... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
l(1)G00208.052e-5223.67gene:FBgn0027330 transcript:FBtr0071280[more]
l(1)G00209.577e-5223.67gene:FBgn0027330 transcript:FBtr0344164[more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nat101.998e-3722.11N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
nat107.026e-3321.55N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nat101.113e-5123.02N-acetyltransferase 10 (GCN5-related) [Source:NCBI... [more]
nat101.139e-5123.02N-acetyltransferase 10 (GCN5-related) [Source:NCBI... [more]
nat101.599e-5123.02N-acetyltransferase 10 (GCN5-related) [Source:NCBI... [more]
nat102.081e-5123.02N-acetyltransferase 10 (GCN5-related) [Source:NCBI... [more]
nat102.086e-5123.47N-acetyltransferase 10 (GCN5-related) [Source:NCBI... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nat101.699e-3821.45N-acetyltransferase 10 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W3C1|NAT10_DROME8.071e-5123.67RNA cytidine acetyltransferase OS=Drosophila melan... [more]
sp|Q55EJ3|NAT10_DICDI1.648e-4622.30RNA cytidine acetyltransferase OS=Dictyostelium di... [more]
sp|O01757|NAT10_CAEEL1.540e-4223.81RNA cytidine acetyltransferase OS=Caenorhabditis e... [more]
sp|P87115|NAT10_SCHPO5.655e-3922.25RNA cytidine acetyltransferase OS=Schizosaccharomy... [more]
sp|Q9H0A0|NAT10_HUMAN1.003e-3822.15RNA cytidine acetyltransferase OS=Homo sapiens OX=... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224XDX09.038e-5824.56Putative conserved plasma membrane protein (Fragme... [more]
A0A069DZP11.621e-5724.20Putative conserved plasma membrane protein (Fragme... [more]
A0A0V0GAB41.104e-5624.03Putative conserved plasma membrane protein (Fragme... [more]
A0A1D2NJL55.872e-5422.01N-acetyltransferase 10 (Fragment) OS=Orchesella ci... [more]
A0A016VPI72.206e-5324.31RNA cytidine acetyltransferase OS=Ancylostoma ceyl... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nat105.299e-4622.32N-acetyltransferase 10 [Source:NCBI gene;Acc:10303... [more]
nat109.590e-4622.32N-acetyltransferase 10 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nat105.243e-4322.11N-acetyltransferase 10 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
KRE331.676e-3824.16Protein required for biogenesis of the small ribos... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492591.836e-4822.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nat101.319e-4621.89N-acetyltransferase 10 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of RNA cytidine acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000026216.10.000e+098.85SMESG000026216.1[more]
SMESG000026207.12.849e-5022.07SMESG000026207.1[more]
SMESG000066293.16.461e-2122.86SMESG000066293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034901 ID=SMED30034901|Name=RNA cytidine acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2696bp
AATTTACACATTTGTACTTAAATTCTTTCTATGAATAATCTTACACGAAA
AATTATTTGCATAGGAATTCAAAACTACAGAATTGATTTAGTATCATTTA
GTAAGTTAATAAAAAATTTTGACAAATTAAAAATACTTTTTTGCAGTAAT
TTATTAAACGAAGGTGAACAAACGCAGTTCTATCAATCTTTTAACCCCCA
TGATATAGAATATTTTAATTACGAACAGAATATCGAGAATAATGAAGTTC
TTAATAAAGTGTATCAAGTTTGTATAATAAAAGATTTTGAATCCAAAATG
GAATTAATTCAATGCTTTATTGAAAATATTCAAGCAAATGGTTTAGTTAT
ATTAATCTCAAATGAAATTACAACTAAACATAAACGTGAAATAAGTTATA
ATTTGACTCAATTTACAAAAAGATTTTACAGTCAACTCTCAACAAAAGCT
GATTTATTAGTTACTAGAAATATAGCGAATAATTGCGTCGATACACTTGC
TAATTGCAAACCATTCCAAGTTTTCGCTAACATCCAGATTGCTGAATCAT
ATCCAATTAAACTCTGCCAAACGAGTGACCAAGAAAGCGCTCTACAATCA
TTGATAGATTCGCTGGAAAATGTTTACTGCATGGCATCAGTAAAGCAGCA
ACTGAGATCATCCGTTTCACTAATTGAAGGCGTGAAAGGCCGCGGAAAAG
CGACCGCAATGATCCTCGGTGTTGCGTCGGCCATCAAATACGGTTTGACA
GATATCTATGTTATCGCACCGAGCGTTCAGTCCCTTACGAGTTTCTGTCG
GTTCCTCCGTCACTCGCTGTTGTCTCTCGGATACCAGGATTCCTCCATTC
AAATACGTAACCAGAACCGATCGATCAGTCTCGAGCTCGCCAGTCCAACT
AGCACTCACAAGGTTCGGTTTATCGATTTTCGACAGAATTTCGCCAAATA
CGATGCGGGATTGGTGGCCATCATCGAGGCGGGCCACCTGGCGGAGGTAG
AGATCAATAAGATCCTCTCGTTCAATCCCCGCATGGTCTGGGCATCGATA
TCGACTGGGGGCTTTCATTCGACCGGTACGACGGTTTTCTCGCGTGTCTC
TCGACCGTTCCGAACCTTCACAGGCATCGGGGAAACTCTGAACAATGACA
TCAATGAAACCGTCAAGAAATCAGGAATGAGCATTCGGCAAATGACCAAT
AAAATCGACAACAAAACCTTCACCTCAATTTACATGACAACTCCAATCAT
TTTCAACCAAAACGACGCCCTTGAAAATTGTTTAAACGACATTTTTTGCT
TACAACGACGAATTGATTGCAAATTTGACGAGAATAACAAAAACAATTTC
TATCCTGAGCCCAGTAATTGCGAGTTGATGTATGTGGATAAAAGGACATT
ATTCAGTGGACATTCTGCCGCTGAGATTCTTTTGGAGAAATTTATCGGCA
TTTACACATCATTCGAGCGAAAAAGGTCAAATGGATTCCTGAAGGAATTA
TCAGACGAGCCAGCTCATCATTTGTTTTGTTTGCAACAGCCATCAGAAAA
TAAGAAATACGTTCCACAGGTTCTCTGCATAGCTCACATTTCCATTGAAG
ATCATGAAAAGAATGAGAAAGAAACGATAATGAAGGAATTACAAAAGCAA
ACAGAATTGGTTGAATTGAAAAACGGGAAAAGTTTGAGAATTGTGAAGTT
GATAACTCAAGCCAAGTTCAAGAAGCTCGGATATGGGAAACATATGGTGA
AAATGTTGCATAAATATTTCATGCAAAACCCACCTGCCGTAGCCGCCGCC
GCCGACAACACCTCTCATCATGTCCTCAGCAAATCACAATTATCAGAATC
GAGTCTCGAGTGCATTTCCATAGAGAAAATGCCAAAATTGCTCGTCAACA
TAAACAATCTTCCTGTAGCGCCGTTTAAAATCGACTACATCTCATGTAAA
TTCCACGCCAATTTCGAGTTGTTATCGTTTTGGAAAAAGTGCAACTTTTA
TCCAGTGCAAATTAAGGCGATCTCGCCGTCTGAAATGGAATGCACGATGA
TTAGTGACTGTTCTGGACGTGTGGGTGACCGTTTCGATGAGGCAGCATAT
CAGGAAATGTGTGAGCGAGTTGGAACGGTTATTTTGCACGATTTATGGGA
CACCGATGTCACTCTTGTCCACGAGGTGCTGTTCAATAGGGATAAGTACA
ACATGACGGGTTTGAAAGAATGCACTATAGAAGATCTGCAAAGCTTTCTT
GACTGTAGACAACTGAAAAAATTGAATTCCTTCATTCAAAATATTCATAC
ATTTGAGTCGGTCCAAGACATTATCTATGGGGTTGCGCAAATATATTTCA
GTCGGCACATCAGTGGCTTGAATTTAGCCAAATATCATGAATTGGCTCTA
GTGGGATTTGGTCTCCAATTAAAATCCTGCAAGAAATTGGCATCAGAAAT
GGTGCTCATGGAGCGCATTCAGAATAGCCATTTTATTGATCCTTTCATCT
TTAAGAAAGACGTTGATAAAAAAAGTCCTCTCTTACTCAGTCACATTAGA
GAGTGTGCTCGAGTGTTCCTTAATCATGTTTCTAGAATTGTAGAAGAGAG
TGCCAACGAGATTCCAGCTAAGAAACGACGACTCGAAATGTAATTTTATC
AATAAATGAGTTTTAGTAAATTTTTGTTTTCAAATGTGAGATCGGA
back to top

protein sequence of SMED30034901-orf-1

>SMED30034901-orf-1 ID=SMED30034901-orf-1|Name=SMED30034901-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=871bp
MNNLTRKIICIGIQNYRIDLVSFSKLIKNFDKLKILFCSNLLNEGEQTQF
YQSFNPHDIEYFNYEQNIENNEVLNKVYQVCIIKDFESKMELIQCFIENI
QANGLVILISNEITTKHKREISYNLTQFTKRFYSQLSTKADLLVTRNIAN
NCVDTLANCKPFQVFANIQIAESYPIKLCQTSDQESALQSLIDSLENVYC
MASVKQQLRSSVSLIEGVKGRGKATAMILGVASAIKYGLTDIYVIAPSVQ
SLTSFCRFLRHSLLSLGYQDSSIQIRNQNRSISLELASPTSTHKVRFIDF
RQNFAKYDAGLVAIIEAGHLAEVEINKILSFNPRMVWASISTGGFHSTGT
TVFSRVSRPFRTFTGIGETLNNDINETVKKSGMSIRQMTNKIDNKTFTSI
YMTTPIIFNQNDALENCLNDIFCLQRRIDCKFDENNKNNFYPEPSNCELM
YVDKRTLFSGHSAAEILLEKFIGIYTSFERKRSNGFLKELSDEPAHHLFC
LQQPSENKKYVPQVLCIAHISIEDHEKNEKETIMKELQKQTELVELKNGK
SLRIVKLITQAKFKKLGYGKHMVKMLHKYFMQNPPAVAAAADNTSHHVLS
KSQLSESSLECISIEKMPKLLVNINNLPVAPFKIDYISCKFHANFELLSF
WKKCNFYPVQIKAISPSEMECTMISDCSGRVGDRFDEAAYQEMCERVGTV
ILHDLWDTDVTLVHEVLFNRDKYNMTGLKECTIEDLQSFLDCRQLKKLNS
FIQNIHTFESVQDIIYGVAQIYFSRHISGLNLAKYHELALVGFGLQLKSC
KKLASEMVLMERIQNSHFIDPFIFKKDVDKKSPLLLSHIRECARVFLNHV
SRIVEESANEIPAKKRRLEM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR032672TmcA/NAT10/Kre33
IPR000182GNAT_dom
IPR007807Helicase_dom
IPR027992tRNA_bind_dom
IPR000299FERM_domain
Vocabulary: molecular function
TermDefinition
GO:0008080N-acetyltransferase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0000154rRNA modification
GO:0006364rRNA processing
GO:0008033tRNA processing
GO:0016072rRNA metabolic process
GO:0034470ncRNA processing
GO:0042274ribosomal small subunit biogenesis
GO:0051391tRNA acetylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027992Possible tRNA binding domainPFAMPF13725tRNA_bind_2coord: 727..812
e-value: 8.0E-11
score: 42.1
IPR000182GNAT domainPFAMPF13718GNAT_acetyltr_2coord: 475..665
e-value: 4.8E-22
score: 78.5
IPR007807Helicase domainPFAMPF05127Helicase_RecDcoord: 215..425
e-value: 6.4E-17
score: 62.0
IPR032672TmcA/NAT10/Kre33PANTHERPTHR10925N-ACETYLTRANSFERASE 10coord: 176..812
NoneNo IPR availablePANTHERPTHR10925:SF5RNA CYTIDINE ACETYLTRANSFERASEcoord: 176..812