Voltage-gated potassium channel

Overview
NameVoltage-gated potassium channel
Smed IDSMED30034900
Length (bp)357
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 147.517 bits (371), Expect = 1.263e-42
Identity = 65/103 (63.11%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 147.517 bits (371), Expect = 3.217e-42
Identity = 65/103 (63.11%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Match: KCNC3 (potassium voltage-gated channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:6235])

HSP 1 Score: 147.132 bits (370), Expect = 1.021e-41
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   89 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 187          
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Match: KCNC3 (potassium voltage-gated channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:6235])

HSP 1 Score: 146.747 bits (369), Expect = 1.140e-41
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   89 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 187          
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Match: KCNC3 (potassium voltage-gated channel subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:6235])

HSP 1 Score: 146.747 bits (369), Expect = 1.559e-41
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   89 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 187          
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 189.119 bits (479), Expect = 6.121e-59
Identity = 84/105 (80.00%), Postives = 92/105 (87.62%), Query Frame = 1
Query:   43 KLKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            K K+  D  +RV+LNVGGIRHETY   LKKIPATRLS+LT  LANYDP+LNEYFFDRHP VFS ILNYYRTGKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:   13 KTKSWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWM 117          
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 185.652 bits (470), Expect = 9.868e-58
Identity = 82/99 (82.83%), Postives = 89/99 (89.90%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RV+LNVGGIRHETY   LKKIPATRLS+LT  LANYDP+LNEYFFDRHP VFS ILNYYRTGKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWM 100          
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 185.652 bits (470), Expect = 9.868e-58
Identity = 82/99 (82.83%), Postives = 89/99 (89.90%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RV+LNVGGIRHETY   LKKIPATRLS+LT  LANYDP+LNEYFFDRHP VFS ILNYYRTGKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWM 100          
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Match: shw-3 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A3B1DVP6])

HSP 1 Score: 185.652 bits (470), Expect = 1.132e-57
Identity = 81/103 (78.64%), Postives = 92/103 (89.32%), Query Frame = 1
Query:   49 KNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            + + D+  R++LNVGG+RHETYK TLKKIPATRLS+LT  LANYDP+LNEYFFDRHP VF+QILNYYRTGKLHYP DVCGPLFEEEL +WGLDSN+ EPCCWM
Sbjct:   19 QTVMDSEYRIILNVGGVRHETYKHTLKKIPATRLSRLTTNLANYDPVLNEYFFDRHPGVFAQILNYYRTGKLHYPLDVCGPLFEEELKYWGLDSNECEPCCWM 121          
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 185.652 bits (470), Expect = 1.226e-57
Identity = 82/99 (82.83%), Postives = 89/99 (89.90%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RV+LNVGGIRHETY   LKKIPATRLS+LT  LANYDP+LNEYFFDRHP VFS ILNYYRTGKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:   12 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWM 110          
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 202.601 bits (514), Expect = 3.941e-64
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    3 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 202.601 bits (514), Expect = 5.599e-64
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    3 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 204.527 bits (519), Expect = 5.992e-64
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    3 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 204.527 bits (519), Expect = 6.590e-64
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    3 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 204.912 bits (520), Expect = 6.690e-64
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:   18 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 120          
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Match: kcnc3b (potassium voltage-gated channel, Shaw-related subfamily, member 3b [Source:ZFIN;Acc:ZDB-GENE-100901-2])

HSP 1 Score: 149.828 bits (377), Expect = 4.588e-43
Identity = 68/99 (68.69%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 148.673 bits (374), Expect = 7.587e-43
Identity = 66/103 (64.08%), Postives = 81/103 (78.64%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RVV+NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 148.673 bits (374), Expect = 7.796e-43
Identity = 66/103 (64.08%), Postives = 81/103 (78.64%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RVV+NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 148.288 bits (373), Expect = 1.109e-42
Identity = 66/103 (64.08%), Postives = 81/103 (78.64%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RVV+NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Match: kcnc3a (potassium voltage-gated channel, Shaw-related subfamily, member 3a [Source:ZFIN;Acc:ZDB-GENE-100901-1])

HSP 1 Score: 148.288 bits (373), Expect = 1.362e-42
Identity = 67/99 (67.68%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHPN F+ ILNYYRTGKLH P+DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 KIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPNTFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 147.902 bits (372), Expect = 1.567e-42
Identity = 66/100 (66.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 147.902 bits (372), Expect = 1.614e-42
Identity = 66/100 (66.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 147.902 bits (372), Expect = 1.879e-42
Identity = 66/100 (66.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 148.288 bits (373), Expect = 2.064e-42
Identity = 66/100 (66.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 147.902 bits (372), Expect = 2.305e-42
Identity = 66/100 (66.00%), Postives = 80/100 (80.00%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +++V+NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPL+EEEL FWG+D   VE CCWM
Sbjct:   36 DKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 151.754 bits (382), Expect = 1.604e-43
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 189          
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 151.754 bits (382), Expect = 1.714e-43
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 189          
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 147.517 bits (371), Expect = 8.582e-43
Identity = 65/103 (63.11%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 147.517 bits (371), Expect = 2.164e-42
Identity = 65/103 (63.11%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 147.132 bits (370), Expect = 6.639e-42
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 189          
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 3.950e-63
Identity = 94/104 (90.38%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    3 LINM-DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 5.894e-54
Identity = 77/95 (81.05%), Postives = 88/95 (92.63%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            R+VLNVGG+RHETY+ATLKKIPATRLS+LT +LAN+DP+LNEYFFDRHP VF+ ILNYYRTGKLHYP DVCGPLFEEEL +WGLD++  EPCCWM
Sbjct:   38 RIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWM 132          
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Match: sp|Q63959|KCNC3_MOUSE (Potassium voltage-gated channel subfamily C member 3 OS=Mus musculus OX=10090 GN=Kcnc3 PE=1 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 1.285e-42
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   90 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 188          
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Match: sp|Q01956|KCNC3_RAT (Potassium voltage-gated channel subfamily C member 3 OS=Rattus norvegicus OX=10116 GN=Kcnc3 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.431e-42
Identity = 64/99 (64.65%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWM 189          
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 6.003e-42
Identity = 65/103 (63.11%), Postives = 79/103 (76.70%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D   R+V+NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. TrEMBL
Match: U4TV34 (BTB domain-containing protein OS=Dendroctonus ponderosae OX=77166 GN=D910_01041 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.828e-66
Identity = 92/102 (90.20%), Postives = 99/102 (97.06%), Query Frame = 1
Query:   52 NMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            NM DA NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHP VF+Q+LNYYRTGKLHYP+DVCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:    6 NMVDAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQVLNYYRTGKLHYPSDVCGPLFEEELEFWGLDANQVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. TrEMBL
Match: A0A182PPR3 (BTB domain-containing protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 7.407e-66
Identity = 92/102 (90.20%), Postives = 98/102 (96.08%), Query Frame = 1
Query:   52 NMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            N+ D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    2 NLMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 103          
BLAST of Voltage-gated potassium channel vs. TrEMBL
Match: A0A182XKZ4 (BTB domain-containing protein OS=Anopheles quadriannulatus OX=34691 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 1.244e-65
Identity = 92/102 (90.20%), Postives = 98/102 (96.08%), Query Frame = 1
Query:   52 NMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            N+ D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    2 NIMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 103          
BLAST of Voltage-gated potassium channel vs. TrEMBL
Match: A0A182F5V0 (BTB domain-containing protein OS=Anopheles albimanus OX=7167 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.439e-65
Identity = 92/102 (90.20%), Postives = 98/102 (96.08%), Query Frame = 1
Query:   52 NMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            N+ D+ NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDPILNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    2 NLMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 103          
BLAST of Voltage-gated potassium channel vs. TrEMBL
Match: H9JHT2 (BTB domain-containing protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 5.778e-65
Identity = 93/104 (89.42%), Postives = 99/104 (95.19%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L NM DA NRVVLNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHP VF+Q+LNYYRTGKLHYP DVCGPLFEEEL+FWGLD+NQVEPCCWM
Sbjct:    3 LLNM-DAENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWM 105          
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 151.369 bits (381), Expect = 5.985e-44
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000049045.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 151.754 bits (382), Expect = 7.253e-44
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000031881.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 151.754 bits (382), Expect = 8.741e-44
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Match: ENSAMXT00000012289.2 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 151.369 bits (381), Expect = 8.902e-44
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            R+V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:    9 RIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 148.288 bits (373), Expect = 6.910e-43
Identity = 66/103 (64.08%), Postives = 81/103 (78.64%), Query Frame = 1
Query:   61 DAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            D  +RVV+NVGGIRH+TY++TL+ +P TRL+ L E  A    +YD  ++E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 150.599 bits (379), Expect = 2.854e-44
Identity = 71/104 (68.27%), Postives = 81/104 (77.88%), Query Frame = 1
Query:   58 TDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTE--ALAN--YDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +D   RVV+NVGG RHETY+ TL+ +P TRLS LTE  A AN  YD   NE+FFDRHP VF+ ILNYYRTGKLH P++VCGPLFEEEL FWG+D   VEPCCWM
Sbjct:   32 SDENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008567.1 (pep scaffold:Pmarinus_7.0:GL478165:47990:49229:1 gene:ENSPMAG00000007760.1 transcript:ENSPMAT00000008567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 1.914e-30
Identity = 50/104 (48.08%), Postives = 66/104 (63.46%), Query Frame = 1
Query:   67 GNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA---------NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCC 351
              RV LNVGG+ HE    TL+++P TRL KL ++ A         ++ P  NEYFFDRHP  F+ ILN+YRTGKLH   ++C   F +ELD+WG+D   +E CC
Sbjct:    4 SRRVRLNVGGVCHEVLWRTLERLPRTRLGKLRDSSAEGEAASLCDDHSPGENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEIYLESCC 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004244.1 (pep scaffold:Pmarinus_7.0:GL488450:6918:7731:1 gene:ENSPMAG00000003882.1 transcript:ENSPMAT00000004244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 1.793e-27
Identity = 45/101 (44.55%), Postives = 61/101 (60.40%), Query Frame = 1
Query:   82 LNVGGIRHETYKATLKKIPATRLSKL-----------TEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCC 351
            +NVGGI HE    TL+++P TRL +L            E   +Y    NE+FFDRHP  F+ ILN+YRTG+LH   ++C   F +ELD+WG+D   +E CC
Sbjct:    1 INVGGITHEALWRTLERLPRTRLGRLQACVVGSEEAIMELCDDYSRADNEFFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGVDEIYLESCC 101          
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 5.623e-27
Identity = 47/102 (46.08%), Postives = 64/102 (62.75%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKL---------TEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCC 351
            RV LNVGG+ HE    TL+++P TRL +L         +E   +Y    NEYFFDRHP  F+ +LN+YRTG+LH   ++C   F +ELD+WG+D   +E CC
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCC 102          
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011463.1 (pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 gene:ENSPMAG00000010436.1 transcript:ENSPMAT00000011463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 6.571e-21
Identity = 39/101 (38.61%), Postives = 57/101 (56.44%), Query Frame = 1
Query:   82 LNVGGIRHETYKATLKKIPATRLSKLT-----------EALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCC 351
            +NVGG++     A L + P TRL+ L            E   +YD   +E++FDR P VFS +LN+YRTGKLH   +VC   F +E+ +WG+    ++ CC
Sbjct:   22 VNVGGLKRTLRHAVLLRFPQTRLALLASRRRHSWEAVLEMCDDYDAARDEFYFDRSPGVFSYVLNFYRTGKLHVMAEVCAHSFSQEIAYWGIHEFFIDSCC 122          
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 154.066 bits (388), Expect = 1.430e-46
Identity = 70/107 (65.42%), Postives = 85/107 (79.44%), Query Frame = 1
Query:   46 LKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTE---ALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            L+  T+AG+RVV+NVGG +HETY  TLK IP TRL  +TE    L  +DP  +E+FFDRHP VF+Q+LN+YRTGKLH PNDVCGPLFE+EL FWG+D  QVEPCCW+
Sbjct:    8 LEEQTNAGDRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWL 114          
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 149.443 bits (376), Expect = 8.171e-45
Identity = 67/99 (67.68%), Postives = 79/99 (79.80%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTEA---LANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            +RV +NVGG+RHETYK+TLK IP TRLS + EA    A++DP   EYFFDRHP VF+ +LNYYRTGKLH P DVCGPLFE+EL FWG+D  QVE CCW+
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWL 99          
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Match: EDO46844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP34])

HSP 1 Score: 141.739 bits (356), Expect = 3.047e-44
Identity = 64/105 (60.95%), Postives = 77/105 (73.33%), Query Frame = 1
Query:   58 TDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTE------ALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCW 354
            T + +++VLNVGG +HETY +TL+ IP +RL  L E        + YD   NEYFFDRHP VF+ ILNYYRTGKLH PNDVCGP+FEEEL +WG+D  QVE CCW
Sbjct:    2 TSSSSKIVLNVGGFKHETYISTLRNIPDSRLCNLGERHQSMNKASEYDANKNEYFFDRHPGVFAHILNYYRTGKLHCPNDVCGPVFEEELQYWGIDEEQVETCCW 106          
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Match: EDO48064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ3])

HSP 1 Score: 142.124 bits (357), Expect = 3.904e-44
Identity = 62/108 (57.41%), Postives = 81/108 (75.00%), Query Frame = 1
Query:   58 TDAGNR------VVLNVGGIRHETYKATLKKIPATRLSKLTEALAN---YDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCW 354
            +D G R      +++N GG+RHET+++TL+  P TRL+   E+  N   YDP  NE+FFDRHP VF+QI+N+YRTGKLH P+DVCGPLF+EEL FWG+D  Q+EPCCW
Sbjct:    4 SDEGQRTTGRDIIIINCGGVRHETFRSTLRNFPDTRLTWSVESTRNNPDYDPEKNEFFFDRHPGVFAQIMNFYRTGKLHAPHDVCGPLFQEELMFWGIDEKQMEPCCW 111          
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 141.739 bits (356), Expect = 5.977e-42
Identity = 63/98 (64.29%), Postives = 77/98 (78.57%), Query Frame = 1
Query:   70 NRVVLNVGGIRHETYKATLKKIPATRLSKLTE---ALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCW 354
            +RV+LNVGG RHETY +TL+ +P +RL+ + E     A+YDP  NE FFDRHP VF+ +LNYYRTGKLH P DVCGPLFEEEL FWG++  Q+EPCCW
Sbjct:    6 DRVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCW 103          
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000008692.2 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 151.754 bits (382), Expect = 2.897e-44
Identity = 69/99 (69.70%), Postives = 81/99 (81.82%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:    9 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 107          
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000039227.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 152.14 bits (383), Expect = 3.218e-44
Identity = 69/99 (69.70%), Postives = 81/99 (81.82%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000028717.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 152.14 bits (383), Expect = 4.418e-44
Identity = 69/99 (69.70%), Postives = 81/99 (81.82%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   37 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 135          
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Match: ENSORLT00000039174.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 152.14 bits (383), Expect = 6.498e-44
Identity = 69/99 (69.70%), Postives = 81/99 (81.82%), Query Frame = 1
Query:   73 RVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            ++V+N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP+VFS ILNYYRTGKLH PNDVCGPLFEEEL FWG+D   VE CCWM
Sbjct:   63 KIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWM 161          
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 149.828 bits (377), Expect = 2.398e-43
Identity = 66/106 (62.26%), Postives = 82/106 (77.36%), Query Frame = 1
Query:   52 NMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALA----NYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
             ++D  +R+V+NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHP VF+ ILNYYRTGKLH P DVCGPL+EEEL FWG+D   VEPCCWM
Sbjct:    2 GLSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWM 107          
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Match: SMESG000013590.1 (SMESG000013590.1)

HSP 1 Score: 221.861 bits (564), Expect = 2.247e-71
Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 1
Query:   55 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM
Sbjct:    1 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 101          
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Match: SMESG000059794.1 (SMESG000059794.1)

HSP 1 Score: 212.616 bits (540), Expect = 1.450e-67
Identity = 93/101 (92.08%), Postives = 98/101 (97.03%), Query Frame = 1
Query:   55 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            MTD+ NRV+LNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHP+VF QILNYYR GKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM
Sbjct:    1 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 101          
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 210.305 bits (534), Expect = 2.842e-66
Identity = 94/101 (93.07%), Postives = 98/101 (97.03%), Query Frame = 1
Query:   55 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            MTDA NRV+LNVGGIRHETYKATLKKIPATRLSKLTEALANYDP+LNEYFFDRHP VF+QILNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 101          
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 209.92 bits (533), Expect = 3.514e-66
Identity = 94/101 (93.07%), Postives = 98/101 (97.03%), Query Frame = 1
Query:   55 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            MTDA NRV+LNVGGIRHETYKATLKKIPATRLSKLTEALANYDP+LNEYFFDRHP VF+QILNYYRTGKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWM
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWM 101          
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Match: SMESG000005595.1 (SMESG000005595.1)

HSP 1 Score: 206.838 bits (525), Expect = 1.840e-65
Identity = 91/105 (86.67%), Postives = 98/105 (93.33%), Query Frame = 1
Query:   43 KLKNMTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWM 357
            K+K   DA NRV+LNVGG RHETYKATLKKIPATRLSKLT+ALANYDP+LNEYFFDRHP VF+Q+LNYYR+GKLHYP DVCGPLFEEELDFWGLDSNQVEPCCWM
Sbjct:   21 KIKIFMDADNRVILNVGGFRHETYKATLKKIPATRLSKLTDALANYDPVLNEYFFDRHPGVFAQVLNYYRSGKLHYPTDVCGPLFEEELDFWGLDSNQVEPCCWM 125          
The following BLAST results are available for this feature:
BLAST of Voltage-gated potassium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC11.263e-4263.11potassium voltage-gated channel subfamily C member... [more]
KCNC13.217e-4263.11potassium voltage-gated channel subfamily C member... [more]
KCNC31.021e-4164.65potassium voltage-gated channel subfamily C member... [more]
KCNC31.140e-4164.65potassium voltage-gated channel subfamily C member... [more]
KCNC31.559e-4164.65potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-16.121e-5980.00SHaW family of potassium channels [Source:UniProt... [more]
shw-19.868e-5882.83SHaW family of potassium channels [Source:UniProt... [more]
shw-19.868e-5882.83SHaW family of potassium channels [Source:UniProt... [more]
shw-31.132e-5778.64SHaW family of potassium channels [Source:UniProt... [more]
shw-11.226e-5782.83SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw3.941e-6490.38gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw5.599e-6490.38gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw5.992e-6490.38gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw6.590e-6490.38gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw6.690e-6490.38gene:FBgn0003386 transcript:FBtr0289989[more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc3b4.588e-4368.69potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a7.587e-4364.08potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a7.796e-4364.08potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a1.109e-4264.08potassium voltage-gated channel, Shaw-related subf... [more]
kcnc3a1.362e-4267.68potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tamm411.567e-4266.00TAM41 mitochondrial translocator assembly and main... [more]
tamm411.614e-4266.00TAM41 mitochondrial translocator assembly and main... [more]
tamm411.879e-4266.00TAM41 mitochondrial translocator assembly and main... [more]
tamm412.064e-4266.00TAM41 mitochondrial translocator assembly and main... [more]
tamm412.305e-4266.00TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc31.604e-4364.65potassium voltage gated channel, Shaw-related subf... [more]
Kcnc31.714e-4364.65potassium voltage gated channel, Shaw-related subf... [more]
Kcnc18.582e-4363.11potassium voltage gated channel, Shaw-related subf... [more]
Kcnc12.164e-4263.11potassium voltage gated channel, Shaw-related subf... [more]
Kcnc36.639e-4264.65potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Voltage-gated potassium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME3.950e-6390.38Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL5.894e-5481.05Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|Q63959|KCNC3_MOUSE1.285e-4264.65Potassium voltage-gated channel subfamily C member... [more]
sp|Q01956|KCNC3_RAT3.431e-4264.65Potassium voltage-gated channel subfamily C member... [more]
sp|P15388|KCNC1_MOUSE6.003e-4263.11Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage-gated potassium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
U4TV343.828e-6690.20BTB domain-containing protein OS=Dendroctonus pond... [more]
A0A182PPR37.407e-6690.20BTB domain-containing protein OS=Anopheles epiroti... [more]
A0A182XKZ41.244e-6590.20BTB domain-containing protein OS=Anopheles quadria... [more]
A0A182F5V01.439e-6590.20BTB domain-containing protein OS=Anopheles albiman... [more]
H9JHT25.778e-6589.42BTB domain-containing protein OS=Bombyx mori OX=70... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048024.15.985e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000049045.17.253e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000031881.18.741e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000012289.28.902e-4469.70potassium voltage-gated channel subfamily C member... [more]
kcnc1a6.910e-4364.08potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a2.854e-4468.27potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000008567.11.914e-3048.08pep scaffold:Pmarinus_7.0:GL478165:47990:49229:1 g... [more]
ENSPMAT00000004244.11.793e-2744.55pep scaffold:Pmarinus_7.0:GL488450:6918:7731:1 gen... [more]
ENSPMAT00000004235.15.623e-2746.08pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
ENSPMAT00000011463.16.571e-2138.61pep scaffold:Pmarinus_7.0:GL479450:27175:28578:-1 ... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398041.430e-4665.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427248.171e-4567.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468443.047e-4460.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480643.904e-4457.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480665.977e-4264.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000008692.22.897e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000039227.13.218e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000028717.14.418e-4469.70potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000039174.16.498e-4469.70potassium voltage-gated channel subfamily C member... [more]
kcnc1b2.398e-4362.26potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Voltage-gated potassium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013590.12.247e-71100.00SMESG000013590.1[more]
SMESG000059794.11.450e-6792.08SMESG000059794.1[more]
SMESG000054802.12.842e-6693.07SMESG000054802.1[more]
SMESG000054802.13.514e-6693.07SMESG000054802.1[more]
SMESG000005595.11.840e-6586.67SMESG000005595.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034900 ID=SMED30034900|Name=Voltage-gated potassium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=357bp
TGAAAATCAAACTGTAAAATACGGGTTTGATTGAAATAGTGGAAGTTAAA
AAACATGACTGATGCTGGAAATCGAGTTGTCCTAAATGTCGGAGGTATTC
GTCATGAAACTTACAAAGCTACCCTGAAAAAGATTCCAGCTACTCGACTT
TCAAAATTAACAGAAGCATTAGCAAACTATGACCCAATTTTGAACGAATA
TTTCTTTGATAGGCACCCAAATGTGTTCTCGCAAATACTGAACTATTATC
GTACAGGAAAATTGCATTACCCTAATGATGTTTGTGGACCTCTTTTTGAA
GAAGAATTAGATTTCTGGGGTTTAGATTCGAATCAAGTTGAACCTTGTTG
TTGGATG
back to top

protein sequence of SMED30034900-orf-1

>SMED30034900-orf-1 ID=SMED30034900-orf-1|Name=SMED30034900-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYF
FDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCW
M
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028325VG_K_chnl
IPR015572Shaw_inv
IPR003974K_chnl_volt-dep_Kv3
IPR000210BTB/POZ_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
IPR004343Plus-3_dom
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0003677DNA binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0006810transport
GO:0006811ion transport
GO:0034765regulation of ion transmembrane transport
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 64..79
score: 89.24
coord: 82..94
score: 41.41
coord: 49..62
score: 73.02
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 6..94
e-value: 9.4E-8
score: 41.8
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 8..93
e-value: 1.9E-29
score: 101.8
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 2..94
e-value: 1.3E-43
score: 149.7
NoneNo IPR availableCDDcd18416BTB_Shaw-likecoord: 6..94
e-value: 1.11557E-68
score: 198.647
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 3..94
IPR015572Potassium channel, voltage dependent, Shaw, invertebratePANTHERPTHR11537:SF257POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAWcoord: 3..94
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 6..92