NADH-ubiquinone oxidoreductase 49 kDa subunit

Overview
NameNADH-ubiquinone oxidoreductase 49 kDa subunit
Smed IDSMED30034899
Length (bp)777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH-ubiquinone oxidoreductase 49 kDa subunit (SMED30034899) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH-ubiquinone oxidoreductase 49 kDa subunit (SMED30034899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH-ubiquinone oxidoreductase 49 kDa subunit (SMED30034899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH-ubiquinone oxidoreductase 49 kDa subunit (SMED30034899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30034899h1SMcG0021157 dd_Smed_v4_3442_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30034899h1SMcG0021157 dd_Smed_v4_3442_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Human
Match: NDUFS2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:HGNC Symbol;Acc:HGNC:7708])

HSP 1 Score: 300.827 bits (769), Expect = 4.081e-100
Identity = 139/175 (79.43%), Postives = 151/175 (86.29%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKF 759
            V N+ LNFGPQHPAAHGVLR V+ L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TRLLNH M++ TH LD+G +TP FWLFEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGLMDDIY+F   F
Sbjct:   77 VKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNF 251          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Human
Match: NDUFS2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:HGNC Symbol;Acc:HGNC:7708])

HSP 1 Score: 300.827 bits (769), Expect = 5.310e-100
Identity = 139/175 (79.43%), Postives = 151/175 (86.29%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKF 759
            V N+ LNFGPQHPAAHGVLR V+ L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TRLLNH M++ TH LD+G +TP FWLFEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGLMDDIY+F   F
Sbjct:   77 VKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNF 251          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Celegans
Match: nduf-2.2 (NADH Ubiquinone oxidoreductase Fe-S protein [Source:UniProtKB/TrEMBL;Acc:Q22800])

HSP 1 Score: 304.294 bits (778), Expect = 1.387e-101
Identity = 139/179 (77.65%), Postives = 158/179 (88.27%), Query Frame = 1
Query:  241 NVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            N+ LNFGPQHPAAHGVLR VL L+GE I+KA PHIGLLHRATEKLIE+KTYTQALPYFDRLDYVSMMCNEQ +SLA+EKLL I++PPRAKYIR LFGELTR+ NH M I TH LDVG +TP FW+FEEREK+ EF ERVSGARMHA Y+RPGGVA D+P+GLMDDIY++ VKFP R++E
Sbjct:   90 NMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDYVSMMCNEQAFSLAIEKLLGIDVPPRAKYIRILFGELTRIQNHIMGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGARMHANYVRPGGVAWDLPVGLMDDIYDWAVKFPARIDE 268          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Celegans
Match: nduf-2.2 (NADH Ubiquinone oxidoreductase Fe-S protein [Source:UniProtKB/TrEMBL;Acc:Q22800])

HSP 1 Score: 304.294 bits (778), Expect = 1.387e-101
Identity = 139/179 (77.65%), Postives = 158/179 (88.27%), Query Frame = 1
Query:  241 NVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            N+ LNFGPQHPAAHGVLR VL L+GE I+KA PHIGLLHRATEKLIE+KTYTQALPYFDRLDYVSMMCNEQ +SLA+EKLL I++PPRAKYIR LFGELTR+ NH M I TH LDVG +TP FW+FEEREK+ EF ERVSGARMHA Y+RPGGVA D+P+GLMDDIY++ VKFP R++E
Sbjct:   90 NMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDYVSMMCNEQAFSLAIEKLLGIDVPPRAKYIRILFGELTRIQNHIMGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGARMHANYVRPGGVAWDLPVGLMDDIYDWAVKFPARIDE 268          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Celegans
Match: gas-1 (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q93873])

HSP 1 Score: 303.138 bits (775), Expect = 4.592e-101
Identity = 139/179 (77.65%), Postives = 158/179 (88.27%), Query Frame = 1
Query:  241 NVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            N+ LNFGPQHPAAHGVLR VL L+GE I+KA PHIGLLHRATEKLIE+KTYTQALPYFDRLDYVSMMCNEQ +SLAVEKLL I+IP RAKYIRTL GELTR+ NH M I TH LDVG +TP FW+FEEREK+ EF ERVSGARMHA Y+RPGGVA D+P+GLMDDIY++ +KFP+R++E
Sbjct:   98 NMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDYVSMMCNEQAWSLAVEKLLGIDIPTRAKYIRTLMGELTRIQNHIMGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGARMHANYVRPGGVAWDLPIGLMDDIYDWAIKFPERIDE 276          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Fly
Match: ND-49 (gene:FBgn0039909 transcript:FBtr0333676)

HSP 1 Score: 328.561 bits (841), Expect = 3.786e-111
Identity = 162/229 (70.74%), Postives = 179/229 (78.17%), Query Frame = 1
Query:  115 AARWRIDDEFYKK--------REYVKLDTSLPXXXXXXXXXXXXXXXXVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            AA+W  D EF K+         E   L T  P          +     V N+ LNFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI++P RAKYIRTLF E+TR+LNH M++ TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+ DMPLGLMDDIYEF  KF +RL+E
Sbjct:   39 AAKWYPDPEFMKQFSGPVMYPDEVTSLWTVPPWNSKVTPVEKS-----VRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDVPLRAKYIRTLFAEITRILNHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPLGLMDDIYEFASKFAERLDE 262          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Fly
Match: ND-49 (gene:FBgn0039909 transcript:FBtr0089105)

HSP 1 Score: 328.561 bits (841), Expect = 3.786e-111
Identity = 162/229 (70.74%), Postives = 179/229 (78.17%), Query Frame = 1
Query:  115 AARWRIDDEFYKK--------REYVKLDTSLPXXXXXXXXXXXXXXXXVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            AA+W  D EF K+         E   L T  P          +     V N+ LNFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI++P RAKYIRTLF E+TR+LNH M++ TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+ DMPLGLMDDIYEF  KF +RL+E
Sbjct:   39 AAKWYPDPEFMKQFSGPVMYPDEVTSLWTVPPWNSKVTPVEKS-----VRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDVPLRAKYIRTLFAEITRILNHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPLGLMDDIYEFASKFAERLDE 262          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Fly
Match: ND-49L (gene:FBgn0039331 transcript:FBtr0273265)

HSP 1 Score: 275.789 bits (704), Expect = 8.314e-90
Identity = 126/176 (71.59%), Postives = 147/176 (83.52%), Query Frame = 1
Query:  250 LNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            +NFGP HPAAHGVLR +L LD ET+L ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVS M NE  Y LAVEKLLN+ +P RAKYIRT+F E+ RL NH M+I + +LD G +TPLFWLFEEREK+ EF ER SGAR+HAAYIRPGGVA D+PLG + D+Y+F+ +F +RL+E
Sbjct:  142 INFGPAHPAAHGVLRMILELDNETVLNADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSCMANELAYCLAVEKLLNVEVPRRAKYIRTMFSEIMRLTNHTMAIGSSVLDCGAITPLFWLFEEREKLYEFSERASGARLHAAYIRPGGVASDIPLGFLHDLYQFINQFNERLDE 317          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Zebrafish
Match: ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:ZFIN;Acc:ZDB-GENE-050522-273])

HSP 1 Score: 303.138 bits (775), Expect = 4.991e-101
Identity = 136/179 (75.98%), Postives = 154/179 (86.03%), Query Frame = 1
Query:  241 NVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            N+ +NFGPQHPAAHGVLR V+ L GE++ K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR++NH M I TH LD+G +TP FW+FEEREK+ EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYE+   F  R++E
Sbjct:   80 NLTINFGPQHPAAHGVLRLVMELSGESVKKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQAPPRAQWIRVLFGEMTRIMNHIMGITTHALDIGAMTPFFWMFEEREKLFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEWCKNFSIRIDE 258          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Match: b3gat3 (beta-1,3-glucuronyltransferase 3 [Source:Xenbase;Acc:XB-GENE-1010243])

HSP 1 Score: 303.908 bits (777), Expect = 1.128e-101
Identity = 137/181 (75.69%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ + DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++  H LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYEF+  F  R++E
Sbjct:   47 VSNLTINFGPQHPAAHGVLRLVMELSGESVKRCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTCHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEFIKNFSIRVDE 227          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Match: b3gat3 (beta-1,3-glucuronyltransferase 3 [Source:Xenbase;Acc:XB-GENE-1010243])

HSP 1 Score: 303.908 bits (777), Expect = 1.336e-101
Identity = 137/181 (75.69%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ + DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++  H LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYEF+  F  R++E
Sbjct:   47 VSNLTINFGPQHPAAHGVLRLVMELSGESVKRCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTCHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEFIKNFSIRVDE 227          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Match: b3gat3 (beta-1,3-glucuronyltransferase 3 [Source:Xenbase;Acc:XB-GENE-1010243])

HSP 1 Score: 303.908 bits (777), Expect = 1.359e-101
Identity = 137/181 (75.69%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ + DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++  H LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYEF+  F  R++E
Sbjct:   47 VSNLTINFGPQHPAAHGVLRLVMELSGESVKRCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTCHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEFIKNFSIRVDE 227          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Match: b3gat3 (beta-1,3-glucuronyltransferase 3 [Source:Xenbase;Acc:XB-GENE-1010243])

HSP 1 Score: 303.908 bits (777), Expect = 1.475e-101
Identity = 137/181 (75.69%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ + DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++  H LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYEF+  F  R++E
Sbjct:   53 VSNLTINFGPQHPAAHGVLRLVMELSGESVKRCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTCHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEFIKNFSIRVDE 233          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Match: b3gat3 (beta-1,3-glucuronyltransferase 3 [Source:Xenbase;Acc:XB-GENE-1010243])

HSP 1 Score: 303.908 bits (777), Expect = 1.487e-101
Identity = 137/181 (75.69%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ + DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++  H LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYEF+  F  R++E
Sbjct:   54 VSNLTINFGPQHPAAHGVLRLVMELSGESVKRCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTCHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEFIKNFSIRVDE 234          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Mouse
Match: Ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:MGI Symbol;Acc:MGI:2385112])

HSP 1 Score: 304.294 bits (778), Expect = 1.113e-104
Identity = 139/181 (76.80%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YS+AVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGL+DDIYEF   F  R++E
Sbjct:   50 VTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDE 230          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Mouse
Match: Ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:MGI Symbol;Acc:MGI:2385112])

HSP 1 Score: 303.908 bits (777), Expect = 2.474e-101
Identity = 139/181 (76.80%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YS+AVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGL+DDIYEF   F  R++E
Sbjct:   77 VTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDE 257          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Mouse
Match: Ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:MGI Symbol;Acc:MGI:2385112])

HSP 1 Score: 274.248 bits (700), Expect = 5.212e-90
Identity = 125/158 (79.11%), Postives = 137/158 (86.71%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQ 708
            V N+ LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YS+AVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAYIRPGGV Q
Sbjct:   77 VTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQ 234          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Mouse
Match: Ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:MGI Symbol;Acc:MGI:2385112])

HSP 1 Score: 251.136 bits (640), Expect = 4.800e-85
Identity = 114/143 (79.72%), Postives = 125/143 (87.41%), Query Frame = 1
Query:  250 LNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHA 678
            LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YS+AVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHA
Sbjct:    3 LNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHA 145          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Match: sp|Q641Y2|NDUS2_RAT (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ndufs2 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.469e-102
Identity = 142/181 (78.45%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V NV LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGLMDDIYEF   F  R++E
Sbjct:   77 VTNVTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYEFSKNFSLRIDE 257          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Match: sp|P17694|NDUS2_BOVIN (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS2 PE=1 SV=2)

HSP 1 Score: 305.064 bits (780), Expect = 5.913e-101
Identity = 140/181 (77.35%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ LNFGPQHPAAHGVLR V+ L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TRLLNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QD+PLGLMDDIYEF   F  R++E
Sbjct:   77 VSNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRLLNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGLMDDIYEFSKNFSLRIDE 257          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Match: sp|Q91WD5|NDUS2_MOUSE (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs2 PE=1 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 1.731e-100
Identity = 139/181 (76.80%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ LNFGPQHPAAHGVLR VL L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YS+AVEKLLNI  PPRA++IR LFGE+TR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGL+DDIYEF   F  R++E
Sbjct:   77 VTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDE 257          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Match: sp|Q93873|NDUS2_CAEEL (Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=gas-1 PE=3 SV=2)

HSP 1 Score: 303.138 bits (775), Expect = 5.841e-100
Identity = 139/179 (77.65%), Postives = 158/179 (88.27%), Query Frame = 1
Query:  241 NVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            N+ LNFGPQHPAAHGVLR VL L+GE I+KA PHIGLLHRATEKLIE+KTYTQALPYFDRLDYVSMMCNEQ +SLAVEKLL I+IP RAKYIRTL GELTR+ NH M I TH LDVG +TP FW+FEEREK+ EF ERVSGARMHA Y+RPGGVA D+P+GLMDDIY++ +KFP+R++E
Sbjct:   98 NMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDYVSMMCNEQAWSLAVEKLLGIDIPTRAKYIRTLMGELTRIQNHIMGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGARMHANYVRPGGVAWDLPIGLMDDIYDWAIKFPERIDE 276          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Match: sp|O75306|NDUS2_HUMAN (NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS2 PE=1 SV=2)

HSP 1 Score: 300.827 bits (769), Expect = 2.550e-99
Identity = 139/175 (79.43%), Postives = 151/175 (86.29%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKF 759
            V N+ LNFGPQHPAAHGVLR V+ L GE + K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR LFGE+TRLLNH M++ TH LD+G +TP FWLFEEREKM EFYERVSGARMHAAYIRPGGV QD+PLGLMDDIY+F   F
Sbjct:   77 VKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNF 251          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Match: B4JZW3 (GH23924 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH23924 PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 5.811e-111
Identity = 173/263 (65.78%), Postives = 193/263 (73.38%), Query Frame = 1
Query:    1 MDIFSYALIRLENLVASTHEIIFTTKCSAALQFMNGYYAARWRIDDEFYKKRE----YVKLDTSLPXXXXXXXXXXXXXXXXVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            ++IF  ++      +  T   I  T CS  L       AA+W  D EF K+      Y    TSL        +     E  V N+ LNFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI +P RAKYIRTLFGE+TR+LNH M+I TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+ DMPLGLMDDIYEF  KF +RL+E
Sbjct:    2 LNIFKRSVAGAGAQLFKTPTSIAATTCSNILSSNQQRNAAKWYPDPEFIKQFSGPVMYPDEVTSL-WKVPPWNSKVVPVEKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIEVPLRAKYIRTLFGEITRILNHIMAIGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPLGLMDDIYEFASKFAERLDE 263          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Match: A0A023EU66 (Putative nadh:ubiquinone oxidoreductase ndufs2/49 kDa subunit (Fragment) OS=Aedes albopictus OX=7160 PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 4.722e-109
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V NV++NFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI+IP RAKYIR LFGE+TR+LNH M+I TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+QD+PLGL+DDIYEF  KF +RL+E
Sbjct:   34 VRNVKINFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDIPLRAKYIRVLFGEITRILNHIMAIGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSQDLPLGLLDDIYEFASKFAERLDE 214          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Match: A0A336M652 (CSON010751 protein OS=Culicoides sonorensis OX=179676 GN=CSON010751 PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 6.244e-109
Identity = 162/225 (72.00%), Postives = 183/225 (81.33%), Query Frame = 1
Query:  115 AARWRIDDEFYKKRE----YVKLDTSLPXXXXXXXXXXXXXXXXVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            AA+W++D EF ++      Y    TS  ++        A  E  V N +LNFGPQHPAAHGVLR V+ LDGET+++ DPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLL I +P RAKYIRTLFGELTR+LNH MSI TH LD+G LTP FWLFEEREKM+EFYERVSGARMHAAY+RPGGV+ DMPLGLMDDIY++  KFPQRL+E
Sbjct:   38 AAKWQVDSEFLEQFNGAVMYPDEVTSKWKVPPYHGKILAPVEKSVKNFKLNFGPQHPAAHGVLRLVMELDGETVMRCDPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLGIEVPLRAKYIRTLFGELTRILNHIMSIGTHALDIGALTPFFWLFEEREKMMEFYERVSGARMHAAYVRPGGVSLDMPLGLMDDIYDWAQKFPQRLDE 262          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Match: Q16Q68 (AAEL011381-PA OS=Aedes aegypti OX=7159 GN=5574746 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 8.651e-109
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V NV++NFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI+IP RAKYIR LFGE+TR+LNH M+I TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+QD+PLGL+DDIYEF  KF +RL+E
Sbjct:   82 VRNVKINFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDIPLRAKYIRVLFGEITRILNHIMAIGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSQDLPLGLLDDIYEFASKFAERLDE 262          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Match: A0A182HFH3 (Complex1_49kDa domain-containing protein OS=Aedes albopictus OX=7160 GN=109405382 PE=3 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 8.745e-109
Identity = 152/181 (83.98%), Postives = 167/181 (92.27%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V NV++NFGPQHPAAHGVLR VL LDGET+++ADPHIGLLHR TEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI+IP RAKYIR LFGE+TR+LNH M+I TH LDVG LTP FWLFEEREKM+EFYERVSGARMHAAYIRPGGV+QD+PLGL+DDIYEF  KF +RL+E
Sbjct:   82 VRNVKINFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDIPLRAKYIRVLFGEITRILNHIMAIGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSQDLPLGLLDDIYEFASKFAERLDE 262          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Cavefish
Match: ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:NCBI gene;Acc:103041339])

HSP 1 Score: 304.679 bits (779), Expect = 1.160e-101
Identity = 138/181 (76.24%), Postives = 155/181 (85.64%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR L+GE+TR+LNH M I TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYE+   F  R++E
Sbjct:   79 VSNLTINFGPQHPAAHGVLRLVMELSGESVKKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRAPPRAEWIRVLYGEMTRILNHIMGITTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEWCKNFSIRIDE 259          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Nematostella
Match: EDO39377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAD2])

HSP 1 Score: 316.235 bits (809), Expect = 1.991e-107
Identity = 143/181 (79.01%), Postives = 162/181 (89.50%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR VL LDGE +++ADPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMM NEQ YSLAVEKLLNI+IP RAK+IR LFGE+TRLLNH M + TH LDVG +TP FW+FEEREK++EFYERVSGARMHAAY+RPGGV+QDMPLGLMDDIY+F+  FPQRL++
Sbjct:   26 VTNMTINFGPQHPAAHGVLRLVLELDGEVVVRADPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMTNEQAYSLAVEKLLNIDIPERAKWIRVLFGEITRLLNHIMGVTTHALDVGAMTPFFWMFEEREKLMEFYERVSGARMHAAYVRPGGVSQDMPLGLMDDIYQFIQTFPQRLDD 206          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Nematostella
Match: EDO30594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0B7])

HSP 1 Score: 92.4337 bits (228), Expect = 1.117e-24
Identity = 41/50 (82.00%), Postives = 45/50 (90.00%), Query Frame = 1
Query:  250 LNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQ 399
            +NFGPQHPAAHGVLR VL LDGE +++ADPHIGLLHR TEKLIEYKTY Q
Sbjct:    3 INFGPQHPAAHGVLRLVLELDGEVVVRADPHIGLLHRGTEKLIEYKTYLQ 52          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Medaka
Match: ndufs2 (NADH:ubiquinone oxidoreductase core subunit S2 [Source:NCBI gene;Acc:101168577])

HSP 1 Score: 305.834 bits (782), Expect = 3.841e-102
Identity = 138/181 (76.24%), Postives = 156/181 (86.19%), Query Frame = 1
Query:  235 VVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            V N+ +NFGPQHPAAHGVLR V+ L GE++ K DPHIGLLHR TEKLIEYKTY QALPYFDRLDYVSMMCNEQ YSLAVEKLLNI  PPRA++IR L+GELTR+LNH M++ TH LD+G +TP FW+FEEREKM EFYERVSGARMHAAY+RPGGV QDMPLGLMDDIYE+   F  R++E
Sbjct:   80 VSNLTINFGPQHPAAHGVLRLVMELSGESVKKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQAPPRAQWIRVLYGELTRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDMPLGLMDDIYEWCKNFSIRIDE 260          
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Planmine SMEST
Match: SMESG000024322.1 (SMESG000024322.1)

HSP 1 Score: 430.254 bits (1105), Expect = 2.094e-151
Identity = 224/229 (97.82%), Postives = 224/229 (97.82%), Query Frame = 1
Query:   91 LQFMNGYYAARWRIDDEFYKKREYVKLDTSLPXXXXXXXXXXXXXXXXVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 777
            L     YYAARWRIDDEFYKKREYVKLDTSLPELEAKKRAAYAEKEIEVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE
Sbjct:   22 LNIFKRYYAARWRIDDEFYKKREYVKLDTSLPELEAKKRAAYAEKEIEVVNVQLNFGPQHPAAHGVLRCVLTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLTPLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFLVKFPQRLEE 250          
The following BLAST results are available for this feature:
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFS24.081e-10079.43NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
NDUFS25.310e-10079.43NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nduf-2.21.387e-10177.65NADH Ubiquinone oxidoreductase Fe-S protein [Sour... [more]
nduf-2.21.387e-10177.65NADH Ubiquinone oxidoreductase Fe-S protein [Sour... [more]
gas-14.592e-10177.65Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ND-493.786e-11170.74gene:FBgn0039909 transcript:FBtr0333676[more]
ND-493.786e-11170.74gene:FBgn0039909 transcript:FBtr0089105[more]
ND-49L8.314e-9071.59gene:FBgn0039331 transcript:FBtr0273265[more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs24.991e-10175.98NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gat31.128e-10175.69beta-1,3-glucuronyltransferase 3 [Source:Xenbase;A... [more]
b3gat31.336e-10175.69beta-1,3-glucuronyltransferase 3 [Source:Xenbase;A... [more]
b3gat31.359e-10175.69beta-1,3-glucuronyltransferase 3 [Source:Xenbase;A... [more]
b3gat31.475e-10175.69beta-1,3-glucuronyltransferase 3 [Source:Xenbase;A... [more]
b3gat31.487e-10175.69beta-1,3-glucuronyltransferase 3 [Source:Xenbase;A... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ndufs21.113e-10476.80NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
Ndufs22.474e-10176.80NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
Ndufs25.212e-9079.11NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
Ndufs24.800e-8579.72NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q641Y2|NDUS2_RAT4.469e-10278.45NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|P17694|NDUS2_BOVIN5.913e-10177.35NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|Q91WD5|NDUS2_MOUSE1.731e-10076.80NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
sp|Q93873|NDUS2_CAEEL5.841e-10077.65Probable NADH dehydrogenase [ubiquinone] iron-sulf... [more]
sp|O75306|NDUS2_HUMAN2.550e-9979.43NADH dehydrogenase [ubiquinone] iron-sulfur protei... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4JZW35.811e-11165.78GH23924 OS=Drosophila grimshawi OX=7222 GN=Dgri\GH... [more]
A0A023EU664.722e-10983.98Putative nadh:ubiquinone oxidoreductase ndufs2/49 ... [more]
A0A336M6526.244e-10972.00CSON010751 protein OS=Culicoides sonorensis OX=179... [more]
Q16Q688.651e-10983.98AAEL011381-PA OS=Aedes aegypti OX=7159 GN=5574746 ... [more]
A0A182HFH38.745e-10983.98Complex1_49kDa domain-containing protein OS=Aedes ... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs21.160e-10176.24NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO393771.991e-10779.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305941.117e-2482.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs23.841e-10276.24NADH:ubiquinone oxidoreductase core subunit S2 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 49 kDa subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024322.12.094e-15197.82SMESG000024322.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034899 ID=SMED30034899|Name=NADH-ubiquinone oxidoreductase 49 kDa subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=777bp
ATGGATATTTTTTCTTATGCGCTTATTAGATTGGAAAATCTTGTGGCGTC
TACTCATGAAATCATATTCACTACCAAGTGCTCAGCAGCCTTACAATTCA
TGAACGGGTATTACGCTGCAAGGTGGCGTATAGATGACGAATTTTATAAA
AAGCGTGAATATGTTAAGCTCGACACCAGTCTCCCAGAACTTGAAGCTAA
AAAAAGGGCTGCATATGCGGAAAAAGAAATAGAAGTTGTAAACGTTCAAT
TGAACTTTGGACCCCAACATCCAGCAGCCCATGGCGTGTTAAGATGTGTG
TTAACTCTAGACGGAGAAACTATCCTGAAAGCTGATCCACATATTGGATT
GTTACACAGGGCAACAGAAAAGTTGATAGAATACAAGACTTACACACAAG
CTTTGCCATATTTTGATAGACTGGATTATGTTTCTATGATGTGCAACGAG
CAATGCTATTCCTTGGCCGTGGAGAAATTATTGAATATTAATATTCCACC
TCGTGCGAAATATATTCGAACTTTATTTGGCGAATTAACAAGACTCCTCA
ATCATGCAATGTCAATCGCAACTCATATATTAGACGTTGGAGGTTTAACC
CCTCTGTTTTGGTTGTTTGAGGAAAGGGAGAAAATGTTGGAGTTCTACGA
ACGTGTTTCTGGAGCTCGAATGCATGCAGCATATATCAGACCTGGCGGTG
TTGCTCAGGATATGCCACTGGGATTGATGGATGATATCTATGAGTTTCTA
GTAAAATTTCCCCAAAGATTAGAAGAA
back to top

protein sequence of SMED30034899-orf-1

>SMED30034899-orf-1 ID=SMED30034899-orf-1|Name=SMED30034899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=259bp
MDIFSYALIRLENLVASTHEIIFTTKCSAALQFMNGYYAARWRIDDEFYK
KREYVKLDTSLPELEAKKRAAYAEKEIEVVNVQLNFGPQHPAAHGVLRCV
LTLDGETILKADPHIGLLHRATEKLIEYKTYTQALPYFDRLDYVSMMCNE
QCYSLAVEKLLNINIPPRAKYIRTLFGELTRLLNHAMSIATHILDVGGLT
PLFWLFEEREKMLEFYERVSGARMHAAYIRPGGVAQDMPLGLMDDIYEFL
VKFPQRLEE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000103central nervous system
Vocabulary: INTERPRO
TermDefinition
IPR038290NADH_Q_OxRdtase_suD_sf
IPR029014NiFe-Hase_large
IPR001135NADH_Q_OxRdtase_suD
IPR014029NADH_UbQ_OxRdtase_49kDa_CS
Vocabulary: molecular function
TermDefinition
GO:0016651oxidoreductase activity, acting on NAD(P)H
GO:0051287NAD binding
GO:0048038quinone binding
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038290NADH-quinone oxidoreductase, subunit D superfamilyGENE3DG3DSA:1.10.645.20coord: 79..259
e-value: 7.1E-76
score: 257.3
IPR001135NADH-quinone oxidoreductase, subunit DPFAMPF00346Complex1_49kDacoord: 195..259
e-value: 2.1E-20
score: 73.0
NoneNo IPR availablePANTHERPTHR11993:SF24NADH UBIQUINONE OXIDOREDUCTASE FE-S PROTEINcoord: 53..259
NoneNo IPR availablePANTHERPTHR11993NADH-UBIQUINONE OXIDOREDUCTASE 49 KDA SUBUNITcoord: 53..259
IPR014029NADH:ubiquinone oxidoreductase, 49kDa subunit, conserved sitePROSITEPS00535COMPLEX1_49Kcoord: 118..129
IPR029014[NiFe]-hydrogenase, large subunitSUPERFAMILYSSF56762HydB/Nqo4-likecoord: 91..259