Flavin-containing monooxygenase

Overview
NameFlavin-containing monooxygenase
Smed IDSMED30034897
Length (bp)1009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flavin-containing monooxygenase (SMED30034897) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flavin-containing monooxygenase (SMED30034897) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034897

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30034897SMESG000040444.1 SMESG000035782.1 Contig13394newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034897SMESG000040444.1 SMESG000035782.1 Contig13394uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flavin-containing monooxygenase vs. Ensembl Human
Match: FMO4 (flavin containing dimethylaniline monoxygenase 4 [Source:HGNC Symbol;Acc:HGNC:3772])

HSP 1 Score: 52.373 bits (124), Expect = 6.914e-7
Identity = 50/207 (24.15%), Postives = 90/207 (43.48%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW----NTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTK---KDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   +++ T +ER  D GG+W    ++   + R +KS   N    +S ++ DF      ++ YP    ++ + + F++Y   F E + L + I + T +  I    +  E      DV+T+   K    V D V++ TG + NP  P   F    +      + H+  +  P  F          +  R+LV+G G + G+
Sbjct:   15 LSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYS-DFP----FHEDYP----NFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSE--TGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAF--PGIHKFKGQILHSQEYKIPEGF----------QGKRVLVIGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Match: ENSXETT00000037555.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:97543315:97551343:1 gene:ENSXETG00000014710.1 transcript:ENSXETT00000037555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 4.692e-7
Identity = 56/230 (24.35%), Postives = 96/230 (41.74%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKAR-DVLTKKDKE---FVHDYVVISTGLYSNPITPDHPFLS-NQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTR 823
            L ++  C    ++ T +ER  D GG+W  + K +        NTS  +  F+       FL+   P +   Y     F EY H +VE + L + I + TE+  +       +F      DV+T+K  E    + D V+I  G +++P  P   F   N    ++  +   ++  P +++  T          +LVVG G SA +   + L  I  + +    E  W  +R
Sbjct:   15 LTAIKCCLEEGLEPTCFERSEDIGGLWRNSHKYRYIISRCSTNTSKEMMCFS------DFLS---PEEFPTYLHHSKFLEYLHLYVEHFSLIKYIHFQTEVCSV---RKHPDFNSTGLWDVVTQKQGEKTVAIFDAVLICNGHFTDPCLPFECFPGINNFKGSI--IHSRTYKTPDSYNGKT----------VLVVGIGNSAADLAVE-LAHIAKQVFLSTREGSWVLSR 219          
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Match: ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:Xenbase;Acc:XB-GENE-946182])

HSP 1 Score: 51.9878 bits (123), Expect = 8.683e-7
Identity = 60/245 (24.49%), Postives = 104/245 (42.45%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW--NTNSKLKRA--HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDR 859
            L ++  C    ++ T +ER  D GG+W    N +  RA  +KS  +NTS  +S F+ DF     + D +P    +Y       EY   + + + L + I + T +  I      L+F    +  +T     K  + V D ++I +G ++ P  P   F   + T     +    +  P +F          +N R+LV+G G S G+ I   L RI         ++F +      +R  W+++R
Sbjct:   15 LAAIKCCVDEGLEPTCFERSEDIGGLWRYKDNPEDGRASIYKSVIINTSKEMSCFS-DFP----IPDDFP----NYMHNSKIMEYFRMYAQNFSLMKYIQFKTTVCSI---TKSLDFPTSGQWTVTIEKDGKQNKCVFDSILICSGHHTFPHLPLTSFPGIE-TFKGQYMHSRDYKGPEDF----------KNKRVLVIGIGNSGGD-IAVELSRIAK-------QVFLS-----TRRGAWIVNR 223          
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Match: ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:Xenbase;Acc:XB-GENE-946182])

HSP 1 Score: 51.9878 bits (123), Expect = 8.823e-7
Identity = 60/245 (24.49%), Postives = 104/245 (42.45%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW--NTNSKLKRA--HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDR 859
            L ++  C    ++ T +ER  D GG+W    N +  RA  +KS  +NTS  +S F+ DF     + D +P    +Y       EY   + + + L + I + T +  I      L+F    +  +T     K  + V D ++I +G ++ P  P   F   + T     +    +  P +F          +N R+LV+G G S G+ I   L RI         ++F +      +R  W+++R
Sbjct:   17 LAAIKCCVDEGLEPTCFERSEDIGGLWRYKDNPEDGRASIYKSVIINTSKEMSCFS-DFP----IPDDFP----NYMHNSKIMEYFRMYAQNFSLMKYIQFKTTVCSI---TKSLDFPTSGQWTVTIEKDGKQNKCVFDSILICSGHHTFPHLPLTSFPGIE-TFKGQYMHSRDYKGPEDF----------KNKRVLVIGIGNSGGD-IAVELSRIAK-------QVFLS-----TRRGAWIVNR 225          
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Match: ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:Xenbase;Acc:XB-GENE-946182])

HSP 1 Score: 51.9878 bits (123), Expect = 8.894e-7
Identity = 60/245 (24.49%), Postives = 104/245 (42.45%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW--NTNSKLKRA--HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDR 859
            L ++  C    ++ T +ER  D GG+W    N +  RA  +KS  +NTS  +S F+ DF     + D +P    +Y       EY   + + + L + I + T +  I      L+F    +  +T     K  + V D ++I +G ++ P  P   F   + T     +    +  P +F          +N R+LV+G G S G+ I   L RI         ++F +      +R  W+++R
Sbjct:   16 LAAIKCCVDEGLEPTCFERSEDIGGLWRYKDNPEDGRASIYKSVIINTSKEMSCFS-DFP----IPDDFP----NYMHNSKIMEYFRMYAQNFSLMKYIQFKTTVCSI---TKSLDFPTSGQWTVTIEKDGKQNKCVFDSILICSGHHTFPHLPLTSFPGIE-TFKGQYMHSRDYKGPEDF----------KNKRVLVIGIGNSGGD-IAVELSRIAK-------QVFLS-----TRRGAWIVNR 224          
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Match: ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:Xenbase;Acc:XB-GENE-946182])

HSP 1 Score: 51.9878 bits (123), Expect = 9.558e-7
Identity = 60/245 (24.49%), Postives = 104/245 (42.45%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW--NTNSKLKRA--HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDR 859
            L ++  C    ++ T +ER  D GG+W    N +  RA  +KS  +NTS  +S F+ DF     + D +P    +Y       EY   + + + L + I + T +  I      L+F    +  +T     K  + V D ++I +G ++ P  P   F   + T     +    +  P +F          +N R+LV+G G S G+ I   L RI         ++F +      +R  W+++R
Sbjct:   15 LAAIKCCVDEGLEPTCFERSEDIGGLWRYKDNPEDGRASIYKSVIINTSKEMSCFS-DFP----IPDDFP----NYMHNSKIMEYFRMYAQNFSLMKYIQFKTTVCSI---TKSLDFPTSGQWTVTIEKDGKQNKCVFDSILICSGHHTFPHLPLTSFPGIE-TFKGQYMHSRDYKGPEDF----------KNKRVLVIGIGNSGGD-IAVELSRIAK-------QVFLS-----TRRGAWIVNR 223          
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Match: Fmo4 (flavin containing monooxygenase 4 [Source:MGI Symbol;Acc:MGI:2429497])

HSP 1 Score: 53.9138 bits (128), Expect = 1.431e-7
Identity = 54/208 (25.96%), Postives = 92/208 (44.23%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW----NTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   N++ T +ER SDFGG+W     +   + R ++S   N    +S ++ DF       + YP    ++ S + F++Y   F E + L + I + T ++ +    +  E      DV+T    K+D+  V D V++ TG + +P  P   F    +      + H+  +  P  F             RILVVG G + G+
Sbjct:   15 LSSIKCCLDENLEPTCFERTSDFGGLWKFADTSEDGMTRVYRSLVTNVCKEMSCYS-DFP----FREDYP----NFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVTKRPDFSE--TGQWDVVTETEGKRDRA-VFDAVMVCTGQFLSPHLPLESF--PGIHKFKGQILHSQEYRIPDAF----------RGKRILVVGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Match: Fmo4 (flavin containing monooxygenase 4 [Source:MGI Symbol;Acc:MGI:2429497])

HSP 1 Score: 53.9138 bits (128), Expect = 1.431e-7
Identity = 54/208 (25.96%), Postives = 92/208 (44.23%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW----NTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   N++ T +ER SDFGG+W     +   + R ++S   N    +S ++ DF       + YP    ++ S + F++Y   F E + L + I + T ++ +    +  E      DV+T    K+D+  V D V++ TG + +P  P   F    +      + H+  +  P  F             RILVVG G + G+
Sbjct:   15 LSSIKCCLDENLEPTCFERTSDFGGLWKFADTSEDGMTRVYRSLVTNVCKEMSCYS-DFP----FREDYP----NFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVTKRPDFSE--TGQWDVVTETEGKRDRA-VFDAVMVCTGQFLSPHLPLESF--PGIHKFKGQILHSQEYRIPDAF----------RGKRILVVGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Match: Fmo1 (flavin containing monooxygenase 1 [Source:MGI Symbol;Acc:MGI:1310002])

HSP 1 Score: 50.0618 bits (118), Expect = 1.922e-6
Identity = 54/240 (22.50%), Postives = 95/240 (39.58%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEI-------LSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVW 847
            L S+  C    ++ T +ER SD GG+W     ++    S      SV+S+ + + + +   +  +P    ++     F EY   +  ++ L + I +NT++  I       +SG+ E+        V   K    + D V++ TG  +NP  P   F    LT   +      +  P  F          ++ R+LVVG G S  +   +A   +  K +       W  +R  D    W
Sbjct:   15 LASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLY---KSVVSNSSREMSCYP--DFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAVSGQWEVV------TVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSF-PGILTFKGEYFHSRQYKHPDIF----------KDKRVLVVGMGNSGTDIAVEA-SHLAKKVFLSTTGGAWVISRVFDSGYPW 231          
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Match: Fmo1 (flavin containing monooxygenase 1 [Source:MGI Symbol;Acc:MGI:1310002])

HSP 1 Score: 48.9062 bits (115), Expect = 2.782e-6
Identity = 54/215 (25.12%), Postives = 88/215 (40.93%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRA----HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEI-------LSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDA 760
            L S+  C    ++ T +ER SD GG+W     ++      +KS   N+S  +S     +  F F  D YP    ++     F EY   +  ++ L + I +NT++  I       +SG+ E+        V   K    + D V++ TG  +NP  P   F    LT   +      +  P  F          ++ R+LVVG G S  +   +A
Sbjct:   15 LASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLYKSVVSNSSREMSC----YPDFPFPED-YP----NFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAVSGQWEV------VTVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSF-PGILTFKGEYFHSRQYKHPDIF----------KDKRVLVVGMGNSGTDIAVEA 203          
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Match: Fmo1 (flavin containing monooxygenase 1 [Source:MGI Symbol;Acc:MGI:1310002])

HSP 1 Score: 49.6766 bits (117), Expect = 3.022e-6
Identity = 54/240 (22.50%), Postives = 95/240 (39.58%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEI-------LSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVW 847
            L S+  C    ++ T +ER SD GG+W     ++    S      SV+S+ + + + +   +  +P    ++     F EY   +  ++ L + I +NT++  I       +SG+ E+        V   K    + D V++ TG  +NP  P   F    LT   +      +  P  F          ++ R+LVVG G S  +   +A   +  K +       W  +R  D    W
Sbjct:   15 LASIKCCLEEGLEPTCFERSSDLGGLWRFTEHVEEGRASLY---KSVVSNSSREMSCYP--DFPFPEDYPNFVPNSLFLEYLKLYSTQFNLQRCIYFNTKVCSITKRPDFAVSGQWEVV------TVTNGKQNSAIFDAVMVCTGFLTNPHLPLDSF-PGILTFKGEYFHSRQYKHPDIF----------KDKRVLVVGMGNSGTDIAVEA-SHLAKKVFLSTTGGAWVISRVFDSGYPW 231          
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Match: sp|Q00730|STCW_EMENI (Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcW PE=3 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 1.649e-9
Identity = 50/200 (25.00%), Postives = 89/200 (44.50%), Query Frame = 2
Query:  164 ECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVI---STGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAIC 754
            +C+  NI+  +YE+  D GG W TN       +           ++   F L       YP     ++   D +EY       ++L Q + + TE+++    E E ++ ++ R     ++ E   D+  I   + G+ SNP  PD P L ++       V HT+ W P ++  V W+     + R+ V+GSG S+ +A+ 
Sbjct:   54 QCA--NIEHVVYEKNHDIGGTWLTN-------RYPNAGCDVPSHAYTYRFAL-------YPDWPRYFSYASDIWEYLDKVCAAFKLRQYMQFRTEVIKACWNEEEGQWKVRLRRQRPGQEPEEFDDHCHILLNACGVLSNPKWPDTPGLHDRFK---GRVIHTAAW-PDDYGEVQWN-----SDRVAVIGSGASSIQAVA 228          
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Match: sp|Q8VHG0|FMO4_MOUSE (Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3)

HSP 1 Score: 53.9138 bits (128), Expect = 1.001e-6
Identity = 54/208 (25.96%), Postives = 92/208 (44.23%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW----NTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLT----KKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   N++ T +ER SDFGG+W     +   + R ++S   N    +S ++ DF       + YP    ++ S + F++Y   F E + L + I + T ++ +    +  E      DV+T    K+D+  V D V++ TG + +P  P   F    +      + H+  +  P  F             RILVVG G + G+
Sbjct:   15 LSSIKCCLDENLEPTCFERTSDFGGLWKFADTSEDGMTRVYRSLVTNVCKEMSCYS-DFP----FREDYP----NFMSHEKFWDYLREFAEHFGLLRYIRFKTTVLSVTKRPDFSE--TGQWDVVTETEGKRDRA-VFDAVMVCTGQFLSPHLPLESF--PGIHKFKGQILHSQEYRIPDAF----------RGKRILVVGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Match: sp|Q8K4B7|FMO4_RAT (Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus OX=10116 GN=Fmo4 PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 2.004e-6
Identity = 52/209 (24.88%), Postives = 91/209 (43.54%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWN----TNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEI-----LSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   N++ T +ER SDFGG+W     +   + R ++S   N    +S ++ DF      ++ YP    ++ S + F++Y   F E + L + I + T +  +      S   + E + +      K+D+  V D V++ TG + +P  P   F    +      + H+  +  P  F             RILVVG G + G+
Sbjct:   15 LSSIKCCLDENLEPTCFERSSDFGGLWKFAEASEDGMTRVYRSLVTNVCKEMSCYS-DFP----FHEDYP----NFMSHEKFWDYLREFAEHFGLLKYIRFKTTVRSVTKRPDFSETGQWEVVTETEG---KQDRA-VFDAVMVCTGQFLSPRLPLESFPG--IHKFKGQILHSQEYRIPDAF----------RGKRILVVGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Match: sp|P31512|FMO4_HUMAN (Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3)

HSP 1 Score: 52.373 bits (124), Expect = 3.321e-6
Identity = 50/207 (24.15%), Postives = 90/207 (43.48%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVW----NTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTK---KDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWD-PLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L S+  C   +++ T +ER  D GG+W    ++   + R +KS   N    +S ++ DF      ++ YP    ++ + + F++Y   F E + L + I + T +  I    +  E      DV+T+   K    V D V++ TG + NP  P   F    +      + H+  +  P  F          +  R+LV+G G + G+
Sbjct:   15 LSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYS-DFP----FHEDYP----NFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSE--TGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAF--PGIHKFKGQILHSQEYKIPEGF----------QGKRVLVIGLGNTGGD 198          
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Match: sp|Q6UEF3|AFLW_ASPPU (FAD-binding monooxygenase aflW OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflW PE=3 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 7.565e-6
Identity = 41/194 (21.13%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  179 NIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDY---VVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAI 751
            N++  LYE+ +D GG W              L     ++  +V    + +     P     ++   D + Y     + + L + +V++TE+V     E+  E+ ++ R  +   +     D+   +V ++G+++NP  P  P L ++       V HT+ W P ++    W     ++ R+ V+GSG S+ + +
Sbjct:   32 NVEHVLYEKNADVGGTW--------------LENRYPMAGCDVPSHAYTYPFAPNPDWPRYFSYAPDIWNYLDRVCKVFDLRRYMVFHTEVVGCYWNEDRGEWTVRLRQHVGGSEPRDFEDHCHILVHASGVFNNPQWPQIPGLHDRFQ---GRVIHTARW-PDDYQESQW-----KHDRVAVIGSGASSIQTV 202          
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Match: A0A4Y2AQ13 (Dimethylaniline monooxygenase [N-oxide-forming] OS=Araneus ventricosus OX=182803 GN=FMO5_10 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.897e-9
Identity = 58/224 (25.89%), Postives = 94/224 (41.96%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGEN---ELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFW 811
            L ++  C   NI    YE+  + GG+W        A+ S   NT S     N    +  F +   P Q   Y       +Y   + E + L   I Y  E++EI+  E+     ++++K R++ +   +E + D V++  G +  P TP +P     L +      H+S     N+ S +      EN+R+LVVG+G S G  I   L  +  K Y       W
Sbjct:   71 LTAIKACKEENIDVICYEKSGELGGLWRYQESSSDAYTSVMKNTIS-----NTSKEMSAFSDFPPPAQFPTYLHHTMCLKYLEMYAENFDLLGSISYYQEVLEIIPSEDYGTTGKWLVKVRNLRSDATREEIFDGVMVCIGHHGCPYTPSYP----NLDLFTGPTLHSS-----NYKSSS----GMENLRVLVVGAGNS-GCDIAAELANVAKKVYLSTRRGAW 275          
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Match: A0A518C1X3 (Putative oxidoreductase CzcO OS=Planctomycetes bacterium Pan97 OX=2527984 GN=czcO PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.691e-8
Identity = 52/206 (25.24%), Postives = 89/206 (43.20%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALV 766
            L++L       I A   +R SD GG WN  S     ++ST L +S  ++         QF++   P +  +Y S  +   Y H + ER++L + +   T ++ I   +N  +  L+      K  + F  D VVI+ G ++ P+ P    ++ Q T  + +     H   L            E  R+LVVG+G S  +   +A +
Sbjct:   19 LVALKNLRQLGIDAVAVDRNSDIGGNWNIQSPHSSVYESTHLISSKGMT---------QFVDCPMPEEYPEYPSHREVLAYLHFYAERFELDRFVRKKTSVLSIKKRDNAWQIELQEEGNPGKATESF--DAVVIANGHHAKPMMPT---IAGQFTGELLHAHGYKHHRQL------------EGKRVLVVGAGNSGCDIAVEAAI 198          
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Match: A0A5P8H6A9 (Putative FAD-containing monooxygenase OS=Aspergillus pachycristatus OX=1810921 GN=stcW PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.077e-8
Identity = 52/194 (26.80%), Postives = 89/194 (45.88%), Query Frame = 2
Query:  179 NIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVI---STGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAI 751
            NI+  +YE+  D GG W TN      + +   +  S   ++   F L       YP     ++   D +EY     E ++L Q + + TE+VE    E E ++ ++ R     ++ E   D+  +   + G+ SNP  PD P L ++       V HT+ W P ++    W+     N R+ V+GSG S+ +A+
Sbjct:   57 NIEHVVYEKNHDIGGTWLTNR-----YPNAGCDVPS--HAYTYRFAL-------YPDWPRYFSYASDIWEYLDKVCEAFKLRQYMQFRTEVVEACWNEEEGQWRVRLRRQQPGQEPEEFDDHCHVLLNACGVLSNPKWPDTPGLHDRFK---GRVIHTAAW-PDDYGETQWN-----NDRVAVIGSGASSIQAV 227          
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Match: W4YGQ8 (Dimethylaniline monooxygenase [N-oxide-forming] OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.100e-8
Identity = 67/276 (24.28%), Postives = 122/276 (44.20%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFN--VDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTK-----KDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQV 955
            L+SL +C     +   +ERES FGGVW  + +  + H    L    V++S     +F+ F +     P     Y    +F  Y  A+V+ + L + I Y+T++  +   E   ++ +  R  +T      + K+   D V++ TGLYS+    ++P    + T     + H++ +   +       + + +NV  LVVG   SAG+   D   R+  K Y               ++  W++ R   G   +P  + A+  R+  +IP+WL  ++V
Sbjct:   16 LVSLKQCLEEGFEPVCFERESSFGGVWIFHDEPVKTHNRGSLYHCLVLNSSKNMTNFSDFPYQKASSP-----YIQGKEFINYIKAYVDHFDLERHIRYSTDVKRV---EKATDYDITGRWTITSACNGGEVKQETFDAVMVCTGLYSDRNMVEYPG-QEEFT---GEIMHSNEYKKAD------GLANGKNV--LVVGGSHSAGDCAVDT-SRVSKKTYLSM------------RKGTWVVQR--MGPDGMPRDM-AVNRRINFFIPEWLRRKKV 255          
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Match: A0A2P6L8H3 (Flavin-containing monooxygenase OS=Nephila clavipes OX=2585209 GN=NCL1_13364 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.946e-8
Identity = 55/208 (26.44%), Postives = 90/208 (43.27%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSG---ENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSN--QLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICD 757
            L ++  C    +  T +E+  +FGG W           S   +T S+ S   + F+ F       P    +Y       EY H + E++ L Q I Y+ E+V ++     EN  +++LK  +  + K+ E   D V+I TG  S P  P  P + N     M+  ++  T+ +               EN+R+L+VG G SA +A  D
Sbjct:   84 LTAIKCCKEEGLAVTCFEKTGNFGGRWRYRRNSIPGVASVMKSTVSIHSKEMLAFSDFP-----PPKSFPNYLHHTKMLEYLHLYAEQFNLLQHIEYDCEVVRVVPAKGYENSGKWLLKIVNATSGKEIEQEFDGVMICTGRLSRPFIPTIPSIENFRGKIMHSQSLKITTEF---------------ENLRVLIVGHGNSAMDAAVD 271          
BLAST of Flavin-containing monooxygenase vs. Ensembl Sea Lamprey
Match: si:dkey-239i20.2 (si:dkey-239i20.2 [Source:ZFIN;Acc:ZDB-GENE-041001-98])

HSP 1 Score: 46.9802 bits (110), Expect = 4.457e-6
Identity = 61/274 (22.26%), Postives = 110/274 (40.15%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRA----HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKAR---DVLTKKDKE--FVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIA-IDAMFCRLFMYIPDWL 940
            L ++  C   N++   +ER+   GG+WN   ++       ++S  +NTS  +  ++ DF +        P    ++       EY   + ++YQL + I Y T +  +   E+   F    +    V+T+   E   V D V++ TG +++P  P   FL   +        H+  +          D    E  R++VVG G S      D  V +     Q    +F +      +R  W+I+R   G   + IA +      +F ++P  L
Sbjct:   16 LTAIKCCLDENLQPVCFERDDYIGGLWNFKEQVPEGQASIYRSVIINTSKEMMCYS-DFPI--------PASFPNFMHNSRIVEYFCMYAQQYQLEKYIRYKTSVKSVKRRED---FDTSGQWDVTVVTEDGTEESSVFDAVMVCTGHHTDPHLPLDSFLG--IEKFGGRYMHSKEYK---------DHKPFEGKRVMVVGVGNSG----LDIAVELSRHASQ----VFLS-----TRRGAWVINRVAEGGKPLDIAYVRRSMAAIFSWLPTEL 253          
BLAST of Flavin-containing monooxygenase vs. Ensembl Nematostella
Match: EDO41869 (Dimethylaniline monooxygenase [N-oxide-forming] [Source:UniProtKB/TrEMBL;Acc:A7S2Z9])

HSP 1 Score: 63.5438 bits (153), Expect = 3.204e-11
Identity = 65/279 (23.30%), Postives = 117/279 (41.94%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKR--AHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEIL-------SGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVK 958
            L S+ E     ++ T YE+ S  GG+WN +   ++  A   T  NTS  +  F+ DF + +   +        Y     +  Y  ++ + + L + I +N  ++E+        +G+ E+  I      +    K  V+D+V++++G  S P  P+ P + +        + H+  +               EN RILVVG G SAG+  C+ L R  ++ Y               +R  W++ R   G + I ++I  +   L      WL  ++VK
Sbjct:   15 LCSIKEALDAGLEPTAYEKASWLGGIWNFSEDPEQSCAALCTITNTSKHVMCFS-DFPMSKTCPN--------YLPMKTYQAYLESYAKEFNLVKNIRFNVSVIEVKKCADFEETGKWEVHSIAGNSQTI----KMEVYDFVMVASGKLSEPFIPEIPGMES----FPGKLIHSKEYKTFR---------GFENRRILVVGLGNSAGDIACE-LSRHASQVYIST------------RRGTWVLPRLGPGGAPIDLSISRLVYHLPRSFLSWLVAQRVK 254          
BLAST of Flavin-containing monooxygenase vs. Ensembl Nematostella
Match: EDO32019 (Dimethylaniline monooxygenase [N-oxide-forming] [Source:UniProtKB/TrEMBL;Acc:A7SWA5])

HSP 1 Score: 46.595 bits (109), Expect = 9.674e-6
Identity = 49/208 (23.56%), Postives = 89/208 (42.79%), Query Frame = 2
Query:  149 LISLYECSLRNIKATLYERESDFGGVWNTNSKLKRA--HKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEIL-------SGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGE 745
            L+S+  C    I+   +E+E   GG+W+   + + +  ++S  +NTS  +  F+ DF + +   D  P     Y       +Y H F   + L + I Y T+++E+        +G  EL ++    D  T K K  V + V++  G +S P  P  P +     + +    H+  +          D    E   ++V+G G S G+
Sbjct:   13 LVSMKSCIDEGIEPVCFEQEDSIGGLWHFTPEERHSSVYRSIVINTSKEMMCFS-DFPIPK---DYPPFMHHSYV-----MKYFHLFARHFDLYKYIRYRTKVLEVKKTDDFNDTGNWELSYV-SLED--TTKVKREVFNGVMVCVGHHSKPYWPVFPAMHKFCGVKM----HSHAYK---------DFRGFEGKTVVVIGVGNSGGD 195          
BLAST of Flavin-containing monooxygenase vs. Planmine SMEST
Match: SMESG000040442.1 (SMESG000040442.1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 268/285 (94.04%), Postives = 273/285 (95.79%), Query Frame = 2
Query:  104 MENAHXXXXXXXXXXLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVK 958
            MEN HIGIVGGG GGLISLYECSLRNIKATLYE+ESDFGGVWN NSKLKRAHKST  +TSS+ SSFNVDFTLF FL  KYPGQEID+A  +DFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQ K
Sbjct:    1 MENIHIGIVGGGPGGLISLYECSLRNIKATLYEKESDFGGVWNFNSKLKRAHKSTVFDTSSITSSFNVDFTLFHFLKGKYPGQEIDFALSEDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQWK 285          
BLAST of Flavin-containing monooxygenase vs. Planmine SMEST
Match: SMESG000035783.1 (SMESG000035783.1)

HSP 1 Score: 508.449 bits (1308), Expect = 2.657e-179
Identity = 242/257 (94.16%), Postives = 247/257 (96.11%), Query Frame = 2
Query:  188 ATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVK 958
            ATLYE+ESDFGGVWN NSKLKRAHKST  +TSS+ SSFNVDFTLF FL  KYPGQEID+A  +DFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQ K
Sbjct:   12 ATLYEKESDFGGVWNFNSKLKRAHKSTVFDTSSITSSFNVDFTLFHFLKGKYPGQEIDFALSEDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQWK 268          
BLAST of Flavin-containing monooxygenase vs. Planmine SMEST
Match: SMESG000040444.1 (SMESG000040444.1)

HSP 1 Score: 492.656 bits (1267), Expect = 2.563e-175
Identity = 244/285 (85.61%), Postives = 265/285 (92.98%), Query Frame = 2
Query:  104 MENAHXXXXXXXXXXLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVK 958
            MENAHIGI+GGGVGGLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLN DSVTWDVM++ENVRIL++GSGQSA EAI D+LVR+++   + N ++FWAPTRQPDKR++WL+DRYPYG+   P+  D+  CRL   +P WLA R++K
Sbjct:    1 MENAHIGIIGGGVGGLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNVDSVTWDVMNKENVRILIIGSGQSAPEAIYDSLVRLESS--RTNFKMFWAPTRQPDKRNIWLLDRYPYGRFHAPVTADSFICRLHSLVPSWLASRKLK 283          
BLAST of Flavin-containing monooxygenase vs. Planmine SMEST
Match: SMESG000035782.1 (SMESG000035782.1)

HSP 1 Score: 487.649 bits (1254), Expect = 3.838e-171
Identity = 242/285 (84.91%), Postives = 264/285 (92.63%), Query Frame = 2
Query:  104 MENAHXXXXXXXXXXLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSRENVRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLIDRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVK 958
            MENAHIGI+GGGVGGLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLN DS+TWDVM++ENVRIL++GSGQSA EAI D+LVR+++   + N ++FWAPTR PDKR++WL+DRYPYG+   P+  D+  CRL   +P WLA R++K
Sbjct:    1 MENAHIGIIGGGVGGLISLYECSLRNIKATLYERESDFGGVWNTNSKLKRAHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAFVERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVISTGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNVDSMTWDVMNKENVRILIIGSGQSAPEAIYDSLVRLESS--RTNFKMFWAPTRHPDKRNIWLLDRYPYGRFHAPVTADSFICRLHSLVPSWLASRKLK 283          
The following BLAST results are available for this feature:
BLAST of Flavin-containing monooxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
FMO46.914e-724.15flavin containing dimethylaniline monoxygenase 4 [... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000037555.14.692e-724.35pep primary_assembly:Xenopus_tropicalis_v9.1:4:975... [more]
ywhaq8.683e-724.49tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaq8.823e-724.49tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaq8.894e-724.49tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaq9.558e-724.49tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fmo41.431e-725.96flavin containing monooxygenase 4 [Source:MGI Symb... [more]
Fmo41.431e-725.96flavin containing monooxygenase 4 [Source:MGI Symb... [more]
Fmo11.922e-622.50flavin containing monooxygenase 1 [Source:MGI Symb... [more]
Fmo12.782e-625.12flavin containing monooxygenase 1 [Source:MGI Symb... [more]
Fmo13.022e-622.50flavin containing monooxygenase 1 [Source:MGI Symb... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00730|STCW_EMENI1.649e-925.00Putative sterigmatocystin biosynthesis monooxygena... [more]
sp|Q8VHG0|FMO4_MOUSE1.001e-625.96Dimethylaniline monooxygenase [N-oxide-forming] 4 ... [more]
sp|Q8K4B7|FMO4_RAT2.004e-624.88Dimethylaniline monooxygenase [N-oxide-forming] 4 ... [more]
sp|P31512|FMO4_HUMAN3.321e-624.15Dimethylaniline monooxygenase [N-oxide-forming] 4 ... [more]
sp|Q6UEF3|AFLW_ASPPU7.565e-621.13FAD-binding monooxygenase aflW OS=Aspergillus para... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2AQ133.897e-925.89Dimethylaniline monooxygenase [N-oxide-forming] OS... [more]
A0A518C1X31.691e-825.24Putative oxidoreductase CzcO OS=Planctomycetes bac... [more]
A0A5P8H6A92.077e-826.80Putative FAD-containing monooxygenase OS=Aspergill... [more]
W4YGQ82.100e-824.28Dimethylaniline monooxygenase [N-oxide-forming] OS... [more]
A0A2P6L8H32.946e-826.44Flavin-containing monooxygenase OS=Nephila clavipe... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-239i20.24.457e-622.26si:dkey-239i20.2 [Source:ZFIN;Acc:ZDB-GENE-041001-... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO418693.204e-1123.30Dimethylaniline monooxygenase [N-oxide-forming] [... [more]
EDO320199.674e-623.56Dimethylaniline monooxygenase [N-oxide-forming] [... [more]
back to top
BLAST of Flavin-containing monooxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flavin-containing monooxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000040442.10.000e+094.04SMESG000040442.1[more]
SMESG000035783.12.657e-17994.16SMESG000035783.1[more]
SMESG000040444.12.563e-17585.61SMESG000040444.1[more]
SMESG000035782.13.838e-17184.91SMESG000035782.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034897 ID=SMED30034897|Name=Flavin-containing monooxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1009bp
ATTAGCCGAATTTTAAATGAAATAATTTGACTTGTAAATTCTCGCTCTCA
GCTTTAAGATTAGTTTACAAATTTTAAAAATAATTAGATAACTATTGAAA
TTTATGGAGAATGCTCATATTGGAATTGTTGGCGGAGGTGTAGGAGGATT
AATTTCATTATATGAATGTTCATTGAGGAATATTAAAGCGACATTATATG
AAAGGGAAAGTGATTTTGGAGGAGTATGGAATACTAATTCTAAATTGAAA
CGGGCTCATAAATCAACACGTTTAAACACTTCCTCGGTTATTTCATCATT
TAATGTTGATTTCACTCTATTTCAATTCCTGAATGACAAATATCCAGGAC
AAGAAATCGATTATGCTTCATGTGATGATTTTTATGAATATCAACATGCG
TTTGTTGAGCGATATCAATTATCTCAAATGATCGTTTATAACACTGAGAT
TGTGGAGATTTTATCTGGTGAAAATGAATTGGAATTCATATTGAAAGCTC
GTGATGTGTTGACAAAAAAAGATAAGGAATTTGTGCATGATTATGTCGTC
ATTTCGACCGGATTATACAGCAATCCGATCACTCCTGACCATCCGTTTCT
ATCCAATCAGTTGACAATGAACGTCGATAATGTTTGGCACACTTCTCATT
GGGATCCACTGAATTTTGATAGTGTGACCTGGGATGTGATGAGTAGGGAG
AATGTGAGGATTCTCGTCGTTGGCAGCGGGCAGAGTGCAGGAGAGGCTAT
ATGTGACGCATTAGTTAGAATTAAAAATAAAAATTATCAGCAAAATATTG
AAATATTTTGGGCTCCAACTCGACAACCGGATAAACGAAGCGTTTGGTTG
ATAGACAGATATCCTTATGGTAAGAGTAAAATTCCAATTGCAATAGATGC
AATGTTCTGTAGACTTTTCATGTACATTCCAGATTGGCTGGCTGTCAGAC
AGGTTAAAATTTGAAGTAATTAAATAAATAATAATATTAATTAATGAAGA
TGATTGTGA
back to top

protein sequence of SMED30034897-orf-1

>SMED30034897-orf-1 ID=SMED30034897-orf-1|Name=SMED30034897-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MENAHIGIVGGGVGGLISLYECSLRNIKATLYERESDFGGVWNTNSKLKR
AHKSTRLNTSSVISSFNVDFTLFQFLNDKYPGQEIDYASCDDFYEYQHAF
VERYQLSQMIVYNTEIVEILSGENELEFILKARDVLTKKDKEFVHDYVVI
STGLYSNPITPDHPFLSNQLTMNVDNVWHTSHWDPLNFDSVTWDVMSREN
VRILVVGSGQSAGEAICDALVRIKNKNYQQNIEIFWAPTRQPDKRSVWLI
DRYPYGKSKIPIAIDAMFCRLFMYIPDWLAVRQVKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036188FAD/NAD-bd_sf
IPR025700Lys/Orn_oxygenase
IPR023753FAD/NAD-binding_dom
IPR020946Flavin_mOase-like
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0004499N,N-dimethylaniline monooxygenase activity
GO:0050660flavin adenine dinucleotide binding
GO:0050661NADP binding
GO:0004497monooxygenase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0031090organelle membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3DG3DSA:3.50.50.60coord: 1..150
e-value: 3.0E-11
score: 44.6
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILYSSF51905FAD/NAD(P)-binding domaincoord: 2..107
IPR025700L-lysine 6-monooxygenase/L-ornithine 5-monooxygenasePFAMPF13434K_oxygenasecoord: 3..117
e-value: 8.3E-8
score: 31.7