glypican-1

Overview
Nameglypican-1 (AFJ24712.1)
Smed IDSMED30034893
Length (bp)2530
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of glypican-1 (SMED30034893) t-SNE clustered cells

Violin plots show distribution of expression levels for glypican-1 (SMED30034893) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of glypican-1 (SMED30034893) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for glypican-1 (SMED30034893) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034893

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034893SMESG000052359.1 Contig14494uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034893SMESG000052359.1 Contig14494newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30034893SMESG000052359.1 dd_Smed_v6_4154_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30034893SMESG000052359.1 dd_Smed_v4_4154_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of glypican-1 vs. Ensembl Human
Match: GPC4 (glypican 4 [Source:HGNC Symbol;Acc:HGNC:4452])

HSP 1 Score: 113.62 bits (283), Expect = 1.622e-25
Identity = 87/374 (23.26%), Postives = 162/374 (43.32%), Query Frame = 3
Query:  219 ICPK-TTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKN-NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQ--CWNG 1313
            ICP+ +TCC   M+ +    S+   KS+       +  +  +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y      N+E++L+ F+  + E++ R+     +   E + C++    +L P+ +V + +      A+  AR     L  A DV   +S  + P+ +CT    K  YCS C  L    PC   C +I+  C  +        ++  W   + A+  ++ + + PFN   V + + +KIS+A+MN+ +    +  K+   C         R  R+  E + S  F         +      L+ LV  +  K+K       +  + +C+        GN+  CWNG
Sbjct:   59 ICPQGSTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVS-VVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLAN-----QGDLDFEWNNFIDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNG 426          
BLAST of glypican-1 vs. Ensembl Human
Match: GPC6 (glypican 6 [Source:HGNC Symbol;Acc:HGNC:4454])

HSP 1 Score: 112.079 bits (279), Expect = 4.834e-25
Identity = 67/289 (23.18%), Postives = 137/289 (47.40%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ICP+  TCC   M+ ++   S+++ +++ E     +     +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F+  + E++ ++     + +E  + C++    +L P+ +V + +      A+  AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KISEA+MN+      +  K+   C
Sbjct:   59 ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVS-KVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN-----QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGC 341          
BLAST of glypican-1 vs. Ensembl Human
Match: GPC1 (glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449])

HSP 1 Score: 103.605 bits (257), Expect = 2.716e-22
Identity = 83/380 (21.84%), Postives = 157/380 (41.32%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM---SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLI--------RKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQG-NQCWNG 1313
            ICP+  TCC + M+  +   S  +L++      + +  +L    R  +D +Q+ L+ S+  +   F   +   Y  N R   D Y +L+LY  G   ++E+ L  F+  + E++ +     +L  ++   + CL      L P+    + +      A+  AR  V  L  A DV   ++Q  L P  EC+    K  YC+ C  +    PC   C++++  C  +        ++  W+ LL ++  I++K         V  ++H  ++EA+  + +   ++  K+   C N  +         KRR               K     +P    L  LV++   +++D+     +    +CS    L     ++CWNG
Sbjct:   61 ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDD--YLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGP--ECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLAN-----QADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRG-------------KLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNG 418          
BLAST of glypican-1 vs. Ensembl Human
Match: GPC1 (glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449])

HSP 1 Score: 91.6633 bits (226), Expect = 1.312e-18
Identity = 77/368 (20.92%), Postives = 149/368 (40.49%), Query Frame = 3
Query:  252 MKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM---SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLI--------RKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQG-NQCWNG 1313
            M+  +   S  +L++      + +  +L    R  +D +Q+ L+ S+  +   F   +   Y  N R   D Y +L+LY  G   ++E+ L  F+  + E++ +     +L  ++   + CL      L P+    + +      A+  AR  V  L  A DV   ++Q  L P  EC+    K  YC+ C  +    PC   C++++  C  +        ++  W+ LL ++  I++K         V  ++H  ++EA+  + +   ++  K+   C N  +         KRR               K     +P    L  LV++   +++D+     +    +CS    L     ++CWNG
Sbjct:    1 MEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDD--YLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGP--ECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLAN-----QADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRG-------------KLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNG 346          
BLAST of glypican-1 vs. Ensembl Human
Match: GPC1 (glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449])

HSP 1 Score: 84.7297 bits (208), Expect = 3.005e-17
Identity = 62/282 (21.99%), Postives = 121/282 (42.91%), Query Frame = 3
Query:  252 MKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKI---LRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN 1082
            M+  +   S  +L++      + +  +L    R  +D +Q+ L+ S+  +   F   +   Y  N R   D Y +L+LY  G   ++E+ L  F+  + E++   L   +L  ++   + CL      L P+    + +      A+  AR  V  L  A DV   ++Q  L P  EC+    K  YC+ C  +    PC   C++++  C  +        ++  W+ LL ++  I++K         V  ++H  ++EA+  + +   ++  K+   C N
Sbjct:    1 MEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDD--YLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGP--ECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLAN-----QADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGN 273          
BLAST of glypican-1 vs. Ensembl Celegans
Match: gpn-1 (GlyPicaN [Source:UniProtKB/TrEMBL;Acc:G5EGU4])

HSP 1 Score: 94.3597 bits (233), Expect = 8.002e-20
Identity = 75/344 (21.80%), Postives = 151/344 (43.90%), Query Frame = 3
Query:  321 IIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLY-MDGKEQNIEKILDTFFTEMAEKILRMS--ILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDV---FLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC----ENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEI 1322
            I   L +  R  N+F+   L      ++ MF  TY S Y++N + L DF+ K+K + +   E +++ I++ FF E+ + +  ++    S  N +++ C+ + + ++  + ++ + IV+         +  + SL + + +   +L+++ K     EC     +   C+ C      PC   C +I+  C       +M     AW+A   ++ K+ N+  H  N V     + + ISEA+M+       I +K+   C    E+  +RK+R+++       F+  P          ++LN +      KM +  +   N    +C       K+  +CWNG  +
Sbjct:   70 IRSFLTSQIRIFNEFFSKTLRTVHMDLDLMFSKTYGSFYQENIQLLNDFFKKIKGFSVSFAETSMKTIVELFFDELFQVMFSIANPFYSITNDQRV-CMESFYREIEAFDDIPQKIVNQLSLPLSNWKHFLGSLESLNGILEGYLNITFKE----ECERGLTRMETCAQCQRISEKPCQAYCVNILSGC-----THQMLDSEGAWRAATESMIKLGNQLNHRQNLVSALQPIPVLISEAIMHFQEKRDYITNKMIGKCLLNNEDFGLRKKRSAK-------FKAFPVITTKRSRDHLILNQMFQSFANKMDEWKVFFGNLPEYLCRGEDWASKEDERCWNGTGV 396          
BLAST of glypican-1 vs. Ensembl Fly
Match: dlp (gene:FBgn0041604 transcript:FBtr0333032)

HSP 1 Score: 98.5969 bits (244), Expect = 8.055e-21
Identity = 69/311 (22.19%), Postives = 141/311 (45.34%), Query Frame = 3
Query:  183 LLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKN---NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMP---SIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRK 1097
            +L++  S +V       TCC   M+T +   S+ +L+   +  +  +  +L + +    D +   L  S+ Q N MF+ TY   Y+ N     D + +L+ Y      ++ +++D FF  + +K+   ++L+     +   +RC++    +L P+ +V   +    K ++   R    +L  A +V    ++K++    + +CT    K  +C  C      PC   C ++I  C         ++ +  W+    A++K++ +    FN V V   L++KISEA+MN  +    I +++   C    ++K
Sbjct:  106 VLRYCESPSVG------TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMF--TVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEV----AKKVLNVRLNADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCL-----HYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGRPKLKK 399          
BLAST of glypican-1 vs. Ensembl Fly
Match: dlp (gene:FBgn0041604 transcript:FBtr0075679)

HSP 1 Score: 98.5969 bits (244), Expect = 8.208e-21
Identity = 69/311 (22.19%), Postives = 141/311 (45.34%), Query Frame = 3
Query:  183 LLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKN---NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMP---SIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRK 1097
            +L++  S +V       TCC   M+T +   S+ +L+   +  +  +  +L + +    D +   L  S+ Q N MF+ TY   Y+ N     D + +L+ Y      ++ +++D FF  + +K+   ++L+     +   +RC++    +L P+ +V   +    K ++   R    +L  A +V    ++K++    + +CT    K  +C  C      PC   C ++I  C         ++ +  W+    A++K++ +    FN V V   L++KISEA+MN  +    I +++   C    ++K
Sbjct:  106 VLRYCESPSVG------TCCTYNMETRMAMQSRQQLEGHTKDQISRMSGILGSKATKFKDIFTALLKESRTQFNSMFIRTYGVIYERNSYVFSDLFKELETYFANGRVDLLEVMDKFFNTLYQKMF--TVLNTQYTFDENYMRCVSEHMKELKPFGDVPDKLSVQIKRSFVATRTYGQALTTASEV----AKKVLNVRLNADCTGALTKMQHCGACKGYTEKPCTNYCVNVIKGCL-----HYQHEFDSEWENFAMAMDKVAERLLGSFNIVMVVEPLNIKISEAIMNFQDSGQDITNRVFQGCGRPKLKK 399          
BLAST of glypican-1 vs. Ensembl Fly
Match: dally (gene:FBgn0263930 transcript:FBtr0305901)

HSP 1 Score: 62.003 bits (149), Expect = 1.721e-9
Identity = 67/349 (19.20%), Postives = 140/349 (40.11%), Query Frame = 3
Query:  129 CQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYM---------DGK---------EQNIEKILDTFFTEM-AEKILRMSILSKNN-----AEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIE--CTTKYAKAFYCSWC------SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEK-ISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            C A+K+      Y  S D+    T      IC    CC+NA + E+   +    + +   H  S+  +L  N++           IS++  + +F   Y      ++  +   Y ++  ++         +G+         + N+E+ +  FF ++      +M  LSKNN      + + CL ++F +++P+ ++ + + SN  ++   + + +N+L  A +V  +        +   C     K  YC  C      S +ET  C G CK+++  C   +       ++  W  ++ +L   ++         + V  +L    SEA+M   +    +  K++  C
Sbjct:   69 CDAVKS------YFESIDIKSSGTYSEKGAIC-GGNCCNNATELELRDKAAGMFEQLLHHHTSSLRGVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHLIYTSNYTNSNGQLGRRGIGSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKNNLGDLHEDYVNCLQHNFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTDTCKLHLLKMHYCPNCNGHHSSSRSETKLCYGYCKNVMRGCSAEY----AGLLDSPWSGVVDSLNNLVTTHILSDTGIINVIKHLQTYFSEAIMAAMHNGPELEKKVKKTC 406          
BLAST of glypican-1 vs. Ensembl Fly
Match: dally (gene:FBgn0263930 transcript:FBtr0076583)

HSP 1 Score: 62.003 bits (149), Expect = 1.721e-9
Identity = 67/349 (19.20%), Postives = 140/349 (40.11%), Query Frame = 3
Query:  129 CQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYM---------DGK---------EQNIEKILDTFFTEM-AEKILRMSILSKNN-----AEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIE--CTTKYAKAFYCSWC------SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEK-ISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            C A+K+      Y  S D+    T      IC    CC+NA + E+   +    + +   H  S+  +L  N++           IS++  + +F   Y      ++  +   Y ++  ++         +G+         + N+E+ +  FF ++      +M  LSKNN      + + CL ++F +++P+ ++ + + SN  ++   + + +N+L  A +V  +        +   C     K  YC  C      S +ET  C G CK+++  C   +       ++  W  ++ +L   ++         + V  +L    SEA+M   +    +  K++  C
Sbjct:   69 CDAVKS------YFESIDIKSSGTYSEKGAIC-GGNCCNNATELELRDKAAGMFEQLLHHHTSSLRGVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHLIYTSNYTNSNGQLGRRGIGSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKNNLGDLHEDYVNCLQHNFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTDTCKLHLLKMHYCPNCNGHHSSSRSETKLCYGYCKNVMRGCSAEY----AGLLDSPWSGVVDSLNNLVTTHILSDTGIINVIKHLQTYFSEAIMAAMHNGPELEKKVKKTC 406          
BLAST of glypican-1 vs. Ensembl Zebrafish
Match: gpc6b (glypican 6b [Source:ZFIN;Acc:ZDB-GENE-130515-2])

HSP 1 Score: 122.865 bits (307), Expect = 1.011e-28
Identity = 97/464 (20.91%), Postives = 203/464 (43.75%), Query Frame = 3
Query:  123 VDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILR-MSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETM-PCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQY--FENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAI----CSSTFKLPKQG----NQCWNGAE----ITTGYKPNVKEKDANKNLKI-----SPLVKTSIATLQKITAALNN 1439
            ++C  +K  + +  +   D   + T+ + + V  P   CC+  M+      S    + + +   + + +   +  +  +DF+   L+ ++  +N+MF+ TY   Y  N       + +L+ +  G   N+E++L  F+T + E++ + ++   +   E + C+     +L P+ +V K + S    A+  AR  V  L    DV   ++Q  M S  C + + K  YCS+C    T+ PC   C +++  C  +        +N  W   + AL  ++ + + PFN   V   + +KISEA+MN+      +  ++   C       + R  R+  +    ++  +E +P    ++   P+      ++L+++MK+   H Q++  ++    C    ++   G     QCWNG      I    K  + ++ +N  + +       L++  I  L+ ++  L N
Sbjct:   19 LNCSLVKDAYSALGFSSDDVPAEQTSGEDLRVCAPLEACCNTQMEESFSHRSSHDFQKLMDDASEELRDTFMSGHKRFDDFFLELLESAERSLNEMFVRTYGKPYLQNAEVFQSLFSELRRFYTGGNVNLEEMLKDFWTRLLERMFQLLNSQFQITDEYLECIGKYTEQLRPFGDVPKKLKSQVTRAFIAARTFVQGLAVGRDVANRVAQVSMSS-SCVSGFTKMLYCSYCQGLFTLKPCRNYCLNVMKGCLAN-----QADLNNEWSKFIDALLLLTERLEGPFNIESVMEPIDVKISEAIMNMQENSMQLSYQVFQGCGQPEPAGMTRSARSVHDSFSGRFKPYEELPT---VASGAPL------HRLVSEMKEKLKHFQSFWVSLPLVFCKDE-QISADGQTEDQQCWNGHHSGRYIAEVQKDGLAQQASNPEVSVDVSRPDSLIRQQILALRIMSNKLKN 466          
BLAST of glypican-1 vs. Ensembl Zebrafish
Match: gpc1a (glypican 1a [Source:NCBI gene;Acc:553367])

HSP 1 Score: 115.161 bits (287), Expect = 3.125e-26
Identity = 95/398 (23.87%), Postives = 178/398 (44.72%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFL--------KLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVH---NFYTS-----IRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKT---LEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEIT-TGYKPNV 1346
            ICP+  TCC +AM+  +  +S+ + + +     +SI  LL    R  + ++   L+ S+  + + F++     Y+ N     D Y +L  Y  G   N+E+ LD F+ ++ E++L+ S     + E    L++ FL         L P+ +  + + +    A+  AR  V  L AA ++   +SQ  + S EC     K  YC  C  L    PC   CK+++  C  +        ++  W++L+  + ++++      +   V  ++ ++ISEAV+ +      YTS       D+ +    + +  + +  E    +  ++  PK+   LE+           V  + +K+K+M L+     +A+CS        G++CWNG  IT   Y P V
Sbjct:   58 ICPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQALLNAQYRTFDTYFLELLNGSERWLEEAFVAALGELYRLNAGVFRDLYAELHRYYSGASLNLEEALDEFWMKLLERLLKAS-----DPETASLLSDDFLDCASKQTETLRPFGDAPRELKAKLVRAFIAARAFVQGLNAAGEIVRKVSQVPL-SPECNRAIMKLVYCPHCRGLGSVKPCINYCKNVMKGCLAN-----QADLDTEWQSLIETMLQVASSFGAEPSMDTVIYSIPVRISEAVLAMQENMEIYTSKVFKACGDRGEEGTPSSISEEPKKKESTVTALEYKPSPKSAARLEVQ----------VTDVYSKLKEMQLYWIQLPSALCSGKTASSTTGDKCWNG--ITKASYLPEV 432          
BLAST of glypican-1 vs. Ensembl Zebrafish
Match: gpc1a (glypican 1a [Source:NCBI gene;Acc:553367])

HSP 1 Score: 115.161 bits (287), Expect = 3.703e-26
Identity = 95/398 (23.87%), Postives = 178/398 (44.72%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFL--------KLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVH---NFYTS-----IRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKT---LEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEIT-TGYKPNV 1346
            ICP+  TCC +AM+  +  +S+ + + +     +SI  LL    R  + ++   L+ S+  + + F++     Y+ N     D Y +L  Y  G   N+E+ LD F+ ++ E++L+ S     + E    L++ FL         L P+ +  + + +    A+  AR  V  L AA ++   +SQ  + S EC     K  YC  C  L    PC   CK+++  C  +        ++  W++L+  + ++++      +   V  ++ ++ISEAV+ +      YTS       D+ +    + +  + +  E    +  ++  PK+   LE+           V  + +K+K+M L+     +A+CS        G++CWNG  IT   Y P V
Sbjct:   67 ICPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQALLNAQYRTFDTYFLELLNGSERWLEEAFVAALGELYRLNAGVFRDLYAELHRYYSGASLNLEEALDEFWMKLLERLLKAS-----DPETASLLSDDFLDCASKQTETLRPFGDAPRELKAKLVRAFIAARAFVQGLNAAGEIVRKVSQVPL-SPECNRAIMKLVYCPHCRGLGSVKPCINYCKNVMKGCLAN-----QADLDTEWQSLIETMLQVASSFGAEPSMDTVIYSIPVRISEAVLAMQENMEIYTSKVFKACGDRGEEGTPSSISEEPKKKERTVTALEYKPSPKSAARLEVQ----------VTDVYSKLKEMQLYWIQLPSALCSGKTASSTTGDKCWNG--ITKASYLPEV 441          
BLAST of glypican-1 vs. Ensembl Zebrafish
Match: gpc4 (glypican 4 [Source:ZFIN;Acc:ZDB-GENE-011119-1])

HSP 1 Score: 111.694 bits (278), Expect = 4.072e-25
Identity = 100/477 (20.96%), Postives = 204/477 (42.77%), Query Frame = 3
Query:   66 LLIITVLFALFENQNAQNDV---DCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMD--GKEQNIEKILDTFFTEMAEKILRM-SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETM-PCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC-ENKL---IRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAE--------ITTGYKPNVKEKDANKNL-KISPLVKTSIATLQKITAAL 1433
            +++ TV  ++    +AQ D    +C  ++T + S  +  +D   K      + V CP+  +CC   M+ ++  +S + LK        ++        R  + F++  LD ++  +N MF+ TY   Y  N+     F+  L+ Y      E N++ +L  F++E+ E++ R+ ++  + +   + C++    +L P+ +V + +      ++   R     L    DV   +S  +  S  C     K  YC +CS    + PC   C +++  C  +        ++  W   L ++  ++ + + PFNF  V + + +KIS+A+MN+      +  K+   C + KL    R RR++++      F         +      L+ L+  +  K+K          + +C      P   + CWNG          +++G    V   D   ++ K   +++  IA L+++T+ L
Sbjct:    4 IVVFTVCMSVVVLASAQADQKSKNCNEVRTAYSSKGFNVNDVPNKGVQGAHLKV-CPQGFSCCTLEMEEKLSQLSHVDLKVPVHQLSSNLQSTFTQRHRHFDQFFRELLDNAEKSLNHMFVRTYGLMYVKNKELFEGFFSDLRRYYSHGSSEVNLDDMLAEFWSELLERMFRLVNVQYEFSDSYMECVSRHTDQLKPFGDVPRKLRLQLTRSFIAVRAFTRGLTLMPDVVRKVS-TVSASPSCVRASMKMLYCPYCSGQVALKPCKNYCLNVMRGCLAN-----QADLDTEWNNFLDSMLGLAERLEGPFNFESVVDPIDVKISDAIMNMQENSMQVSQKVFQGCGQPKLSMGFRSRRSAKDSGFPGRFRPYSPEARPTTAAGTTLDRLLTDVKKKLKHAKKFWSTLPDTVCVGERIAPS--DDCWNGTAKSRYESVVMSSGLANQVSNPDVEVDITKPDMVIRRQIAVLKEMTSWL 471          
BLAST of glypican-1 vs. Ensembl Zebrafish
Match: gpc6a (glypican 6a [Source:ZFIN;Acc:ZDB-GENE-071004-15])

HSP 1 Score: 106.686 bits (265), Expect = 1.555e-23
Identity = 62/284 (21.83%), Postives = 139/284 (48.94%), Query Frame = 3
Query:  234 TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM--SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            TCC + ++ ++   S++  + + +   ++I     +  +  ++F+   LD S+  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F++ + E++ ++  S  + ++ + + C++    +L P+ +V + + +   +A+  AR  V  L    +V  +   K+  S  C+    K +YC +C  ++   PC   C++++  C  +        ++  W   + A+  ++++ + PFN   V   + +KISEA+M + +    +  K+   C
Sbjct:   64 TCCTSDIEDQLGQQSKLDFERLVDDSSRNIRTTFTSRHKKFDEFFLELLDNSEKSLNDMFVRTYGKLYTHNSEMFEDLFSELKRYYTGGNVNLEEVLNDFWSRLLERMFQLLNSQFTFSD-DYLECISKYTDQLKPFGDVPRKLKAQVTKAFIAARSFVQGLMVGREV-ANRVAKVNISPGCSKALTKMWYCPYCGGMSGLKPCANYCQNVMRGCLAN-----QADLDPEWNLFIDAMLLVADRLEGPFNIEAVMEPIDVKISEAIMTMQDNSMQVSSKVFQGC 340          
BLAST of glypican-1 vs. Ensembl Xenopus
Match: GPC4 (glypican 4 [Source:NCBI gene;Acc:100126682])

HSP 1 Score: 116.701 bits (291), Expect = 1.375e-26
Identity = 86/403 (21.34%), Postives = 173/403 (42.93%), Query Frame = 3
Query:  129 CQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM-SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCS-LTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAE 1319
            C  ++  + S  +  +D          + V   + TCC  AM+ +    S+   K        ++  +  +     ++F++  L  +++ +N MF+ TY   Y  N     DF+ +LK Y  G   N+E++L+ F+  + E++ R+ +   +   E + C++    +L P+ +V + +      A+  AR     L  A DV   +S  + P+ +C     K  YC +CS L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KIS+A+MN+      +  K+   C         R+ R+  + + +  F +       +      L+ LV  +  K+K       +   +IC + +      + CWNG+E
Sbjct:   30 CSEVRRLYISKGFNQNDAPTHEINGDHLKVCSQRHTCCSLAMEEKYSQQSKHDFKVAVIEPCNNMQHIFASRFNKFDEFFKELLQNAENSLNDMFVRTYGRLYMQNSELFKDFFVELKKYYVGGNVNLEEMLNDFWARLLERMFRLVNPQYQFTDEYLECVSKYTDQLKPFGDVPRKLKLQVTRAFVAARTFAQGLSVARDVINKVSS-VNPTPQCVKAMLKMTYCPYCSGLVTVKPCNNYCLNVMRGCLAN-----PGDLDTEWNNFIDAMLLVAERLEGPFNIETVMDPIDVKISDAIMNMQENSMQVSQKVFQGCGQPKPLSQGRQARSVSDSNFNSRFRSYGPEERPTTAAGTSLDRLVADVKEKLKTAKKFWSSLPGSICKNNWTSGASEDDCWNGSE 426          
BLAST of glypican-1 vs. Ensembl Xenopus
Match: GPC6 (glypican 6 [Source:NCBI gene;Acc:100491173])

HSP 1 Score: 114.005 bits (284), Expect = 1.202e-25
Identity = 91/389 (23.39%), Postives = 174/389 (44.73%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYF----ENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQ--CWNGAEITTGYKPNV 1346
            ICP+  TCC + M+ ++   S+++ +S+ E     +     +  R  ++F++  L  ++  +N MF++TY   Y  N     D + +LK Y  G   N+E+IL+ F+  + E++ ++     + +E  + C++    +L P+ ++ + +      A   AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC   C +++  C  +        ++  W   + A+  + ++ + PFN   V   + +KISEA++N+      +  K+   C       L+R  R+  E +  ++     E  P T  I+      L+ LV ++  K+K       +  +AIC       +  N+  CWNG +    Y P +
Sbjct:   58 ICPQEYTCCTSEMEDKLSQQSKLEFESLVEETSHFVRATFVSWHRKFDEFFRELLKNAEKSLNDMFVNTYGMLYMQNTEVFQDLFTELKRYYTGGNVNLEEILNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDIPRKLKVQVTRALIAARTFVQGLTVGREVANRVS-KISPNPGCIRALMKMLYCPYCRGLPSVRPCSNYCLNVMKGCLAN-----QADLDIEWNLFIDAMLLVVDRLEGPFNIESVMGPIDVKISEAIVNMQENSVQVSGKVFLGCGQPKSPPLLRLSRSFSENNNVRFHPYTAEERPTTAAITS-----LDRLVIEIKDKLKVSKKLWSSLPHAICKEVRITGENPNEDKCWNG-QTRARYLPEI 434          
BLAST of glypican-1 vs. Ensembl Xenopus
Match: atf2 (activating transcription factor 2 [Source:Xenbase;Acc:XB-GENE-961088])

HSP 1 Score: 106.686 bits (265), Expect = 1.263e-23
Identity = 88/379 (23.22%), Postives = 170/379 (44.85%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMP-CDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKL-PKQGNQCWNGAEITTG-YKP 1340
            ICP+  TCC + M+     +S+++ ++       SI  LL    R+ + ++Q+ L+ S+  + + F S Y   Y  N +   D Y +L+ Y  G   N+E+ L  F++ + E++ +      + +E+ + CL   + +L P+ +  + +      A+  AR  V  L AA DV    +Q  M S EC     K  YC  C    ++  C   C +++  C  +        ++  W+ L+ +L  +++K     N   +   +H KISEA+ ++      + +K+   C      K+ N   +SE +      K  +  +     +++L++ +   + D+  +  +  +  C+      P   ++CWNG  IT G Y P
Sbjct:   41 ICPQGYTCCTSEMEENFANISRVEFEAKLRESSASIQRLLTTQHRNFDSYFQDLLNTSERVLQERFPSQYGDLYSQNSKIFRDLYSELRQYYRGSGINLEEALIEFWSRLLERVFKAQHTQYSFSEEYMDCLVKQYEQLKPFGDTPREVKLKAARAFIAARSFVQGLNAAADVVRKANQVPM-STECARAVMKLVYCPHCRGHSSIKLCSNYCWNVMRGCLAN-----QADLDSEWRNLIESLLLVADKFNGASNVENIVGAIHTKISEAITHMQENKELLTNKVFKICGTP---KKTNKGSKSEER--RRKGKATQEDKSAVATMDNLISDVKGILSDIQDYWVSLPSLFCTEKVTAGPGNEDKCWNG--ITKGRYMP 406          
BLAST of glypican-1 vs. Ensembl Xenopus
Match: atf2 (activating transcription factor 2 [Source:Xenbase;Acc:XB-GENE-961088])

HSP 1 Score: 106.301 bits (264), Expect = 2.154e-23
Identity = 88/379 (23.22%), Postives = 170/379 (44.85%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMP-CDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKL-PKQGNQCWNGAEITTG-YKP 1340
            ICP+  TCC + M+     +S+++ ++       SI  LL    R+ + ++Q+ L+ S+  + + F S Y   Y  N +   D Y +L+ Y  G   N+E+ L  F++ + E++ +      + +E+ + CL   + +L P+ +  + +      A+  AR  V  L AA DV    +Q  M S EC     K  YC  C    ++  C   C +++  C  +        ++  W+ L+ +L  +++K     N   +   +H KISEA+ ++      + +K+   C      K+ N   +SE +      K  +  +     +++L++ +   + D+  +  +  +  C+      P   ++CWNG  IT G Y P
Sbjct:   65 ICPQGYTCCTSEMEENFANISRVEFEAKLRESSASIQRLLTTQHRNFDSYFQDLLNTSERVLQERFPSQYGDLYSQNSKIFRDLYSELRQYYRGSGINLEEALIEFWSRLLERVFKAQHTQYSFSEEYMDCLVKQYEQLKPFGDTPREVKLKAARAFIAARSFVQGLNAAADVVRKANQVPM-STECARAVMKLVYCPHCRGHSSIKLCSNYCWNVMRGCLAN-----QADLDSEWRNLIESLLLVADKFNGASNVENIVGAIHTKISEAITHMQENKELLTNKVFKICGTP---KKTNKGSKSEER--RRKGKATQEDKSAVATMDNLISDVKGILSDIQDYWVSLPSLFCTEKVTAGPGNEDKCWNG--ITKGRYMP 430          
BLAST of glypican-1 vs. Ensembl Xenopus
Match: atf2 (activating transcription factor 2 [Source:Xenbase;Acc:XB-GENE-961088])

HSP 1 Score: 106.686 bits (265), Expect = 2.419e-23
Identity = 88/379 (23.22%), Postives = 171/379 (45.12%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMP-CDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKL-PKQGNQCWNGAEITTG-YKP 1340
            ICP+  TCC + M+     +S+++ ++       SI  LL    R+ + ++Q+ L+ S+  + + F S Y   Y  N +   D Y +L+ Y  G   N+E+ L  F++ + E++ +      + +E+ + CL   + +L P+ +  + +      A+  AR  V  L AA DV    +Q  M S EC     K  YC  C    ++  C   C +++  C  +        ++  W+ L+ +L  +++K     N   +   +H KISEA+ ++      + +K+   C      K+ N   +SE +  +   K  +  +     +++L++ +   + D+  +  +  +  C+      P   ++CWNG  IT G Y P
Sbjct:   72 ICPQGYTCCTSEMEENFANISRVEFEAKLRESSASIQRLLTTQHRNFDSYFQDLLNTSERVLQERFPSQYGDLYSQNSKIFRDLYSELRQYYRGSGINLEEALIEFWSRLLERVFKAQHTQYSFSEEYMDCLVKQYEQLKPFGDTPREVKLKAARAFIAARSFVQGLNAAADVVRKANQVPM-STECARAVMKLVYCPHCRGHSSIKLCSNYCWNVMRGCLAN-----QADLDSEWRNLIESLLLVADKFNGASNVENIVGAIHTKISEAITHMQENKELLTNKVFKICGTP---KKTNKGSKSEERRRKG--KATQEDKSAVATMDNLISDVKGILSDIQDYWVSLPSLFCTEKVTAGPGNEDKCWNG--ITKGRYMP 437          
BLAST of glypican-1 vs. Ensembl Mouse
Match: Gpc1 (glypican 1 [Source:MGI Symbol;Acc:MGI:1194891])

HSP 1 Score: 114.005 bits (284), Expect = 8.275e-26
Identity = 87/381 (22.83%), Postives = 165/381 (43.31%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKL-PKQGNQCWNGAEITTG-YKPNV 1346
            ICP+  TCC + M+  +   S+M+L+S      +++   L      ++D +Q  L+ S+  + + F   +   Y  N R   D Y +L+LY  G   ++E+ L  F+  + E++ +         + + CL      L P+ +  + +      A+  AR  V  L  A DV   ++Q  L P  EC+    K  YC+ C  +    PC   C++++  C  +        ++  W+ LL ++  I++K   P     V   +H+ ++EA+  + +   ++  K+   C N  +    N       +        L+  +P    L  LV++   +++D+     +    +CS    + P   ++CWNG  I+ G Y P V
Sbjct:   61 ICPQGYTCCTSEMEENLANHSRMELESALHDSSRALQATLATQLHGIDDHFQRLLNDSERTLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLAP--ECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLAN-----QADLDAEWRNLLDSMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQACGNPKV----NPHGSGPEEKRRRGKLALQ-EKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSPASDDRCWNG--ISKGRYLPEV 427          
BLAST of glypican-1 vs. Ensembl Mouse
Match: Gpc6 (glypican 6 [Source:MGI Symbol;Acc:MGI:1346322])

HSP 1 Score: 112.464 bits (280), Expect = 2.903e-25
Identity = 67/289 (23.18%), Postives = 137/289 (47.40%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ICP+  TCC   M+ ++   S+++ +++ E     +     +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F+  + E++ ++     + +E  + C++    +L P+ +V + +      A+  AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KISEA+MN+      +  K+   C
Sbjct:   59 ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVS-KVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN-----QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGC 341          
BLAST of glypican-1 vs. Ensembl Mouse
Match: Gpc6 (glypican 6 [Source:MGI Symbol;Acc:MGI:1346322])

HSP 1 Score: 112.464 bits (280), Expect = 2.903e-25
Identity = 67/289 (23.18%), Postives = 137/289 (47.40%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ICP+  TCC   M+ ++   S+++ +++ E     +     +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F+  + E++ ++     + +E  + C++    +L P+ +V + +      A+  AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KISEA+MN+      +  K+   C
Sbjct:   59 ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVS-KVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN-----QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGC 341          
BLAST of glypican-1 vs. Ensembl Mouse
Match: Gpc6 (glypican 6 [Source:MGI Symbol;Acc:MGI:1346322])

HSP 1 Score: 112.079 bits (279), Expect = 3.208e-25
Identity = 67/289 (23.18%), Postives = 137/289 (47.40%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ICP+  TCC   M+ ++   S+++ +++ E     +     +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F+  + E++ ++     + +E  + C++    +L P+ +V + +      A+  AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KISEA+MN+      +  K+   C
Sbjct:   59 ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVS-KVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN-----QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGC 341          
BLAST of glypican-1 vs. Ensembl Mouse
Match: Gpc4 (glypican 4 [Source:MGI Symbol;Acc:MGI:104902])

HSP 1 Score: 112.079 bits (279), Expect = 3.485e-25
Identity = 85/374 (22.73%), Postives = 160/374 (42.78%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKN-NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQ--CWNG 1313
            ICP+  TCC   M+ +    S+   K++       +  +  +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y      N+E++L+ F+  + E++ R+     +   E + C++    +L P+ +V + +      A+  AR     L  A DV   +S  + P+ +CT    K  YCS C  L    PC   C +I+  C  +        ++  W   + A+  ++ + + PFN   V + + +KIS+A+MN+ +    +  K+   C         R  R+  E + S  F         +      L+ LV  +  K+K       +  + +C+         N+  CWNG
Sbjct:   59 ICPQDYTCCSQEMEEKYSLQSKDDFKTVVSEQCNHLQAIFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYVAGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVSKVS-VVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLAN-----QGDLDFEWNNFIDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESAFSARFRPYHPEQRPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSTVCNDERMAAGNENEDDCWNG 426          
BLAST of glypican-1 vs. UniProt/SwissProt
Match: sp|P50593|GPC1_CHICK (Glypican-1 OS=Gallus gallus OX=9031 GN=GPC1 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 5.137e-27
Identity = 94/390 (24.10%), Postives = 167/390 (42.82%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILR-MSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLI---------RKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICS-STFKLPKQGNQCWNGAEITTG-YKPNV 1346
            ICP+  TCC + M+      S+ + +++ +   +S+  +L    +  ++++Q+ L+ S+  +   F S Y   Y  N +   D Y +L+ Y  G   N+E+ L+ F+T + E++ + M+       E + C+     +  P+  V + +      A+  AR          DV   +SQ  + S ECT    K  YC  C  +    PC   C +++  C  +        +N  WK L+ AL  ++++   P+N   V   +H++ISEA+ N+     SI  K+   C N  +         +KRR                TLE ++   + L  LV      +  +  +       +CS      P + ++CWNG  +T G Y P V
Sbjct:   58 ICPQGYTCCTSEMEENFANKSRSEFEAMMKEAGRSVQTILTAQYKSFDNYFQDLLNKSEKALYDTFPSLYGDLYTQNMKVFKDLYSELRRYYRGSNINLEEALNEFWTRLLERLFKLMNAQYHITDEYLDCMVKHAEQHKPFGEVPRDLKVKATRAFIVARSYAQGFLVGSDVVKKVSQVSL-SHECTRAVMKLMYCPHCRGMASVKPCSNYCLNVVKGCLAN-----QADLNTEWKYLMDALVAVADRIDGPYNVDTVIGTIHMRISEAISNLQENKVSITAKVFQGCGNPKVSMKGSSSEDKKRRGKV-------------TLE-AKSSAVALEMLVLDAKGNLTALKSYWVTLPGVLCSKKIMASPAEDDKCWNG--MTKGSYLPEV 425          
BLAST of glypican-1 vs. UniProt/SwissProt
Match: sp|F1QCC6|GPC1_DANRE (Glypican-1 OS=Danio rerio OX=7955 GN=gpc1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.603e-25
Identity = 95/398 (23.87%), Postives = 178/398 (44.72%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFL--------KLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVH---NFYTS-----IRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKT---LEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEIT-TGYKPNV 1346
            ICP+  TCC +AM+  +  +S+ + + +     +SI  LL    R  + ++   L+ S+  + + F++     Y+ N     D Y +L  Y  G   N+E+ LD F+ ++ E++L+ S     + E    L++ FL         L P+ +  + + +    A+  AR  V  L AA ++   +SQ  + S EC     K  YC  C  L    PC   CK+++  C  +        ++  W++L+  + ++++      +   V  ++ ++ISEAV+ +      YTS       D+ +    + +  + +  E    +  ++  PK+   LE+           V  + +K+K+M L+     +A+CS        G++CWNG  IT   Y P V
Sbjct:   58 ICPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQALLNAQYRTFDTYFLELLNGSERWLEEAFVAALGELYRLNAGVFRDLYAELHRYYSGASLNLEEALDEFWMKLLERLLKAS-----DPETASLLSDDFLDCASKQTETLRPFGDAPRELKAKLVRAFIAARAFVQGLNAAGEIVRKVSQVPL-SPECNRAIMKLVYCPHCRGLGSVKPCINYCKNVMKGCLAN-----QADLDTEWQSLIETMLQVASSFGAEPSMDTVIYSIPVRISEAVLAMQENMEIYTSKVFKACGDRGEEGTPSSISEEPKKKERTVTALEYKPSPKSAARLEVQ----------VTDVYSKLKEMQLYWIQLPSALCSGKTASSTTGDKCWNG--ITKASYLPEV 432          
BLAST of glypican-1 vs. UniProt/SwissProt
Match: sp|Q9QZF2|GPC1_MOUSE (Glypican-1 OS=Mus musculus OX=10090 GN=Gpc1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.788e-25
Identity = 87/381 (22.83%), Postives = 165/381 (43.31%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKL-PKQGNQCWNGAEITTG-YKPNV 1346
            ICP+  TCC + M+  +   S+M+L+S      +++   L      ++D +Q  L+ S+  + + F   +   Y  N R   D Y +L+LY  G   ++E+ L  F+  + E++ +         + + CL      L P+ +  + +      A+  AR  V  L  A DV   ++Q  L P  EC+    K  YC+ C  +    PC   C++++  C  +        ++  W+ LL ++  I++K   P     V   +H+ ++EA+  + +   ++  K+   C N  +    N       +        L+  +P    L  LV++   +++D+     +    +CS    + P   ++CWNG  I+ G Y P V
Sbjct:   61 ICPQGYTCCTSEMEENLANHSRMELESALHDSSRALQATLATQLHGIDDHFQRLLNDSERTLQEAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLAP--ECSRAIMKLVYCAHCRGVPGARPCPDYCRNVLKGCLAN-----QADLDAEWRNLLDSMVLITDKFWGPSGAESVIGGVHVWLAEAINALQDNKDTLTAKVIQACGNPKV----NPHGSGPEEKRRRGKLALQ-EKPSTGTLEKLVSEAKAQLRDIQDFWISLPGTLCSEKMAMSPASDDRCWNG--ISKGRYLPEV 427          
BLAST of glypican-1 vs. UniProt/SwissProt
Match: sp|O75487|GPC4_HUMAN (Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV=4)

HSP 1 Score: 113.62 bits (283), Expect = 7.791e-25
Identity = 87/374 (23.26%), Postives = 162/374 (43.32%), Query Frame = 3
Query:  219 ICPK-TTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKN-NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQ--CWNG 1313
            ICP+ +TCC   M+ +    S+   KS+       +  +  +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y      N+E++L+ F+  + E++ R+     +   E + C++    +L P+ +V + +      A+  AR     L  A DV   +S  + P+ +CT    K  YCS C  L    PC   C +I+  C  +        ++  W   + A+  ++ + + PFN   V + + +KIS+A+MN+ +    +  K+   C         R  R+  E + S  F         +      L+ LV  +  K+K       +  + +C+        GN+  CWNG
Sbjct:   59 ICPQGSTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVS-VVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLAN-----QGDLDFEWNNFIDAMLMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNG 426          
BLAST of glypican-1 vs. UniProt/SwissProt
Match: sp|Q9R087|GPC6_MOUSE (Glypican-6 OS=Mus musculus OX=10090 GN=Gpc6 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.031e-24
Identity = 67/289 (23.18%), Postives = 137/289 (47.40%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ICP+  TCC   M+ ++   S+++ +++ E     +     +  +  ++F++  L+ ++  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F+  + E++ ++     + +E  + C++    +L P+ +V + +      A+  AR  V  L    +V   +S K+ P+  C     K  YC +C  L    PC+  C +++  C  +        ++  W   + A+  ++ + + PFN   V + + +KISEA+MN+      +  K+   C
Sbjct:   59 ICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVS-KVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN-----QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGC 341          
BLAST of glypican-1 vs. TrEMBL
Match: I1ZI58 (Glypican-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1456.43 bits (3769), Expect = 0.000e+0
Identity = 749/751 (99.73%), Postives = 751/751 (100.00%), Query Frame = 3
Query:   45 MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLXXXXXXXXXXXXXXGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKPSEPRTPQIEGSGSLDTVEXXXXXXXXXXXXXXXXVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL 2297
            MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNSEEESESQYFE+VPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLPTIEPINEPKEIIEGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKP+EPRTPQIEGSGSLDTVEKSTETSKIFTTKTSTTVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL
Sbjct:    1 MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNSEEESESQYFESVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLPTIEPINEPKEIIEGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKPAEPRTPQIEGSGSLDTVEKSTETSKIFTTKTSTTVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL 751          
BLAST of glypican-1 vs. TrEMBL
Match: A0A0X3PZ77 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR151712 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.725e-37
Identity = 96/390 (24.62%), Postives = 179/390 (45.90%), Query Frame = 3
Query:   69 LIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICP---KTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM-------------------------------------SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCS-WCSLTETMP-----------CDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN 1082
            + +  L AL+    A + +DC   +  W + +YQ          S     +CP     +CCD+ M+  I  VS+ +L +     L++I + + N+   LN +++++L  ++++++  F + Y   Y+ N+ F +  +  L  YM GK   ++ +LD FF+++   I+ +                                     + L   ++++I+CL+N   K NP+  VD  + S F EAYP ARMLVNSL A   +   + +++    EC   +A+  +C  +C   E  P           C G C ++   CF       M ++  AW  L+ ++ + + + +  FNF  VN NLH+ +SEA+  V   Y+ ++ ++   C++
Sbjct:   13 VFLVFLSALYLFPLAVSGLDCARARRDWLTVQYQVLLGSRPIPMSSPPQQVCPTLGAQSCCDSNMEQNIYAVSERQLSAAMTKWLETISQQMENDCVSLNYYFRSDLKEARERLHTSFSTIYGLMYQRNRDFFYRLFADLDDYMAGKRGQLKNLLDEFFSQLRTSIVGLMETTALGGGSGGGGGGTTGGNTGHPMGGGAAAAAGSATGLRTQDSKRIQCLSNGLNKQNPFDGVDTRLQSRFLEAYPPARMLVNSLAAGSALVKSILREVSGRPECIIAFARLHHCGPYCLAREPPPSHAVPTQALDLCAGACSNLASVCFFEGKNSRMPQLADAWVQLIDSISQATTRLERSFNFPGVNKNLHIYLSEAITYVQQKYSQVKTQIDRECDS 402          
BLAST of glypican-1 vs. TrEMBL
Match: U6JA45 (Glypican OS=Echinococcus granulosus OX=6210 GN=EGR_06051 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.093e-34
Identity = 89/350 (25.43%), Postives = 173/350 (49.43%), Query Frame = 3
Query:   66 LLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQY-SDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKIL----RMSILSKNNA----EKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYC-SWCSL---TETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
             L +  L  L  N  + + +DC   K  W +++Y+  + + +  + S+T+  I   T+CCD  M+ +I  V + +L +     L  + E + ++S  L+ F++++L  +++++++ F   Y  +YK N  F F F++ L+ YM G+  ++ +++ +FF ++   I+    +  + + + A    ++I CL+ +  K N +   D  +   F + YP ARMLVNSL AA  +   + +      EC   +++  YC ++C     T    C   C + I  CF   +      +   W  L+ A+   + + +   NF  VN +LH+ +SEA+  VH  Y +++  L   C
Sbjct:   17 FLFLISLALLTWNAFSVSGLDCTKAKRDWLNYRYKVLTTNAISPSYSQTICPIIESTSCCDKQMEMDIYTVGESELPTSLANWLAPVAEQMESDSLALDYFFRSDLMEARNRLHEAFSGIYGYNYKVNHAFFFQFFNDLEAYMAGRRGDLAQLVTSFFNQLRTSIVVLMEKAEVATGSTATPDYQRINCLSEALGKQNAFDLTDVHLREQFLQVYPPARMLVNSLAAASKLLRTIVEDASKRPECIVAFSRIHYCGTYCGAREGTHAKVCPAACDNFIKTCFADASSDSSKSLPHVWSKLITAITVTTKRLERTQNFASVNKDLHIFLSEAITYVHQKYATVKPSLIQEC 366          
BLAST of glypican-1 vs. TrEMBL
Match: A0A087W1I7 (Glypican OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000241300 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.955e-33
Identity = 86/350 (24.57%), Postives = 175/350 (50.00%), Query Frame = 3
Query:   66 LLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQY-SDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKIL----RMSILSKN----NAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYC-SWCSL---TETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
             L +  L  L  +  + + +DC   K  W +++Y+  + + +  + S+ +  I   T+CCD  M+ +I  V + +L +     L  + E + ++S  L+ F++++L  +++++++ F   Y  +YK N  F F F++ L+ YM G+  ++ +++ +FF ++   I+    +  + + +    ++++I CL+ +  K N + + D  +   F + YP ARMLVNSL AA  +   + +      EC   +++  YC ++C     T+   C   C + I  CF   +      +   W  L+ A+   + + +   NF  VN +LH+ +SEA+  VH  Y +++  L   C
Sbjct:   17 FLFLISLALLSWDAFSVSGLDCTKAKRDWLNYRYKVLTTNAISPSYSQPICPIIESTSCCDKQMEMDIYTVGESELPTSLANWLVPVAEQMESDSLALDYFFRSDLMEARNRLHEAFSGIYGYNYKVNHAFFFQFFNDLEAYMAGRRGDLAQLVTSFFNQLRTSIVVLMEKAEVATGSTVTPDSQRINCLSEALGKQNAFDHTDVHLREQFLQVYPPARMLVNSLAAASKLLRTIVEDASKRPECIVAFSRIRYCGTYCGAREGTQAKVCPAACDNFIKTCFVDASSDSSKSLPHVWSKLITAITVTTKRLERTQNFASVNKDLHIFLSEAITYVHQKYATVKPSLIQEC 366          
BLAST of glypican-1 vs. TrEMBL
Match: C1LFG9 (Glypican-4 OS=Schistosoma japonicum OX=6182 GN=Xgly4 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.100e-30
Identity = 94/382 (24.61%), Postives = 175/382 (45.81%), Query Frame = 3
Query:   39 KIMNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICP--KTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRM-----SILS--------------KNNA------------EKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC---SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ++M +    LLI+T++ + +        +DC + K +W   +Y     L   T +     ICP   T+CCD  M+ E+  V Q +L       L+ +   + N+S  L   +Q +L  +K ++++ F   Y  +YK ++ F F F+  L+ YM G+   +  ++  FF ++ + I+ +      ++S               NN+             +IRCL++   +L+P+ +VD  + +   EAYP ARMLVN L     +   L  +++   +C     +  +C+ C   SL+    C   C  ++  C       E  ++   W  L+  +   +N+ +  FNF  VN NL ++ISEA+ ++   Y+  + K ++ C
Sbjct:    5 EVMRIFRSILLIMTLVTSTYA-------LDCTSFKQQWMKIRYTMLKGLHSSTINGPTSNICPVTGTSCCDVNMEREMYSVGQRQLIKQCNSWLQ-VARKMSNDSAILESIFQADLQQAKGRLHQFFSRIYGYNYKLHRNFFFGFFTDLEQYMAGQRGQLGVLIKNFFNQLRDSIVSLIEKSGQVISNPPFGSAPSNAGSFGNNSPGIEGTDEASESRRIRCLSDKIAQLHPFDDVDVRLHARMLEAYPPARMLVNVLSVTSKLLHHLVDQVVAQSQCILGITRYRFCALCEAQSLSNV--CPDSCAQLLSSCLHGDGPDEA-QLAYIWPQLIDTIVVATNRLERSFNFPAVNRNLQMEISEAITSLQTRYSETKSKFESEC 375          
BLAST of glypican-1 vs. Ensembl Cavefish
Match: gpc6a (glypican 6a [Source:ZFIN;Acc:ZDB-GENE-071004-15])

HSP 1 Score: 111.309 bits (277), Expect = 3.995e-25
Identity = 81/371 (21.83%), Postives = 164/371 (44.20%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILR-MSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN----KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWN 1310
            +C +  TCC + M+ ++   S++KL+ + E     +    ++  +  ++F+   LD S+  +N MF+ TY   Y  N     D + +LK Y  G   N+E++L+ F++ + E++ + ++       + + C++    +L P+ ++ + + +    A+  AR  V  L    +V   +S K+  S  C+    +  YC +C  L    PC   C++++  C  +        ++  W   + A+  ++ + + PFN   V   + +KISEA+M + +    +  K+   C +     L R  R   E+  +  F         +      L+ LV  +   +K          +A+CS   ++     QCWN
Sbjct:   32 VCARGQTCCSSEMEDKLGVQSKVKLEGMVEESSDVLRSTFFSRHKKFDEFFLELLDNSEKSLNDMFVRTYGKLYTHNSEIFEDLFSELKRYYTGGNVNLEEMLNDFWSRLLERMFQLLNSQYTFTDDYLECISKYTDQLKPFGDIPRKLKAQVTRAFIAARTFVQGLMVGREVANRVS-KVNVSPGCSKALTRMLYCPYCGGLPGLRPCGNYCQNVMKGCLAN-----QADLDPEWNLFIDAMLLVAERLEGPFNIEAVMEPIDVKISEAIMTMQDNSMQVSAKVFQGCGHPKPAGLSRTSRGISEKGFNTRFRPYSPEERPTTAAGTSLDRLVIDIKETLKKSKKFWSTLPDAVCSRE-RVSDDDEQCWN 395          
BLAST of glypican-1 vs. Ensembl Cavefish
Match: gpc1a (glypican 1a [Source:NCBI gene;Acc:553367])

HSP 1 Score: 98.9821 bits (245), Expect = 3.547e-21
Identity = 85/374 (22.73%), Postives = 163/374 (43.58%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMS---ILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEI--SQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGN-QCWNG 1313
            +CP+  TCC +AM+  +  +S+ + + +     +SI   L    R  + ++   L+ S+  + + F+    + Y  N     D Y +L+ Y  G   N+E+ LD F+  + E++L+ S     S  + + + C +     L  +    + + +     +  AR  V  L  A DV   +SQ  L P  EC     K  YC  C  L    PC   CK+++  C  +        ++  W+ L+  + ++++      +   + +++ ++ISEAV ++        +KL   C  +   +   +    E +  E+   TLE   S    + L   V+ + +K+K+M +      +A+C+S        N +CWNG
Sbjct:   27 VCPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQATLNAQYRSFDTYFIELLNGSERWLEEAFVKALGALYGPNAVVFRDLYSELRRYYRGAALNLEEALDEFWARLLERMLKASDPAAASLISDDFLECASKQAETLRLFGEAPRELKTRLVRVFVAARAFVQGLNMAGDVVRKVSQVPLTP--ECNRAIMKLVYCPHCRGLGSVKPCANYCKNVMKGCLAN-----QADLDTEWQNLIDTMLQVASSFGTEPSMDVILHSIPVRISEAVQHMQENMELYTNKLFQACGER-GEEGTPTSVSEEPKKKESTVTTLEYKPSSAAAVRLEVQVSDVSSKLKEMQMFWIQLASALCNSKAASGSSNNDKCWNG 392          
BLAST of glypican-1 vs. Ensembl Cavefish
Match: gpc4 (glypican-4 [Source:NCBI gene;Acc:103025650])

HSP 1 Score: 98.9821 bits (245), Expect = 3.867e-21
Identity = 83/407 (20.39%), Postives = 169/407 (41.52%), Query Frame = 3
Query:  114 QNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYM--DGKEQNIEKILDTFFTEMAEKILRM-SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETM-PCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN--KLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNG 1313
            Q   +C  ++T + S  +  +D   K      + V CP+  +CC   M+ ++   S+  LK+       ++        +  + F++  L  ++  ++ MF+ TY   Y  N      F+ +L+ Y    G   +++ +L  F+ E+ E++ R+ ++  +     + C++    +L P+ +V + +      A+  AR     L    DV   +S  +  S  C     K  YC +CS    + PC   C +++  C  +        ++  W   L A+  ++ + + PFNF  V + + +KIS+A+MN+      +  K+   C     + R +R++++      F         +      ++ LV  +  K+K          + +C        Q + CWNG
Sbjct:   24 QKSKNCNEVRTAYSSKGFNINDVPNKGVQGAHLKV-CPQGFSCCTLEMEEKLSQQSRTDLKAPVSQLSSTLQSTFTQRHQHFDQFFKELLTNAEKSLHDMFVRTYGVMYVKNAELFKHFFHELRRYYASGGAAVHLDSMLSEFWAELLERMFRLVNVQYEFTDGYMECVSRHTDQLKPFGDVPRKLKLQLTRAFVAARTFTLGLALIPDVVSKVS-TVSASPSCVRAAMKMLYCPYCSGQVALKPCKNYCLNVMRGCLAN-----QADLDTEWNNFLDAMLSLAERLEGPFNFESVMDPIDVKISDAIMNMQENSMQVSQKVFQGCGQPKPMYRSKRSTKDSGFPGRFRPYSPDTRPTTAAGTNMDRLVTDVKKKLKHAKKFWSTLPDTVCVG--DRVAQADDCWNG 421          
BLAST of glypican-1 vs. Ensembl Cavefish
Match: gpc1a (glypican 1a [Source:NCBI gene;Acc:553367])

HSP 1 Score: 98.9821 bits (245), Expect = 4.460e-21
Identity = 85/374 (22.73%), Postives = 163/374 (43.58%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMS---ILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEI--SQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGN-QCWNG 1313
            +CP+  TCC +AM+  +  +S+ + + +     +SI   L    R  + ++   L+ S+  + + F+    + Y  N     D Y +L+ Y  G   N+E+ LD F+  + E++L+ S     S  + + + C +     L  +    + + +     +  AR  V  L  A DV   +SQ  L P  EC     K  YC  C  L    PC   CK+++  C  +        ++  W+ L+  + ++++      +   + +++ ++ISEAV ++        +KL   C  +   +   +    E +  E+   TLE   S    + L   V+ + +K+K+M +      +A+C+S        N +CWNG
Sbjct:   27 VCPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQATLNAQYRSFDTYFIELLNGSERWLEEAFVKALGALYGPNAVVFRDLYSELRRYYRGAALNLEEALDEFWARLLERMLKASDPAAASLISDDFLECASKQAETLRLFGEAPRELKTRLVRVFVAARAFVQGLNMAGDVVRKVSQVPLTP--ECNRAIMKLVYCPHCRGLGSVKPCANYCKNVMKGCLAN-----QADLDTEWQNLIDTMLQVASSFGTEPSMDVILHSIPVRISEAVQHMQENMELYTNKLFQACGER-GEEGTPTSVSEEPKKKESTVTTLEYKPSSAAAVRLEVQVSDVSSKLKEMQMFWIQLASALCNSKAASGSSNNDKCWNG 392          
BLAST of glypican-1 vs. Ensembl Cavefish
Match: gpc1a (glypican 1a [Source:NCBI gene;Acc:553367])

HSP 1 Score: 98.5969 bits (244), Expect = 5.185e-21
Identity = 85/374 (22.73%), Postives = 163/374 (43.58%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMS---ILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQ-KLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEI--SQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGN-QCWNG 1313
            +CP+  TCC +AM+  +  +S+ + + +     +SI   L    R  + ++   L+ S+  + + F+    + Y  N     D Y +L+ Y  G   N+E+ LD F+  + E++L+ S     S  + + + C +     L  +    + + +     +  AR  V  L  A DV   +SQ  L P  EC     K  YC  C  L    PC   CK+++  C  +        ++  W+ L+  + ++++      +   + +++ ++ISEAV ++        +KL   C  +   +   +    E +  E+   TLE   S    + L   V+ + +K+K+M +      +A+C+S        N +CWNG
Sbjct:   55 VCPQGYTCCTSAMEETLSNLSRREFEGLVREAGRSIQATLNAQYRSFDTYFIELLNGSERWLEEAFVKALGALYGPNAVVFRDLYSELRRYYRGAALNLEEALDEFWARLLERMLKASDPAAASLISDDFLECASKQAETLRLFGEAPRELKTRLVRVFVAARAFVQGLNMAGDVVRKVSQVPLTP--ECNRAIMKLVYCPHCRGLGSVKPCANYCKNVMKGCLAN-----QADLDTEWQNLIDTMLQVASSFGTEPSMDVILHSIPVRISEAVQHMQENMELYTNKLFQACGER-GEEGTPTSVSEEPKKKESTVTTLEYKPSSAAAVRLEVQVSDVSSKLKEMQMFWIQLASALCNSKAASGSSNNDKCWNG 420          
BLAST of glypican-1 vs. Ensembl Medaka
Match: gpc2 (glypican 2 [Source:NCBI gene;Acc:101173153])

HSP 1 Score: 114.005 bits (284), Expect = 6.763e-26
Identity = 89/388 (22.94%), Postives = 171/388 (44.07%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMK--LKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCE----NKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQ---GNQCWNGAEITTGYKPNV 1346
            +CP+  TCC + M+ E LG+   +  LK+I E + + +        R  ++F++  +D+S+  MN+MF  TY   +  N     + + +L+ Y  G   ++ ++L  F++ + E++  +       +E  + C++    +L P+ ++ + +      A+  AR L   L    D+ ++ + KL    EC     + +YC  C  +    PC  LC +++  C  +        ++  W   + AL  +S K + PFN      ++ +K+SEA+M +     S+  K+   C     +    KR   E     + F       + +      L+ LV +L  +++ MT    +    IC+   KL        +CWNG +    Y P+V
Sbjct:   67 LCPQDYTCCSSQME-ETLGLQSERDFLKAIEE-NSQFLQTTFTQRHRRFDEFFRELIDLSEKSMNQMFTKTYGLLFTQNAHIFQELFVELRRYYSGSSVSLAEVLSDFWSRLVERVFSLVNPQYQFSEDYLECVSKHAEQLQPFGDMPRKLRVQVSRAFIAARSLSQGLATGRDI-VNKATKLTADPECVRGLMRQWYCPLCRGVPYLQPCHPLCLNVMKGCLAN-----QADLDTEWNNFIDALYLVSEKLEGPFNMELAAESIAVKVSEAIMYMQENSVSVSSKVFQGCGAPKPSPARSKRSPKESGGSRRPFRTYTPEEKPTTAAGTNLDRLVTELKERLRPMTGFWVSLPQTICNDE-KLAADVTNSERCWNG-QTRGRYLPDV 444          
BLAST of glypican-1 vs. Ensembl Medaka
Match: gpc2 (glypican 2 [Source:NCBI gene;Acc:101173153])

HSP 1 Score: 114.005 bits (284), Expect = 6.763e-26
Identity = 89/388 (22.94%), Postives = 171/388 (44.07%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMK--LKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEK-IRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCE----NKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQ---GNQCWNGAEITTGYKPNV 1346
            +CP+  TCC + M+ E LG+   +  LK+I E + + +        R  ++F++  +D+S+  MN+MF  TY   +  N     + + +L+ Y  G   ++ ++L  F++ + E++  +       +E  + C++    +L P+ ++ + +      A+  AR L   L    D+ ++ + KL    EC     + +YC  C  +    PC  LC +++  C  +        ++  W   + AL  +S K + PFN      ++ +K+SEA+M +     S+  K+   C     +    KR   E     + F       + +      L+ LV +L  +++ MT    +    IC+   KL        +CWNG +    Y P+V
Sbjct:   67 LCPQDYTCCSSQME-ETLGLQSERDFLKAIEE-NSQFLQTTFTQRHRRFDEFFRELIDLSEKSMNQMFTKTYGLLFTQNAHIFQELFVELRRYYSGSSVSLAEVLSDFWSRLVERVFSLVNPQYQFSEDYLECVSKHAEQLQPFGDMPRKLRVQVSRAFIAARSLSQGLATGRDI-VNKATKLTADPECVRGLMRQWYCPLCRGVPYLQPCHPLCLNVMKGCLAN-----QADLDTEWNNFIDALYLVSEKLEGPFNMELAAESIAVKVSEAIMYMQENSVSVSSKVFQGCGAPKPSPARSKRSPKESGGSRRPFRTYTPEEKPTTAAGTNLDRLVTELKERLRPMTGFWVSLPQTICNDE-KLAADVTNSERCWNG-QTRGRYLPDV 444          
BLAST of glypican-1 vs. Ensembl Medaka
Match: gpc4 (glypican-6 [Source:NCBI gene;Acc:101160491])

HSP 1 Score: 113.235 bits (282), Expect = 1.191e-25
Identity = 103/485 (21.24%), Postives = 219/485 (45.15%), Query Frame = 3
Query:   42 IMNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKT-TCCDNAMKTEILGVSQMKLK---SIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKL-KLYMDGKEQ-NIEKILDTFFTEMAEKILRM-SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETM-PCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCE----NKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAE--------ITTGYKPNVKEKDANKNL-KISPLVKTSIATLQKITAAL 1433
            ++ L + C L +  +    E    Q   +C  ++  + S  +  +D   K  +  ++ V CP+  +CC   M+ ++   S  ++K   S    +L++I +  +N+    ++F++  L  ++  ++ MFL TY   Y+ N     +F+  L + Y+DG  + +++ +L  F+ ++ E++ R+ ++  + +   + C++ +  +L P+ +V + +    K A+  AR  V  L+   +VF  +S  +  +  C     K  YC +CS    + PC   C +++  C  +        ++  W   L A+  ++++ + PFNF  V + + +KISEA+MN+      +  K+   C     ++  R +R+ +E   +  F         +      L+ L +++  K+K            +C+     P  G++CWNG          I  G        D   ++ K   ++++ IA L+++T  L
Sbjct:    4 LLVLCVVCPLAVLCVSGTAE----QKSKNCNEVRAAFSSKGFNINDVPNKGISGASLKV-CPQGFSCCTVEMEEKLSQQSHTEIKAPVSRLSTNLQTIFKERHNH---FDNFFRELLKNAEASLHNMFLRTYGKMYEQNSELFGNFFASLTRYYIDGSAKVDLDAMLTDFWADLLERMFRLVNVQFEFSDAYMECVSRNTDELQPFGDVPRKLRIQLKRAFIAARTFVRGLKLMPEVFNKVS-TVSATPSCVRAATKMLYCPYCSGQVALKPCQNYCLNVMRGCLAN-----QADLDTEWNNFLDAMLNLADRLEGPFNFESVMDPIDVKISEAIMNMQENSMQVSQKVFQGCGTPKLSQSFRSKRSLKETGFTGRFRPYTPEARPTTAAGTSLDRLTSEVKKKLKHAKKFWSTLPETVCADERIAP--GDECWNGTAKSRYELHVIGNGLANQGTNPDVEVDITKPHTVIRSQIAALKEMTIWL 472          
BLAST of glypican-1 vs. Ensembl Medaka
Match: gpc4 (glypican-6 [Source:NCBI gene;Acc:101160491])

HSP 1 Score: 106.301 bits (264), Expect = 1.711e-23
Identity = 79/353 (22.38%), Postives = 170/353 (48.16%), Query Frame = 3
Query:   42 IMNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKT-TCCDNAMKTEILGVSQMKLK---SIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKL-KLYMDGKEQ-NIEKILDTFFTEMAEKILRM-SILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETM-PCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANC 1076
            ++ L + C L +  +    E    Q   +C  ++  + S  +  +D   K  +  ++ V CP+  +CC   M+ ++   S  ++K   S    +L++I +  +N+    ++F++  L  ++  ++ MFL TY   Y+ N     +F+  L + Y+DG  + +++ +L  F+ ++ E++ R+ ++  + +   + C++ +  +L P+ +V + +    K A+  AR  V  L+   +VF  +S  +  +  C     K  YC +CS    + PC   C +++  C  +        ++  W   L A+  ++++ + PFNF  V + + +KISEA+MN+      +  K+   C
Sbjct:    4 LLVLCVVCPLAVLCVSGTAE----QKSKNCNEVRAAFSSKGFNINDVPNKGISGASLKV-CPQGFSCCTVEMEEKLSQQSHTEIKAPVSRLSTNLQTIFKERHNH---FDNFFRELLKNAEASLHNMFLRTYGKMYEQNSELFGNFFASLTRYYIDGSAKVDLDAMLTDFWADLLERMFRLVNVQFEFSDAYMECVSRNTDELQPFGDVPRKLRIQLKRAFIAARTFVRGLKLMPEVFNKVS-TVSATPSCVRAATKMLYCPYCSGQVALKPCQNYCLNVMRGCLAN-----QADLDTEWNNFLDAMLNLADRLEGPFNFESVMDPIDVKISEAIMNMQENSMQVSQKVFQGC 342          
BLAST of glypican-1 vs. Ensembl Medaka
Match: gpc6a (glypican-6 [Source:NCBI gene;Acc:101172317])

HSP 1 Score: 97.8265 bits (242), Expect = 1.080e-20
Identity = 89/423 (21.04%), Postives = 179/423 (42.32%), Query Frame = 3
Query:  219 ICPKT-TCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILR-MSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWC-SLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCE----NKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANK------NLKIS---PLVKTSIATLQKITAALNN 1439
            +CP+  TCC + M+ ++   S+++ +++ E   + +     +  +  ++F+   LD S+  +N +F  TY   Y  N     D + +LK Y  G   N+E++L+ F++ + E++ + ++       + + C+      L P+ +  + +     +A+  AR  V  L    +V  +   K+  +  C     K  YC +C  +    PC   C +++  C  +        ++  W   + A+  ++N+ + P N   V + + +KISEA++ +      +  K+   C     + L R  R   +   S++    P+    S      L  LVN +  ++++         N ICS          QCWN       +   VKE   N+      ++ I+    L++  I  L+ +T  L N
Sbjct:   59 VCPQGYTCCTSEMEEKLNQQSKLEFENMVEESSRQMRTTFISRHKKFDEFFLELLDNSEKSLNSLFTRTYGKLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWSRLLERMFQLLNSQYHFTDDYLECIGKIADVLKPFGDAPRRLKIQVTKAFIAARTFVQGLMVGREV-ANRVAKVNVAPACVRALTKMLYCPYCRGMAGLKPCHNYCHNVMRGCLAN-----QADLDSEWNLFIDAMLLVANRLEGPDNIEAVIDPVDIKISEAIITMQENSMQVSAKVFQECGQPKPSGLSRSTRG-IDMLNSRFRPYTPEQRPTSAAGTS-LERLVNDIKERLEESKRVWSKLPNDICSKEKLTQPDEEQCWNSHTKGRYFPEVVKEGLTNQINNPEVDVDITRPDTLIRQQIMALRVMTNKLKN 473          
BLAST of glypican-1 vs. Planmine SMEST
Match: SMESG000052359.1 (SMESG000052359.1)

HSP 1 Score: 1455.27 bits (3766), Expect = 0.000e+0
Identity = 748/751 (99.60%), Postives = 749/751 (99.73%), Query Frame = 3
Query:   45 MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNXXXXXXXQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLXXXXXXXXXXXXXXGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKPSEPRTPQIEGSGSLDTVEXXXXXXXXXXXXXXXXVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL 2297
            MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNSEEESESQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKN ICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLPTIEPI EPKEIIEGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKP+EPRTPQIEGSGSLDTVEKSTETSKIFTTKTSTTVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL
Sbjct:    1 MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIRKRRNSEEESESQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQNYKNTICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISEQMEGSGKGGVDIENTSNKSKPKLPTIEPIKEPKEIIEGSGEIKTPSNEISKNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKPAEPRTPQIEGSGSLDTVEKSTETSKIFTTKTSTTVVPFVMTDLVKSPKSGRPDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPNDLPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYILL 751          
BLAST of glypican-1 vs. Planmine SMEST
Match: SMESG000032627.1 (SMESG000032627.1)

HSP 1 Score: 243.432 bits (620), Expect = 3.704e-68
Identity = 160/536 (29.85%), Postives = 273/536 (50.93%), Query Frame = 3
Query:   72 IITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICP---KTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN---KLIRKRRNXXXXXXXQ--------YFE---NVPKTLEISQPKPI-----LLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGN-----QCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIK----FVEKPKITEIPRLRPSRISEQMEGSGKGGVDIEN 1586
             I + F L +   + +  +C      WYS KY Y + L  +    T    CP      CC++ +  E+  VS++KLK  AE  L++++ +  N+S  L + Y N+L+ +K+ +N++F +TY  +YK  + F F ++DKLK+YM+GK+ NI ++LD FF EMA KI+++ I  +++ E  +C  +  ++  PYQ  D ++  N   +Y  +RM VN++    D F  L  K+ PS  C  ++   F+C  C+      C   CKS++  CFGSF   E+ K++K +   L AL +++NK  +  NF  VN+ ++++IS A+MN+ N Y +I+++++A C+N   K+ RKR+ ++E    Q        ++E   N      +S+  P+      LND ++ +  ++K     L+ Y          L  Q N     QCWNG     G   +   K       +S + KT    L+ IT  +N++L  +V DP+   ++    +  KP      +     ++  +EGSG    D EN
Sbjct:    6 FIHLFFILLKFSYSTSSDECTKSTPMWYSLKYPYLNLLENYKLQNTA-FNCPILQTRNCCNSVILKEMSSVSEIKLKGFAEEKLENLLTMFSNDSYILMNMYLNDLENTKNDLNQLFSATYGYNYKVEKNFFFSWFDKLKMYMEGKKHNIGQLLDEFFLEMAGKIVKILIPPESSPEVTKCQIDRLIEAKPYQEADNSLKKNIIRSYAPSRMFVNAIAVGRDGFRALMNKITPSSNCVAQFNTQFHCMLCNGLTVKTCPVSCKSVMENCFGSFKLAELKKLDKIFTKYLSALFELANKLDNQLNFPAVNHKMNVQISTAIMNIQNIYPTIKEQIKAKCQNTGSKVRRKRQVAKEFVAWQTKLGDESPFWEKKLNDNLKSGVSKKTPVGSQNTKLNDFLSPMSRRIKTKYKALEGYFLRGVHDFCTLNSQSNESSSTQCWNGT--LPGIVTDKNNKKKLDKSSVS-VFKTVTNNLKDITMKINDLLRDKVPDPETVAVEDYLLYKSKPSSKRTGKPIKPTLAPSIEGSG----DFEN 533          
BLAST of glypican-1 vs. Planmine SMEST
Match: SMESG000032627.1 (SMESG000032627.1)

HSP 1 Score: 243.432 bits (620), Expect = 3.877e-68
Identity = 160/536 (29.85%), Postives = 273/536 (50.93%), Query Frame = 3
Query:   72 IITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKFTTSKTVDVICP---KTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNNSRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMDGKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQNVDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKAFYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEKISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCEN---KLIRKRRNXXXXXXXQ--------YFE---NVPKTLEISQPKPI-----LLNDLVNKLLTKMKDMTLHLQNYKNAICSSTFKLPKQGN-----QCWNGAEITTGYKPNVKEKDANKNLKISPLVKTSIATLQKITAALNNILSKQVVDPDAFKIK----FVEKPKITEIPRLRPSRISEQMEGSGKGGVDIEN 1586
             I + F L +   + +  +C      WYS KY Y + L  +    T    CP      CC++ +  E+  VS++KLK  AE  L++++ +  N+S  L + Y N+L+ +K+ +N++F +TY  +YK  + F F ++DKLK+YM+GK+ NI ++LD FF EMA KI+++ I  +++ E  +C  +  ++  PYQ  D ++  N   +Y  +RM VN++    D F  L  K+ PS  C  ++   F+C  C+      C   CKS++  CFGSF   E+ K++K +   L AL +++NK  +  NF  VN+ ++++IS A+MN+ N Y +I+++++A C+N   K+ RKR+ ++E    Q        ++E   N      +S+  P+      LND ++ +  ++K     L+ Y          L  Q N     QCWNG     G   +   K       +S + KT    L+ IT  +N++L  +V DP+   ++    +  KP      +     ++  +EGSG    D EN
Sbjct:   16 FIHLFFILLKFSYSTSSDECTKSTPMWYSLKYPYLNLLENYKLQNTA-FNCPILQTRNCCNSVILKEMSSVSEIKLKGFAEEKLENLLTMFSNDSYILMNMYLNDLENTKNDLNQLFSATYGYNYKVEKNFFFSWFDKLKMYMEGKKHNIGQLLDEFFLEMAGKIVKILIPPESSPEVTKCQIDRLIEAKPYQEADNSLKKNIIRSYAPSRMFVNAIAVGRDGFRALMNKITPSSNCVAQFNTQFHCMLCNGLTVKTCPVSCKSVMENCFGSFKLAELKKLDKIFTKYLSALFELANKLDNQLNFPAVNHKMNVQISTAIMNIQNIYPTIKEQIKAKCQNTGSKVRRKRQVAKEFVAWQTKLGDESPFWEKKLNDNLKSGVSKKTPVGSQNTKLNDFLSPMSRRIKTKYKALEGYFLRGVHDFCTLNSQSNESSSTQCWNGT--LPGIVTDKNNKKKLDKSSVS-VFKTVTNNLKDITMKINDLLRDKVPDPETVAVEDYLLYKSKPSSKRTGKPIKPTLAPSIEGSG----DFEN 543          
The following BLAST results are available for this feature:
BLAST of glypican-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPC41.622e-2523.26glypican 4 [Source:HGNC Symbol;Acc:HGNC:4452][more]
GPC64.834e-2523.18glypican 6 [Source:HGNC Symbol;Acc:HGNC:4454][more]
GPC12.716e-2221.84glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449][more]
GPC11.312e-1820.92glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449][more]
GPC13.005e-1721.99glypican 1 [Source:HGNC Symbol;Acc:HGNC:4449][more]
back to top
BLAST of glypican-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpn-18.002e-2021.80GlyPicaN [Source:UniProtKB/TrEMBL;Acc:G5EGU4][more]
back to top
BLAST of glypican-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dlp8.055e-2122.19gene:FBgn0041604 transcript:FBtr0333032[more]
dlp8.208e-2122.19gene:FBgn0041604 transcript:FBtr0075679[more]
dally1.721e-919.20gene:FBgn0263930 transcript:FBtr0305901[more]
dally1.721e-919.20gene:FBgn0263930 transcript:FBtr0076583[more]
back to top
BLAST of glypican-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc6b1.011e-2820.91glypican 6b [Source:ZFIN;Acc:ZDB-GENE-130515-2][more]
gpc1a3.125e-2623.87glypican 1a [Source:NCBI gene;Acc:553367][more]
gpc1a3.703e-2623.87glypican 1a [Source:NCBI gene;Acc:553367][more]
gpc44.072e-2520.96glypican 4 [Source:ZFIN;Acc:ZDB-GENE-011119-1][more]
gpc6a1.555e-2321.83glypican 6a [Source:ZFIN;Acc:ZDB-GENE-071004-15][more]
back to top
BLAST of glypican-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPC41.375e-2621.34glypican 4 [Source:NCBI gene;Acc:100126682][more]
GPC61.202e-2523.39glypican 6 [Source:NCBI gene;Acc:100491173][more]
atf21.263e-2323.22activating transcription factor 2 [Source:Xenbase;... [more]
atf22.154e-2323.22activating transcription factor 2 [Source:Xenbase;... [more]
atf22.419e-2323.22activating transcription factor 2 [Source:Xenbase;... [more]
back to top
BLAST of glypican-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpc18.275e-2622.83glypican 1 [Source:MGI Symbol;Acc:MGI:1194891][more]
Gpc62.903e-2523.18glypican 6 [Source:MGI Symbol;Acc:MGI:1346322][more]
Gpc62.903e-2523.18glypican 6 [Source:MGI Symbol;Acc:MGI:1346322][more]
Gpc63.208e-2523.18glypican 6 [Source:MGI Symbol;Acc:MGI:1346322][more]
Gpc43.485e-2522.73glypican 4 [Source:MGI Symbol;Acc:MGI:104902][more]
back to top
BLAST of glypican-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50593|GPC1_CHICK5.137e-2724.10Glypican-1 OS=Gallus gallus OX=9031 GN=GPC1 PE=2 S... [more]
sp|F1QCC6|GPC1_DANRE2.603e-2523.87Glypican-1 OS=Danio rerio OX=7955 GN=gpc1 PE=2 SV=... [more]
sp|Q9QZF2|GPC1_MOUSE5.788e-2522.83Glypican-1 OS=Mus musculus OX=10090 GN=Gpc1 PE=1 S... [more]
sp|O75487|GPC4_HUMAN7.791e-2523.26Glypican-4 OS=Homo sapiens OX=9606 GN=GPC4 PE=1 SV... [more]
sp|Q9R087|GPC6_MOUSE2.031e-2423.18Glypican-6 OS=Mus musculus OX=10090 GN=Gpc6 PE=1 S... [more]
back to top
BLAST of glypican-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI580.000e+099.73Glypican-1 OS=Schmidtea mediterranea OX=79327 PE=2... [more]
A0A0X3PZ773.725e-3724.62Uncharacterized protein OS=Schistocephalus solidus... [more]
U6JA452.093e-3425.43Glypican OS=Echinococcus granulosus OX=6210 GN=EGR... [more]
A0A087W1I71.955e-3324.57Glypican OS=Echinococcus multilocularis OX=6211 GN... [more]
C1LFG91.100e-3024.61Glypican-4 OS=Schistosoma japonicum OX=6182 GN=Xgl... [more]
back to top
BLAST of glypican-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc6a3.995e-2521.83glypican 6a [Source:ZFIN;Acc:ZDB-GENE-071004-15][more]
gpc1a3.547e-2122.73glypican 1a [Source:NCBI gene;Acc:553367][more]
gpc43.867e-2120.39glypican-4 [Source:NCBI gene;Acc:103025650][more]
gpc1a4.460e-2122.73glypican 1a [Source:NCBI gene;Acc:553367][more]
gpc1a5.185e-2122.73glypican 1a [Source:NCBI gene;Acc:553367][more]
back to top
BLAST of glypican-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glypican-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glypican-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glypican-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpc26.763e-2622.94glypican 2 [Source:NCBI gene;Acc:101173153][more]
gpc26.763e-2622.94glypican 2 [Source:NCBI gene;Acc:101173153][more]
gpc41.191e-2521.24glypican-6 [Source:NCBI gene;Acc:101160491][more]
gpc41.711e-2322.38glypican-6 [Source:NCBI gene;Acc:101160491][more]
gpc6a1.080e-2021.04glypican-6 [Source:NCBI gene;Acc:101172317][more]
back to top
BLAST of glypican-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052359.10.000e+099.60SMESG000052359.1[more]
SMESG000032627.13.704e-6829.85SMESG000032627.1[more]
SMESG000032627.13.877e-6829.85SMESG000032627.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034893
GenBankAFJ24712.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034893 ID=SMED30034893|Name=glypican-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2530bp
CTATATAAATCTTATATGATTTTGGATTGACTTGAACTAAAATTATGAAT
TTAAGTATCGATTGTCTTTTAATTATAACCGTTTTGTTTGCTTTATTCGA
AAATCAAAATGCTCAAAACGATGTCGATTGTCAAGCAATAAAAACAAGAT
GGTATTCTCATAAATATCAATATTCAGATGATTTGTTGAAATTCACTACA
TCTAAAACTGTCGATGTGATCTGCCCCAAAACAACCTGCTGTGATAATGC
AATGAAAACAGAAATTCTAGGAGTTAGTCAAATGAAATTAAAATCAATTG
CAGAAATTCATTTGAAAAGCATAATAGAATTACTTTATAACAATAGCAGG
GATTTAAATGATTTCTATCAAAACAATCTCGATATTTCTAAAGACCAAAT
GAATAAAATGTTTCTTAGCACATATGCCAGCAGTTATAAAGATAACCAGC
GGTTTTTATTTGACTTCTATGACAAATTAAAGCTCTACATGGATGGTAAG
GAACAAAATATTGAAAAGATTTTGGATACATTTTTCACTGAAATGGCGGA
AAAGATTCTCAGAATGTCTATATTATCGAAGAATAATGCCGAAAAGATTC
GTTGTCTGACAAATAGCTTCCTGAAATTAAATCCCTACCAGAATGTCGAT
AAAGCAATTGTTAGCAATTTCAAGGAAGCCTATCCGACTGCACGGATGCT
CGTTAATTCTCTGAGGGCTGCTCATGACGTGTTTCTCGATTTGTCTCAAA
AGCTGATGCCATCGATTGAATGCACAACAAAGTACGCTAAAGCATTTTAT
TGCTCCTGGTGTTCTTTAACCGAAACGATGCCCTGTGATGGCTTGTGTAA
ATCAATTATTGGGAAATGTTTTGGATCTTTCAACAGAAAGGAAATGAACA
AAATAAACAAAGCATGGAAAGCCCTTTTGGGAGCACTTGAAAAGATTTCT
AACAAAGCAAAACATCCGTTTAATTTTGTTGAAGTCAATAATAATCTCCA
CTTGAAAATTTCCGAAGCCGTCATGAACGTCCACAATTTCTATACCAGTA
TTCGAGATAAGCTCCAGGCTAATTGTGAAAATAAGTTGATTCGAAAACGG
CGGAATTCGGAAGAAGAGAGTGAAAGTCAATATTTTGAAAACGTGCCGAA
AACCTTAGAAATTTCCCAACCGAAACCGATTCTTTTGAATGATTTGGTTA
ATAAACTGTTAACGAAGATGAAGGACATGACTCTACACCTGCAAAATTAC
AAGAACGCAATTTGTTCAAGCACATTCAAATTACCGAAACAAGGAAATCA
GTGCTGGAACGGAGCTGAAATCACAACTGGATATAAACCAAATGTTAAAG
AAAAAGACGCAAACAAGAATTTAAAGATCAGTCCATTAGTGAAAACGTCA
ATAGCGACATTACAAAAAATCACCGCAGCCCTTAATAATATACTATCAAA
ACAGGTGGTCGATCCAGATGCGTTTAAAATAAAGTTCGTAGAGAAACCAA
AAATAACGGAAATCCCAAGATTGAGACCGTCGCGAATTTCAGAGCAAATG
GAAGGTAGTGGGAAAGGTGGTGTAGATATTGAAAATACAAGTAATAAAAG
TAAACCGAAATTACCAACTATAGAACCGATCAACGAACCAAAGGAAATAA
TTGAAGGCAGCGGAGAAATAAAAACGCCTAGCAACGAAATTTCTAAAAAC
CGACCAGCATTTCCACAACTTCCGCCAAATAATATCAACACTCCTAAGCC
CGGAAAGATAACCAAATCGCCTCCAATTCCCGATGATGAAGATCTCCCCA
CTGATCAGAATGAAAATAAAAATGAAAAAACACCAAAACCATCCGAACCC
AGGACACCTCAAATTGAGGGAAGTGGTTCGTTGGATACGGTCGAAAAATC
AACAGAAACGTCCAAAATATTTACAACTAAAACATCTACTACTGTTGTCC
CGTTTGTGATGACTGATCTAGTGAAATCTCCTAAAAGCGGCCGTCCTGAT
GACGAGTCAAGCCTTGTCGAAGGCAGCGGGCAGGAGGAAGTCACCCCACG
GAAGCCCCATGAATTCAATTCTAGAGTGGAACATGAAACTACAACCTCAG
CTCCAGTTGACCTGACCACTCCATCGGTATTATTGCCAAATGATTTACCC
GGAGAAATCCCCCCTGAGATATGGATTCCAAGAGTAATAGATTACGATTC
CCGCGGACCGATCCTTAATAATCCCAATTCGACATGCTCGATTACAAAAT
TTCATCCTGCTATGTTTTTCAGTTTGTTTGTAATTTACATTTTGCTGTAA
TTTGCATCGCTAGTAACGCGAGCGCATTTGATTTTGATCTCTAGTCAGCG
AATTTATGATCAAAACTTGATTGAGGACGACATCTAGATATAGTTTGTCA
TTTATTCTTTGTATATATCTCTTTCTCTTTCTCTTTCTCTCTGTAAAACT
TTGCTGCAAATGTTTCAGCTAGCTCTCTATAATAATATTATTGATATCGA
TCTGTCTTGTTGTTGTTGTTGTTGTTGTTG
back to top

protein sequence of SMED30034893-orf-1

>SMED30034893-orf-1 ID=SMED30034893-orf-1|Name=SMED30034893-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=752bp
MNLSIDCLLIITVLFALFENQNAQNDVDCQAIKTRWYSHKYQYSDDLLKF
TTSKTVDVICPKTTCCDNAMKTEILGVSQMKLKSIAEIHLKSIIELLYNN
SRDLNDFYQNNLDISKDQMNKMFLSTYASSYKDNQRFLFDFYDKLKLYMD
GKEQNIEKILDTFFTEMAEKILRMSILSKNNAEKIRCLTNSFLKLNPYQN
VDKAIVSNFKEAYPTARMLVNSLRAAHDVFLDLSQKLMPSIECTTKYAKA
FYCSWCSLTETMPCDGLCKSIIGKCFGSFNRKEMNKINKAWKALLGALEK
ISNKAKHPFNFVEVNNNLHLKISEAVMNVHNFYTSIRDKLQANCENKLIR
KRRNSEEESESQYFENVPKTLEISQPKPILLNDLVNKLLTKMKDMTLHLQ
NYKNAICSSTFKLPKQGNQCWNGAEITTGYKPNVKEKDANKNLKISPLVK
TSIATLQKITAALNNILSKQVVDPDAFKIKFVEKPKITEIPRLRPSRISE
QMEGSGKGGVDIENTSNKSKPKLPTIEPINEPKEIIEGSGEIKTPSNEIS
KNRPAFPQLPPNNINTPKPGKITKSPPIPDDEDLPTDQNENKNEKTPKPS
EPRTPQIEGSGSLDTVEKSTETSKIFTTKTSTTVVPFVMTDLVKSPKSGR
PDDESSLVEGSGQEEVTPRKPHEFNSRVEHETTTSAPVDLTTPSVLLPND
LPGEIPPEIWIPRVIDYDSRGPILNNPNSTCSITKFHPAMFFSLFVIYIL
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0009966regulation of signal transduction
Vocabulary: cellular component
TermDefinition
GO:0046658anchored component of plasma membrane
GO:0016020membrane
GO:0005578proteinaceous extracellular matrix
Vocabulary: INTERPRO
TermDefinition
IPR001863Glypican
Vocabulary: molecular function
TermDefinition
GO:0043395heparan sulfate proteoglycan binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001863GlypicanPFAMPF01153Glypicancoord: 20..542
e-value: 5.7E-59
score: 200.4
IPR001863GlypicanPANTHERPTHR10822GLYPICANcoord: 8..639
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 524..538
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 543..570
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 665..679
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 644..686
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 494..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 575..601
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 608..622
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.754