Dynein heavy chain 5, axonemal

Overview
NameDynein heavy chain 5, axonemal
Smed IDSMED30034888
Length (bp)14168
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034888

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034888SMESG000049144.1 SmedASXL_018345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034888SMESG000049144.1 dd_Smed_v6_4569_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30034888SMESG000049144.1 dd_Smed_v6_4569_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30034888 Contig10559newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034888 Contig10559uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30034888SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30034888 gnl|ti|1314596667_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 5443.63 bits (14120), Expect = 0.000e+0
Identity = 2707/4664 (58.04%), Postives = 3486/4664 (74.74%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXX---XVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKE---RKTAKQLAAEALQSNE-KDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI------EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++K E+ AKR+ LD RH YL   VA   DL  TEVE++IL+GNQIE +D+ F+      L F++Q+ E E ETG    +G   +   ++ KPKVF+T+G +  L G CV F+R+     I  + I ++V+F +++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV VLS A+ES+ E+V L+ C  ++LK ++ P D + + NN E L K+E C+ +W+KQ EQVLAE++Q+ +EAD++GPRAEL++WKKR++KFNYLL+QLK P+VKA + +L AAKSK LKTW EMD RITDA NEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSEK+TSLFVK+TNQ+I++CKAYI+N+ T ++W    + + +++L   +L + YQ CF +TK +L   P+ +QF+ SEMYIFGKF+TF RRL+ II IF  +KTYSVL D++IEGLE M  K+  IV+TIKKK YNFLDQR+ +F QD+++F +Q  +LHN +  FMD  F  I +T +A++ L++FERLNIP+LGI++KY  IL +YG D++ + K Y++ K DPP+AR+ P IAGKI WARQLF RIQ PM++F+ QH  +L T EAK II++YN++A+ L+ FE+++H+AW+RQI   H GL +SL+++ P T EL+VNFDP ILIL RET+ M ++ LE+ P A +L  K++  K  F N  M++  Y Q+V + IP   EQL+V  +AK+   ++PGL    WTS+ ++ Y+++ +  + +LELLLDR  DL ++RID +LEEMS+  LC+LP + P+T +EF+  T++LC+  A++L  KS  VE++VNEL+NML   E   E +         V    E     ++       + ++  A+  +     + K+    + E A ELL HFNH+N++A++KV RNTLE++RKRI +   + +  S     +K ++ P FR +  L IPNIVM P +E+VQ T+N+    IISV KG+ QWS E   +K  ++    ALQSNE  D D E+G        N  Q  +  A                                 S NL    Q KN YKNV+ENKE+ K+ S+LST INST+KEV T+M  F  Y+H+W K K+  ++ F+   P +SEF+  I  +  LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IF   E+  K+L+R IKDLDDIRIAM ALKEIRE +I ID  + PIEESYA+L RY L + ++E ++VDTL Y W+KL++R  +VQ+ L+++QP F+  LI  V++F +DC +FY DYD +GPM  GL P+EASDRLI+ QN++DN+ R++ITY+GGEELFGL  T Y +L +IKK+LNLLQK+Y+LYN VI +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD TSEII+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG+GHYC +R F   V + V+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSR+WQG++NT S+VI     LL+LW HEC RV++DR    SD+ WF++ +      EF  +   +V+        TYFVDFLRDAPE   E ++++    PKIYEP+ SF  LKERL+MF + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA YV FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK FP+   T ENL+ YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C+ YF ++RRS  +T KSYLS+I  YK +Y      V  L  RM  GL+KLKEA E++  LSKELE KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKD+  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TI+P+DI+TVR L +PPHLI RIMDCVL+LFQ+K+     D E+     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L +K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P  K +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+ + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLE+NFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+D+TWLNLV LSKL  FS +++QI  +EK W+ WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL +D+++EL  +I E+  V+  +RLWMT+E H QFPI  LQ++IKF N+PP+G+RA L+R+++ ++QD LD      WK M Y++AFLH TVQERRKFG LGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  +RYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKD+  G  ETRE++V +   +ML+K+P +++PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLAIDG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF ELI+RN+QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT++  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI I+A     +     D + Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVE-EAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQ-QHPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEY-QRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGE-------NELQDTLEIA---------------------------------SVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDC----GIDTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRDPRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4996.02 bits (12958), Expect = 0.000e+0
Identity = 2512/4657 (53.94%), Postives = 3314/4657 (71.16%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEK-ETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++E L E+Q + +E R ++R ++D  ++Y+   +A+   L+   VEE ILD   +E    FF+ D   TL F +QE ++   E G  I     G K       K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  122 LQETLKERQARFREARESRRLKIDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIAGATKGAKMM-----KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4707          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4956.73 bits (12856), Expect = 0.000e+0
Identity = 2481/4554 (54.48%), Postives = 3263/4554 (71.65%), Query Frame = 3
Query:  456 KVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4335.79 bits (11244), Expect = 0.000e+0
Identity = 2215/4131 (53.62%), Postives = 2921/4131 (70.71%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEK-ETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQE---GTWVLLQNCHLC 12515
            ++E L E+Q + +E R ++R ++D  ++Y+   +A+   L+   VEE ILD   +E    FF+ D   TL F +QE ++   E G  I     G K       K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+      +LLQ  H C
Sbjct:  122 LQETLKERQARFREARESRRLKIDPSYKYIFEILAENLGLDIVTVEELILDCPSLEAFTNFFAKDGCKTLKFLYQEGDVPGIECGRTIAGATKGAKMM-----KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQVCDKRLLLLQ--HYC 4188          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1972.21 bits (5108), Expect = 0.000e+0
Identity = 1183/3572 (33.12%), Postives = 1941/3572 (54.34%), Query Frame = 3
Query: 3525 VAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTD---CGEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISR--IHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSEN-GEWVHWNSKV-EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIE------FCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLK-TIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTP----LIEH--HAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMV-ITKWYFQEPMFQPDFFINPIQKIVVF--NTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK-DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVC-SKSAEHWIMRGVAMLCDI 14099
            V +++++ K+Q+ +S+ + +    ++  +  +  Y  +W   KD+ +  + + +P VS F   I  Y  + + +  E    +   + L    LK  L+     W+  +           + ++ T+ ++  +++SR  + L+++ +++  +  ++ +   ++  I PI E +A+L +YE+PV+    E +D+L   W          +  L   + +F++ LI +   FKK      ED++  G     +    A D++   +     +     +      +F +       L++++KEL+ LQ+++ +  D   + N +    +  +  E +         R  KL K  KD  W   E  R  I+ F   +PL+  + NPA++ RHW ++ D     FD ES+ F L  I+E  + +  E+I +I  SA KE  IE  L+ +   W   +L    +K++G   LRG  T E+   +ED+ + LS++ ++R+   F+KD+      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F  ++ +W  IM R +++ N L+       L  L+       +I QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK ++  +      ++E +   +S +GE ++    V  E  VE WL  +    + +L  ++R  + ++        +++  +  QV +   Q+ WT D T+ L+ AK  +D+KI++   +  + +LN   +    +L K+ R K   L+TI +H +D+ ++L K  +   + FDWL Q RFY+ +D+D C++  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV A QI  +LS        F F DG  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF +  +LA+K YTLY L  +QL++Q HYDFGLR + S+LR  G+++R  P  T++  ++  +RDMN++KL   D PLF +++ DLFP I+L    Y +L   + ++I +  + S P  + K+ QL+ET+  RH  M +G +G+GKT    +L  +L+     G+P+    RE  +NPKA++  +++G  D+STN+WTDGI S++ R     +K +  W++ DGPVD +WIEN+NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   + L W P ++ WL KR   E   +  +F      +  +        +   E   +   C L   L   ++  + +         E  ++FS++WS+ A ++ E R ++++Y+R    I+   P     ++DT+++Y V      W  +  K+ + + YP ++ P Y  I+VP VD VR ++L++++ + +  +LL+G  GT KT +    L S          +N S+ T     Q  IES V+KR    Y P  G+ M  F+DD+NMP  + +G Q   E++R  I+  GF+          + ++  +AAM  PGGGR  I  RL+  F I N T PT + I RI+   G     K + F   V  + + +   T  ++ +   +  PTP+K HY+FNLRD+S+++QG++    D   +   + RLW+HEC RV SDRL+D +D + F   I       F L    +   + PP     F DFL++                PK+YE +    +LK  +      YN +    P+ LV F +A+ H+ +I RVI   +GN+LLVG+GGSG+QS+ RLAS I DY  FQI +T+ Y    F +D+K +YR AG E K T F+F D +I DES+LE INN+L+SG +  L+  +E +EI S +  D  +   + P++ ++L+ Y ++RV++NLH+VLC SP+G+ FR     +PAL +  TINWF +WP+EAL+ VA+  L    L  ++ +  K+  +   +H  V     K   + RR   +T   YL  +  YK +    +  +     +++ GL K+ E +E + ++S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K A    K +     A++ L  A PAL+EA  AL ++   DI  ++   +PP  ++ +M  V+IL              +G + +W E+ + L   NF+ SL+ F +D I+++++  +  Y  + D+  +   +       LC W +AME +  + R V P +  + +    L + Q  L  A++ L E  E L ++K +YD  + +K+ L   +     K+  A  L++GL  EKARW       E  +G LVGD ++ +AF+SY GPF   +R ++ +  W   I    VP + +  I   L NP ++ +WN+QGLP+D  S EN IIVT+ +R++L IDPQ+Q   WI N E    +   +     + + LE A+  G+P++++++ E LDP LN +L K+  +IG  L +++GDKEV+ +  F  YITTKLSNPH+SPE  AKT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   +  KRK+KELED +L  L    GSL++D  L+  L+ +K T+ +V+ Q+  +  TE   + ARE YR  ++R S+L+F++ D+  ++PMYQ  L  +++LF+ SI +S +S  ++ RI ++    T  ++ +  R+L++  +  F+  +  K+   +  +  +E N  L+GG  LD +  +D     W+ D  W N+  L KL  F GL+       + W  W+   APE   +P  +E   +E +++L++R    DR       +I   LG  FIE     + S+  ++  ++PL+ +LS G DPT     L EH   A++ H     +S+GQGQ   + R++ + + +G WV L NCHL + ++  L ++++  +  + +  +RLW++S  H  FPI+ LQ++IK T EPP+G++AN+ R +  +++  +        +K + +SL F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+I+ I YGG VTDD+D RLL   I  ++  + +  P   ++ ++   +    ++  Y+ YIS LP  D P +FG H NAD++      + + +T+LS+QP+    +  G+TRE  V +   ++  KIP   I ++  +K+  +    P+N+ L QEI R + ++  +  +LTDL+  I G++VM+  L +  +CIFDA +P +W K       L  W  +L  R  QF  W +  R PV FW++GF  P GFLTA+ Q   R ++  + DS+     V+      L  PPK+GV++ GL+LEGA WD++N  L+EA+P  L   +P I+        + +++    MY  P Y  P R       +++   +L   + + +HWI RG A+L  +
Sbjct:  928 VEQDEDIKKIQTQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIHRYQRLNPPVSSFVADIARYTEVANNVQKEETVTNIQFVLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEFKGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDI-QKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAV-GMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHF-DGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLR---EIEGSFP-----NKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNA-PFY-KIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIF---GTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPP----IFGDFLKE----------------PKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHI-IDQARV-EQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL--------------RGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFH----ALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLD--------EYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIP-EMIDYEGTQKLLALDP-SPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNV-SVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF----RPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSL 4425          

HSP 2 Score: 94.7449 bits (234), Expect = 6.081e-18
Identity = 77/287 (26.83%), Postives = 132/287 (45.99%), Query Frame = 3
Query:  474 GKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPH-FRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMN-----IVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITN 1316
            G     + Q V F+R +      EN  A  V F  + G    +  L   +  V  P  F N   GW      E  R    + L  F+  L++ R  +     L +           P + MN     ++ + E + ++E  +  W +QI+++L+  + +    +N+GP  E+++W+ R    + +  QL    VK    IL  AKS  L  ++++ ++I D + +A+ N+ FL  L+E    L    P  +   +PKLIS +R+I   S +YNT E++TSLF K+ +
Sbjct:  129 GMPVQTQNQLVYFIRQAPVPITWENFEAT-VQFGTVRGP--YIPALLRLLGGVFAPQIFAN--TGW-----PESIRNHFASHLHKFLACLTDTRYKLEGHTVLYI-----------PAEAMNMKPEMVIKDKELVQRLETSMIHWTRQIKEMLSAQETVE-TGENLGPLEEIEFWRNRCMDLSGISKQLVKKGVKHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSKLPKLISLIRIIWVNSPHYNTRERLTSLFRKVCD 393          

HSP 3 Score: 62.7734 bits (151), Expect = 2.474e-8
Identity = 64/290 (22.07%), Postives = 118/290 (40.69%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK--ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE--LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWT 2498
            F+  + T++      LD + T + +D++ F   I++L     N +   F+ +      +  L  F RL   +  I+  Y K  +  +   + E  + +  RNK+ P +   +   +GK  W   L RRI   M      H  L +    K  +  Y ++ + +        Q W   ++        + ++R  + K   L VNFD  +LIL  E D   +L  E P   +N+  +   L+     L+L+     ++   +  + + L   R+  L + I PGL   +W 
Sbjct:  431 FHKNLHTLRAVRGGILDVKNTCWHEDYNKFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASRE-AIKRTYDKKAVDLYMLFNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAH-FLPRIGTGKESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKSLLILFAEIDYWERLLFETPHYVVNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRLLDKKIHPGLKKLHWA 718          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 914/3424 (26.69%), Postives = 1643/3424 (47.98%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQ--RRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEV-HSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQ----PMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13772
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +    +   +  A + G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +     E +      +    P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct: 1168 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 4478          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1197.57 bits (3097), Expect = 0.000e+0
Identity = 914/3424 (26.69%), Postives = 1643/3424 (47.98%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQ--RRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEV-HSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQ----PMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13772
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +    +   +  A + G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +     E +      +    P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct: 1168 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 4478          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 914/3424 (26.69%), Postives = 1643/3424 (47.98%), Query Frame = 3
Query: 4053 RYELPVQKDETERVDTLRYTWQKLMS-RGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYA-----KLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKF------HYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYE--------PVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKK---FFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDF------------------VKEKIVDLLAVIHQDVFSNCLKYFNQY-----RRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFI--QRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNS-------------------VRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPED------EDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFI-EDVPFKIGSL-SREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEV-HSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSH-KTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPI----QKIVVFNTV--DEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQ----PMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISW-ESTTLGFWFIELIDRNNQFLK--WLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTR 13772
            RY+ P Q   +E V+     + +++S R + +Q  ++ +Q +F     E+  + K+  +   E ++ S P+     P+EA + +   + + + L               L+ + +A     KL    +EL  ++ ++     V   ++   +  W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+   D   ++ + +++    LS++  + Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQ +E+ GFY       ++S+  + FV A   P   GR+ +  R  RH  I     P   S+ +IY             F  +++ M   + GL  +L  +  +    +   F      HYV++ R+L+R  +G+    + + S S+++L+RLW HE  R+  DRL+ E + +W ++ +             D   ER YF +  R           D A   P +Y         PV   EL   +  RL  F   Y E +    + LV F   + HV++I R+ R  +G++LL+G  G+GK +++R  +++     FQ+ +   Y   +F ED++++ R AG  N+   F+  ++ + D  +LE +N +LA+G + GLF  +E   +++ +    ++       H    + LY++F  +V  NLH+V   +P G   R+RA   PAL + C +NWF  W + AL  V         L   D+                   ++ +V+ L ++H+ V     + FN+       R +  T + +L +I  + +++   ++ +      +  GL K+ E +E +  L K L++K   L      A   L  +      AE  K     ++ + A  ++++   +   E  L   +PA+ EA+ A+  IK + +  V+ +  PP  ++  ++ + IL  +             V T W    +++   +F+  +L F  +L+  EI+  ++ Y    D+  +   ++      +  W +A   +  +  +V PL++ L       AK   + +  +  +TE EE +   K EY   I + + ++ D    ++K++ + +L++ L+ E+ RW+  S  F  Q+  LVGD ++ SAF++Y G ++Q  R ++F  W + + N G+     +  +E LS  +   +W L  LP D L  ENAI++ + +RY L IDP  Q   +I+ +    +I  T+F ++ F+++LE AL  G+ L+++D+ E  DP LN VL +   + G  + + +GD+++D+   F +++ T+ S   FSP+I ++ + ++F+VT   L  Q L  V+  E+ +++  RN LLK       +++ LE +LL  L  ++G +++D +++  L K K  + +V+ + A+      E++    +Y+ +S   S +Y  +  L+ ++ +Y   L   + +F + +   E S      +R++ I + +   ++  + R +   D+    LLL +++ + +N                     + +E +  + GG  LD  T++ K           ++    K+  F  +   +  +     +W   D PE       +D       +      L+++    PDR +  A R +     DHF+ +D    I S+   E     P+L   + G D +  IE  A + + Q+ +I++G  +    +   +  A + G WVLL+N HL   ++ +L + +  S   +A +RL++T+E H + P + L+ +     EP  G++ANL RS + +    L        + ++  + +LH  VQER ++ PLGW+  YEF+ AD       +   +D +   + + +   + W  +R ++S+  YGG++ + FD  LL  + +  F    F+ D  + P       +   N    D+   ++  L     P   GL NNA+    TK  + +L  +L +   D      E  +  V  Q    L ++    +     E +      +    P+  F  +E++   +++ ++R  L ++          N+  R     +   ++P  W++ +     T+  W  +L +R  Q ++    ++ +   FW+ G F+P+ ++TA RQ+V ++ + W+ + + L   + R
Sbjct:  236 RYQFPAQWLYSENVEGEWSAFTEILSLRDASIQTQMMNLQTKFAQ---EDELVEKRTVETLTE-WNKSKPVEGAQRPQEALNVITAFEAKLNKLTEERNKMRKARVALDLSDSAHAPSEGDKLTVATEELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLIKGWD---DLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGT-----------FNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLV-------------DTTAER-YFGNACRL----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGF---YEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSH----DELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTV-----QKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGE------------NVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLH-SMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQA-NTWSLEQLNLHIHIGR 3546          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 846/3202 (26.42%), Postives = 1496/3202 (46.72%), Query Frame = 3
Query: 4602 LRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTS--HHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAH-ELHFGTFK-NRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVR-TDFLMNTVASQEKAVLLI-GEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKR--MGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPG-GGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSF-ELLKERLSMFNKSYNETVRGSPIN--LVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVA--EEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLE--AARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT--VDEYRNYIS-NLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESI-----VYKQCTEMLDKIPSNHIP--FKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLND--------GRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDK--RNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAML 14090
            L K ++ F  +   L+      +   HW  M           +E   FA    +   +++  ++++ +   A  E  I   ++ +   W+A  E     +K + G+ L       E I+ ++DS  +L SL S+ Y   F        ++L++    + Q   +Q  W+YLE +F  G     LP EA RFS +D  +  I++   ++  ++  C   ++L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++P  IQ+H+  +F  I  V+F     ETI++  S EGE + L K V+    VE WL  L +  +R+L  +   A   + D + +    L  YP+QV  L  ++ ++  S E  +N  SD       + +  LL  L          KV   K ++LI   +H  D+ DQL+ ++ KS + + W +Q RFY V      ++     +F Y  E+ G   +LV TPLTD+CY+TL QA+ M +GG P GPAGTGKTE+VK +   +G+ V+VFNC + +D   +GRIF G+ + G+WGCFDEFNR+D  VLS  + QI  +    K R     F  G  V +NP   IF+T+NP   GY GRQ++P+NLK  FR V M  PD ++I    L S GF+D   LARK  ++++L  + L+KQ HYD+GLR +  VL   G  +R      E   V++ L    LSKL   D   F SLI+D+F  +  +   + EL   +     E  I      + K+ QL+E  R R G++ +G +G+GK+    +L ++L    +P +  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W+V DG +D  W+E LNSVLDDN+ LT+ +G+RI    +   +FE  ++  ASPATVSR GM+Y+S   +    ++  WL+K   +    M       F   +R       +K+  + +F +     L  GL   K  K  +Q           F V+   G L  +    + E + +      + +P  +    D   D ++S   + V  N   EE +  +D  P      V   D  R +D + + + S  +   LI G  G  K  ++ K+    +PE  +      + ++   + Q   ++ V      G  + P     M +F+  IN+P  +++G      +++Q +  +GF+  D   +++S+ ++ FV +M   G G    I  RL    R  +      + +  IY    L    +E   R+S I + ++++ +  K+    ++  +PT S   ++F+ RDL+     L+  + D      KL  +   E  R+ +DRL  E+D   FE  +   +  S+        NE   F + +     TV  G  ++   +  I   +  F +LL + ++ F  ++       P+   L FF         I RV+    G++ L G  G G++   RL + + +   F   +T  ++   F  +LK+    A   N+  V +  D++++   +L+ IN++LASG + GLF+++E+D +++ V                 L Q+   R+R  +H+VL        F+      PA+   C + +  ++ + +LV + + ++    +   D +     D+L  + + +    +KY                 +++ +  +    + ++S+  ER++ G+ KL EA++ +  + K+   K + L+   AEA+  L  +T+  + AE    K+   + K A   E +R+++Q A  +E+L   +P + EA  A+ +IK   +S +R L+ PP  ++ I+  VL LF   +D            TSW    K L+ +   + ++ F  + I  EI   +     ++    E   A+++    A L AW KA  ++  +  ++ PL+         L KA+  +++  K L   +EV+  +K +++  +K    ++ D    +  +  A  L+  L  E  RW +Q   F  +   +    ++ SAF++Y G  +++ R  +    +S+ +   +P   T   +   S   +   W  +GLP D+LS+EN  I+  +    L ID   Q   + L+K  E    T           +E A+  G  +II+DI E  D AL  +L K+    G    +  G K +D +  F +Y  T+       P  Y + ++++F+ T+  L  QLL + I++EK ELE   + LL+     K +++ LE  LL++LA+++G+L+E+  LL  LNK+K+++  ++  I ++    +E+   ++ Y  +S   S L+F  ++L   NPMY   +   ++LF  +I   E       R++ +   M + ++  I R +++ DR  F +        +    ++ EL   +    + DL  +    ++WI     L  +A  + H+ S      +  +  W   F K    +   P   E  +  F+K+L I+   P+R       ++ +TL    I    F++  + +E+++  P+L +L+ GADP+  +   A   ++   +ISMGQGQE+ +   I ++  +G W+ L N HL +  +  +F+ +  +T  +  +RLW+T+E   +FP   LQ ++K T EPP G+R NL R++  + +   +   VI  + +F  LA+LH  +QERR F P GW   YEF  +D      F++     +T  K+      DW+ VR ++  + YGGR+ +DFD ++L       F +           ++ I +  T  V EY  +IS ++P+ D P  FGL  N   S+      R + +I ++   D+     +  + I     ++K+  +  D +P   +P   + A+ I+++   + +N      I ++ + I +V  ++    LA   V       +  +  +   + P  W+ + W   +    ++ ++ +  +    L +          P+ F  +  F P  FL A+RQ  +R       D +IL +  T       + P K+ V + GL L+GA++D   R   +  A     Y   P+  +F              ++ + P+Y    R++L  I +  + C + A+ W +  VA+ 
Sbjct: 1144 LMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTL-WAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRG----ALPSEASRFSRVDSEYRAILNDVSKDARLVSLC-SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTG-ETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQA---VADAQPS----LAKYPSQVLCLAEEVKFSA-SIENNLNGSSD-----LNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNG--GIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF-GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSVHH-WIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHF---WRCLKWVRSHKISGITSFAI-----LKNGLTHLKASKTKTQ-----------FLVLLFNGFLPTVTPENRQE-FAKGVVFQGMSVPDPKNICYDERIDGIMSYTDD-VSQNVTKEE-VEREDLRP-----FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLL-KHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFF--DHNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTY-LTPILEEVGERNSEI-IANRMVDIYNKV----QSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELD----QGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQA-------NETVIFKEKVYVTTGTVVPGESNTGLPLTPIN--MSDFNQLLAKSINRF--AFEIANFNCPLTSQLAFFCAC------IDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEA-----ANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTDAILTGFNDVLVNLPEHLSIQPIKY---------------RQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAE--DQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVL-LFMGILD------------TSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLL---KSMCKMFNMP--PTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLF-LSKFLEKS-ETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKS--STRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALR---VQWI-SPDRLQSLARIRTHLPSLFNNFQIQDDATWNE-FSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLTTP-HENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKN---VITCQSIFV-LAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQ----LTANKA------DWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQS-DDLPKRELPTAIRSADPISEVLCLETINAL--SLIKQLHRSIGHVAKSMKTPSLASPAV-------QKTIQSLVFQQTPDEWDSM-WAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSR-QIKIPLDQLILSSAWT-----PSQLPAKQCVQVQGLLLQGATFDSFLRETTVSSAA----YSQAPI--VFLAWTSESSSTITGEQIQV-PVYSSSERSDL--ICSVNMPC-RGADQWNIAAVALF 4169          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 108.997 bits (271), Expect = 9.921e-23
Identity = 77/303 (25.41%), Postives = 156/303 (51.49%), Query Frame = 3
Query: 9804 RMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLL-QPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARW 10709
            + + G++K+K A+E +  +  EL   +  L   S E   +++ + K+T   E  +  V   ++K      K +  +  +E +L +A PAL+ A +AL T+  +D+S+++ ++ PP+ ++  M+ V IL   K    I +   + V   WV   KLL+  +FL  + +F RD ++++ + L+ + Y ++E++  E  ++      GLC W  A++ +  +++ V P ++ L    +++ +    L+   K L +  E L  +  ++    ++KQ LES  + C  +M  A +L+  L  EK +W
Sbjct: 2124 KYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVK-PAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKW 2425          

HSP 2 Score: 98.2117 bits (243), Expect = 1.718e-19
Identity = 116/486 (23.87%), Postives = 215/486 (44.24%), Query Frame = 3
Query: 4611 TIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVK---AESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVG--LLGIQLLWTRDST---EALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKF-ETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLG 6041
             + +F  ++P+L  ++  AMK RHW+ +   +     VE +   +  +LE   ++  ++ E +   A KE+ +E  ++ +K++W      F T +  GELL     T+E+   M+  L    ++LS+ +       I+  +  L N +  +  +      W  +E VF   DIA Q+P E + F  I   W+ I ++  E   +L+     + L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +P   +S++  +F ++ T  F +     I++  S + E + L KPV    ++ +VE W+  L +  + +L   IR     +N     V   LN  P QV    L I   W  +++    +L    S+ KI  +  +  +L              K +R +F   L  I+     + ++L+ ++V    D+ W  Q R+Y+   ++   + +  V   Y  E  G
Sbjct:  684 VLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPL-VSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTAT--FVTHQG-GELL-----TTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTT--FDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILN-EPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAVL-------------HKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQG 1141          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 4070.77 bits (10556), Expect = 0.000e+0
Identity = 2054/3741 (54.91%), Postives = 2697/3741 (72.09%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISR----------------------IHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +    + A            +   +         +Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct:  994 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPL----------NSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWK--NDRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4692          

HSP 2 Score: 402.905 bits (1034), Expect = 1.971e-111
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   14 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 900          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 4068.46 bits (10550), Expect = 0.000e+0
Identity = 2053/3741 (54.88%), Postives = 2692/3741 (71.96%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +                                  Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct: 1023 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPP-------------------------------QVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4700          

HSP 2 Score: 402.905 bits (1034), Expect = 2.007e-111
Identity = 271/905 (29.94%), Postives = 457/905 (50.50%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y   +   + +    P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   43 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIYHETYYTVREQ-PFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 929          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 4063.84 bits (10538), Expect = 0.000e+0
Identity = 2055/3765 (54.58%), Postives = 2696/3765 (71.61%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +    + A            +   +         +Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct:  994 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPVRTAPL----------NSFAMFSKILSYQPQQVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4716          

HSP 2 Score: 402.905 bits (1034), Expect = 1.946e-111
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   14 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 900          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 4062.3 bits (10534), Expect = 0.000e+0
Identity = 2054/3765 (54.56%), Postives = 2691/3765 (71.47%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGP-IALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDP---PNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A  E+  +++ + ++ ++KVIR  L++LR+R  A      D +     KP F  +A LQIP++V+ PN++E+Q  +      I  ++KG++QWS  +                                  Q +++    +    ++S  G K  +R I      A E+         + +K+ Y  + +NKEVAK  + L++C  + + E++T + R+  Y  LW    D T  + +  +  + EF+  ++    L+  +  E      G  +A++ E LK GL  E K+     G+A   KYK EM+ ++    +++++L R I+DLDD+R+ M  L +IRE E+ +++ I PIEE++ +L RYE+ V++++ + VD LR T+Q L++   Q Q  L+ +QP F+ +L  N+  FK+D   +  +Y  +GPM  GL PREASDRLI+ QNR++ + RR  TY  GEELFGL  TDY +L  I+KELNLLQKLY LYNDVI+ V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD T+E I  +EDSLM+L SLLSNRYN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ+++MKGFYSL+KPGDF +++D+ +VAAM  PGGGRNDIP RLKR F +FNC +P   SID+I+ VIG GHY  +R F   + ++V KLI +TR LWQ T+ K+ PTP+KFHYVF+LRDLSRIWQG++ T S VI+S   L+ LW HEC+RV +DR     D +WF   +  CL   E+ +       PN    FVDF+RDAPE   E  +D+   +PK+YEPV S E+L+ERL MF   +NE VRGS ++LVFF DAMLH+VKISR+IR  +G+++LVGVGGSGKQS+T+LASFIA Y  FQI +TR YN+ NFLEDLK +YR  G + KGT F+FTD +IK+E +LEY+NN+L+SG+I+ LFS++E  EI+  +   MK+   +   T E++  +FL R   NLH+  CFSP+GE FR R   FPAL SGCTI+W   WPK+ALV+VA+H L  F + C   VKE++V+ L  I   V     +YF ++RR+  +T KSYL++I  YK +YQ  +  +    E+M  GL+KLKEA  ++ +L K+L + E  L  AS  AE+VL  VT++   AE VKN+V  VKDK  A+V  I  ++ +AEEKL AAKPAL+EAE+ALNTIKP  I+TVRKL +PPHLI RIMDCVLILF++K+ P IPD      K SW ESLK++AS  FL  L  +P+D IN+E+IDLLQPYF  EDY+++ AR+ CG+VAGL +WTKAM  F+ VN+EV+PLK +L  Q   L  A DDL  AE+ L E+EE L  VK +YD A+  KQ L   A +C +KM+ A  L+NGL DEK RWT QS EF+ Q+G LVGD+++ + F+SYCGP+NQ+FR  +   W  +++   +P    ++I+  L + + + EW LQGLPND+LSV+NA+I T++S Y L +DPQ+QGK WI  KE  + +  T+  +KYF+ HLED+L+ G PL+IED+  +LDP ++NVLEKNFIK G+  KV VGDKE D+   F LYITTKL NP FSPE+ AKTS+IDF+VTM+GLEDQLLG VI +EK +LE  R  L +    N+R +KELE +LL RL++++GSLV+D+ L+ VL   K T+ +V+ ++  +  TER+I +AREE+R+++KRGS+LYFLI ++S VN MYQ+ LKQFL +F +SI +S KS   + RI  I+  +T  ++ F  RSLY+  +  FTL+LA+K+D  N ++  EE    +KGG++LDL  + PKP +WI+D+TWLNLV +SKL  FS +++ I  +EK WR W++ + PE+E+IPCGY AILD F+KLLLIR WCPDRT+  A++YI  +LG  + E     +  +  E++ +TP + LLS+G+DPT  I   AK+  I + ++SMGQGQE H+R++I ++M  G WVLLQN HL + + +E+  ++ ES +++  +R+W+T+E H++FPI  LQ+A+KFTNEPP+GIRA+L+RS+   TQD+LD      W  + Y++AFLH  VQERRKFGPLGWNIPYEFNQADF A   FIQNHLD +  KK     G+ W+ + YMI E+QYGGRVTDDFD RLL   T  +F EP+    F      K+    ++  + +YI++LP  D P  FGLH+NADI+Y   + K IL+TILS+QPK+   G GETRESIVY+   +ML K+P+ +  ++V E + +MG   PMNIFLRQEIDR+ +VI  V   L DLKLAIDG +VM+  L+++LD ++DA+IP  W KISWESTTLGFW+ EL++RN QF  W++  RP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N++TR+  E++ E P EGVY++GLFLEGAS D+R+G+LIE+K K+LY+ +PVI I+A+         +D K+Y  PIY+KP+RT+L Y+ + +     + +HW +RGVA+LCDIK
Sbjct: 1023 AVVEMRRYYSRKVIDVLIKVIRAALDTLRRRFIA------DENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPP-------------------------------QVSMTVQPRVGRNHNESTGGGKSRRRKIYC---LASEE----RPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPYHFLWKN--DRTTRQLM--EFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKKEMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQNLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQSGEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELA-CLVREELGDSHSQMILPN--PVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKK-----GVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAI----NTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK 4724          

HSP 2 Score: 402.905 bits (1034), Expect = 1.718e-111
Identity = 274/908 (30.18%), Postives = 458/908 (50.44%), Query Frame = 3
Query:  192 ERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQE----------------PELEKETGDQIRIGLTGIKQSRVMKPK---VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS------RRAMMNSLENFVLVLSNARESINERVALKVCTEIDL--------KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQ---PHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTD------ASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLN--IPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQ-INSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPV-TVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ER A+R  +D R ++  + + D   L   ++ + I +G+ ++ +++ F  +  N L + +QE                P          +    G   S +  PK   +F+T G      G C+   R +   Q+ E    KD+   VI+  N G++  +E  +  V +         +  LE DE+       +  ++  L +F   L         RV  +VC   ++        ++I    +  ++  N E   ++E  V  W K I ++L ES+Q+R+E D+ GP+ EL+YWKKR A+F+ LL  L+  EV+  +  L  A S+ +K W E DR+IT   NEA+DN KF+  +E  C  LY ++P  M ++I  L+ +VR+I+S+SQ+YNTSE+ ++L VKITNQMI +CK+YI+    ET+W+ +   +  +L  C +LN  Y     ET   +  Q   P++  F  SE ++FGKFDTFC RLS II +F +I  Y+ L +         E LE     F      +  + Y++LD R ++F  DF+ FI +   L + I   ++  FD +  T + I+ L RFE+++  IP   ++EKY +IL +  ++V+ ++K + + ++DPP+AR+ P IAG+I W R L   I   M+   ++H  L   P AK +   Y+ +   L  +E      W+ Q ++     L   L+    +  +L+VN  P I +L RE  ++ KL +E+P  A  L  +Q       + L  ++        ++  E   L + ++ +L  +++PGL T NWT+    E+ +     +   ++L+ R  D+   RI  VL  M  + L  LP D  + TVDEF+  ++E C KAA  L  KSQ V ++V E+++++
Sbjct:   43 ERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEGDMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCAFTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQAL-----AFPSLEGDEEDVSCGLIKGQLLPGLRSFCSAL---------RVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQDELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVSMKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIY----HETYYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTSRKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEKEVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAV-MEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIVSIWLDQDVSVADACLLQPLL--SLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMFLSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVSLQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLV 929          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 3667.09 bits (9508), Expect = 0.000e+0
Identity = 1839/3568 (51.54%), Postives = 2526/3568 (70.80%), Query Frame = 3
Query: 3435 TIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMM-RFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGL---IPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI--EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINEL-FQVIQ-----ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            T G  ++  +       ++ N   ++ ++ V E+K+V +    L+  + S + ++E      F  Y +LWA+ ++  +  F+  +P   +   +   Y  +  +I   S     GPI +        L+SE+K W++  G   +V+YK +++++  F  +    L + I DLDD+R AM  L+++R+N I +D+++  I ++Y++  ++ + V +++ ++V+ L+  + K++    +V D +  ++      L + +  F ++   F  D+D +GPMV G+  +EASDR+ + QNR+D L R+F  YS GE+LFGL +TDY  L   K+E N L +LYSLY  V+ ++  YY++ W DV+IEKIS EL++FQ RCRKLPKG++ WPAF DL+  IDDFN   PLLELMTN AMK RHW R++ L +  FD  +  F L  +LEAP+LK+KE++EDIC+ A KE DIEAKLK + ++WS   L  G FKNRG+L+L+G  T EIIS +EDSLMI++SL SNRYN PFKKDIQ  +SKL N+ +I+E+W+ VQNLW+YLEAVFVGGDI+KQLP EAKRF+NIDKS++KIM RA E  N + CC GDE+L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASDP +IQ HLLS+FD I TV F EK  + I +  SM  E ++ E  V+   +VE+WL  LL   Q ++  ++   + S+ND EFN  E    +  Q G++G+QLLWT+DS  AL   ++D+ IM++TN +FL+LLN  I  T  DL  ++R +FET++TIHVHQ+DIFD L   ++KS  DF+W KQ RFY+ ED D  IV ITDV+F+YQNE+LG TERL ITPLTDRCYITLAQA+GM MGGAPAGPAGTGKTET KDMGR LGK VVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KE++  F+F DGD+V +NPEFGIF+TMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVK+ASCGF +N+VL+RK YTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG QKR+NP DTE+T VMRVLRDMN+SKL+D+DE LF+SL++D+FPGI+L    Y +L+ AI +  DE   +++P W LK++QL+ET  VRHG+M +GP+G+GKT+C   +++  T+ G  H+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRR+LK  + ++ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRI M+ + K++FE  N+DNASPATVSR GMV+ SSS L W   ++ WLLK+  +   +    +   + D + +    L+ KM  LEA  +RQ  D+++GL   +P + EK          ER+++FS+MWS+GA+LE+ +R KLE ++  + + KL  PK  +   +T+F+Y V +NG W HW+++VEE+ YP+D  PE+ SILVPNVDNVRT FL++ +A Q K VLLIGEQGTAKTVMI  Y+   +PE H+FKS NFSSAT P M+QR IES+V+KR G+TYGPP  R MT+FIDDINMPVINEWGDQI NEIVRQ IE +GFYSL++PGDF +++D+  ++AMIHPGGGRNDIP RLKRH  IFNCTLP+  S+D+I+  IG G++  +R     V+ ++  L+ LTR  WQ+ K KM PTP+ FHYVFNLRDLSRIW+G++  + +   S  ++L+LW HEC+RV+SDR   E D  WF   +  +  L+  E +EF   P E TY+VDFLRDAPE  EE  ++ +F  PKIYE +PSF+ ++ ++ +F   +NE +RG  ++LVFF+DA+ H++ +SR+I   +GN LLVGVGGSGKQS+TRL+SFIA Y  FQ+T+TR YN  N  EDLK +YR AG +  G  F+FT NEIK+ES+LE+INN+L+SG IA LF+K+E+DE+ S +   MKK  P+ P TQ+NLY +F+ R R NLH+ LCFSP+GEKFR R+L FP L SGC I+WFQKWP++A + V++H L D+ +VC + VK++++D+++ IH+ V   CL Y++++RR   +T KS +S+++ YK +Y+  +  + +++ERM +GL KL EA  ++ +L K+L    + +++AS EAE VLA V +   AAE VK +V   K +   +V+ I   + VAE KL  A PAL+EAE AL TIK  DI+TVRKL KPP+LI  IMDCV ILF++K+ P  PD E+  +++SW ESLK+++ T+FL  ++ +P DLIN E++D++ PYF    Y  EAA+ +CGNVAGL +WT AM K++ VN+EV+PLK +LA Q     KA  DLQ AE++L +KE  LA V+   + A+ +K A+  +A  C+ KM  A  L+ GL  EK RWT Q   F+S+   LVGD+++L+AF+SY GPFNQ+FR  + S W   I    +PI+  ++I+E L++ +QIGEWN+QGLP D+LS++N II T+A R+ L IDPQSQGK WI NKE ++ ++ T   +KYF+ HLED+++ G P+IIED+ EELDP L+N+L++N +K+GT  K+K+GDKEVD +  F  YITTKL NP ++PEI+A+TS+IDF+VTM+GLEDQLLG VI  E++ELE+ R QL++  + N +K+KELE +LL++L+ T+GSL++D  ++ VLN +K T+ +V  +I  A  TE +IN AREEYR ++ RGS+LYFL+  ++ VN MYQ+ L QFL  F  S+  S K+   Q+RI+ II+ +T  I+ +  R LY+ D+  F LL+AL +D +   +  +E  V +KGG+AL+L    P P +W  D TWLNLV L+ L  F  ++ ++  +E+ W  W+ KDAPE+E IP GY + LD F+K+LL+R WC DRT+   R+YI  +LGD F E V      L  E+    P++  LSLG+DP+  IE  AKK+ ++   ISMGQGQE+H+R++I   +++G WVLLQNCHL ++Y+ EL  Q+++     +   VN  +R+W+T+E H +FPI  LQ+ +K+TNEPP GIRA L+R++ +L+QD+LD      +  + YS++FLH  VQERRKFGPLGWNIPYEFN +D+ A  +F+QNHLD I      +  GI W  VRYM+ E+QYGGRVTDD+D RLL   T+ +F + +F+  F      K+  F   + Y   I ++   D P  +G H+NA+I+Y T T + IL+ I+SIQPK+S  G GE+RE  V +Q  EML K P     F V + +  MGA   MNIFLRQEIDR+ ++I  VR    DL LA++G ++M++ LRDALD IF+A++P ++++ SW S++LGFWF EL++R+ QF  W    RPV FW++GFFNPQGFLTAMRQEV R+H GWA D V + N V +   EE ++PPKEGV++YGLF++GA WDKR  RL+EA  K+L+  +PVI+I+A+         +++K+Y  P+YKK  RT+L YI    L  +K  +HW +RGVA+LCD+K
Sbjct: 1051 TWGKQAKTQERRDRRVTVDENKYERSYFRYVMEHKDVIRAVQNLANGLLSYKSDMEEFQRDMFEKYKYLWAEDREDIINSFVLTNPLTVDIRDMFLHYDNISLKIETMSAKRIIGPIEVRMGSTIEKLVSESKKWKVLLGHLLSVQYKKQLDEMIEFITEQNNILDKPINDLDDVRQAMVVLEKVRDNYIEMDVSLQLITDTYSLFSQFYIYVPQEDYDKVEGLQVLFNKMLENAKKVSDRISEMEEPLLRELNDGIATFVQEFYDFNLDFDLNGPMVEGISAKEASDRVFLFQNRFDELWRKFEMYSSGEKLFGLPITDYPLLHQRKREFNYLNRLYSLYIQVLKTITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKGGETLEIISSLEDSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDESLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTILAQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRSNPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLLKQGEDSE-VFRRCYDVLYDDAHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLDLPLRTEK--------ALERIFLFSLMWSLGAVLELSEREKLEEFLLKHVS-KLRWPK--RGVNETIFEYYVDDNGNWQHWSTRVEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDR-LGDEVVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKMISDAELNIKEFMEFY--PEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFLESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKVIALASEEAEDVLATVEQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATVRKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDTSFLRKIVEYPTDLINAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQKASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYITTKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNS-LDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKKNELKCHPISMGQGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEPHPKFPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDYSQSPFYLPLVYSISFLHTVVQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDI-----EQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGSWVSSSLGFWFTELLERHTQFYNWCFGARPVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAI----FSTAAKNSKLYTCPVYKKINRTDLNYICALWLQSNKHPDHWTLRGVALLCDVK 4593          

HSP 2 Score: 282.722 bits (722), Expect = 4.017e-75
Identity = 216/877 (24.63%), Postives = 425/877 (48.46%), Query Frame = 3
Query:  183 IKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQ-IELMDKFFSSDDTNTLFFHFQEPELEKETGD----QIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGS--NGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEI--DLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKS-KTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQ---LCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ++E R  + S L    +Y+L   AD   ++  E+   I+D ++ +E ++  F  ++   +        +     D    Q ++  T I++S  ++  +         L G+  V  R +    I+  +++ +V   +I+    N  L  ++ +M  V+ P    +   +G  EK++  +    + L  +   L ++  +++ RV   +  E+   L  +R  I+  + +    +L  VE     WL+QI+ +L E  QI+R+  ++GP   L  W++ +A++  + + +           L  ++S K L  W E+D ++T A NEAKDNV+++ +L++   PLY+++P ++I ++P L+ ++R +   + Y+NT   +T L VKI+NQ+  + K YI+++    V                   + Y+  +  T   + N  +ER + +S +YI      F +RL  +  I     TYS+L    I G+E           TI  + Y+ L+ R   F  DF+ F+ +++E    +  F+        S    +  L+RFE L++  L ++ +Y+++     R++  +   Y+  + +P + R++P +AG+I W R +F++I  PM+  +++ Q +L   +A+  ++ YN +   +  +E+ YH+AW   +      LN+ ++  + E     VN D  IL L  ET+ M KL LE+P  A  +   ++ L      L LM+    ++  S+   +  +M  R+ ++  +++P L+T  W S  L++Y++ V   + E+E   +   D+   RI   L+EM +I       +P + PV+  EFV  + +L  +  ++L+ KS  +E +V ++INM 
Sbjct:   46 LREMRQQRISSLGPNQRYVLEICADLLGIDPEEIVTGIVDESKYVENVNGIF--EEKGPMAIMISNATMLGYPTDSGRYQEKLKYTEIQRSVCLRSDL-------VDLIGKWTVVYRLNNEKSIDNRSVSDEVAIFMISAEERNSCLNVVKTFMDHVLKPSIEAVTE-FGLAEKEQTQK--FFHILNMYNTFLKSSEATVSSRVNFDISHELFKGLLLVRWQIEASSKILTRVRL--VERYFEQWLRQIQGILVEGKQIQRDTPDVGPLQMLVNWRRMLARYTTITEFVTSRAFNNHKDCLTLSRSSKLLNRWAEIDNQVTLALNEAKDNVRYISSLQKFWDPLYRSSPNVIISSLPGLMVAIRNVSKTAHYFNTPVNVTGLMVKISNQLTITSKNYITDNEHSKVM------------------ENYKNIYIHTVDEMKNS-NERPWTVSSVYILTCLQKFLQRLEKVKWIANTDITYSILDRIMISGMERFNAMIKGARMTISSQLYDPLNYRIETFDLDFEKFVNEVEEAEVGMQQFVKLLSTECPSAASVMLVLKRFEALSLECLCLDRRYLEVAEMLEREMFLLKDVYNEERGNPFIPRNLPPVAGRIIWIRSIFKKIDLPMQALKLR-QCVLAHKKAQRTVRYYNYMNGIICHYEMAYHKAWFDYVEEVRCLLNAPIMTINKEEAIYIVNIDRAILQLISETEWMWKLNLEVPNMAATITYCKDRLLGPATTLKLMLQRYDRLRTSLTPVFINIMRFRLQEISILLKPSLSTVTWISENLEDYVEKVCMKIKEVETFFNLILDIEDLRI---LQEMYSISDYLYIYVPEE-PVSSYEFVEESNKLRSEIERILEKKSVCMERAVVDIINMF 884          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4600.04 bits (11930), Expect = 0.000e+0
Identity = 2244/3721 (60.31%), Postives = 2866/3721 (77.02%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAE---ALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSE------VVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A ELL HFNHRN++A++++ RNTLE+LRKRI A +++       S  +P FR    L IPNI+M+P ++EVQH +NR    ++SVSKG+ QWSKER + ++++     AL+ N ++ + E      ++  +   S++S                                   SAN    +Q+KN +K+++ENKE+ K+ S+LST INST+KE+  A+ RFS Y H+W K ++ T+++F++ +P +SEF+  I  Y  LE +INAE ++   G +AL+T  LK+ L +ETK+W + +G+ CN KY+ EME+IFTF ++  K+L+RQIKDLDDIRIAM  LKEIRE++I ID  + PIEESY+ML +Y L + K+E E+VDTLRYTW+KL+SR ++VQ+ L+++QP+FR  LI+NV+ F +DC  FY DYD   P   G    +A  +L         +   +IT++GGEELFGL VT + +L +I+K+L LLQKLY LYN VI++VNGYYDI W D+ I++I+NEL +FQ RCRKLP+GLK+W AF DL+KTID+F+   PLL+LMTN AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLM+L SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL++FDNIK V+FHEK Y+ ILA  S EGE +EL+KPV AE NVE+WL  LL  +QRSLH VIR A  +I D+ F ++EFL+ +PAQVGLLGIQ++WT+DS +AL NA+ DRKIM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF ED D+ +++ITDV F+YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+K F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNI LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYP+LE+AI++Q+ EA +I+HPPW LK+IQL+ETQRVRHGMM LGPSGAGKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNI+NASPATVSRNGMV+MSSS L+W P+L+GWL  R++ E  ++ +LF++SFP++YR+SIQ L YKME LEAF++ Q  ++L+GLI  K++    ++SR H ERLY+F++MWS+GALLE++DR KLE ++R++++I LDLP I   SEDTMFD+ V+ +G WVHWN++VEEYIYP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  Y+S  +PE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E  GF++L+KPG+F +++D+ F+AAMIHPGGGRND+P+RLKR F IFNCTLP+ ASID+I+ VIG GHYC  R F   V N V +L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++   ++VIS+ + LL+LW HEC RV++DR     D+ WF+  +   +++        VV+        +YFVDFLRDAPE   +  +++ F +PK+YEP+ SF+ L ERL+MF   +NE++RG+ +++VFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI+S +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+AL+ V++H L  + + C   VK ++V  +      V   C  YF +YRRS  +T KSYLS+I  YKT+Y+   + V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+A+A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+     SW ESLKL+ + NFL SL  FP+D INEE+++ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +LA Q   L  A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT  S EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G   KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L+ VL   K+T+ +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+ +S KSP   +RI +II  MT  +  +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK   PK  KWI+D+TWLNLV LSKL  FS +++QI   EKQWR+WFD++APE+E IP  Y+  LD F++LLLIR WCPDRT+  AR+YI +++G+ + E V   +     E++ +TPL+  LS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++  +M  G W LLQNCHL +D+++EL   I E+ +V+  +RLWMT+E H  FPI  LQ++IKFTNEPP+G++A L+R++  ++QD LD   ++ W+ M Y +AFLH TVQERRK+GPLGWNIPYEFNQADFNA   F+QNHLD I  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   + VD+Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+IV +   +ML+K+P + +PF+V E++  MG  QPMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W+K SW STTLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP EGVY+YGL+LEGA WD+RN +LI++KPK+L++ +PVI ++A     +    +D ++Y SPIYKKP RT+L YIA  +L  S   E+WI+RGVA+LCD+K
Sbjct:  868 AKELLSHFNHRNVDALLRLTRNTLETLRKRIHASSLIRQK---GSGPQPIFRAGVCLAIPNIIMVPGLDEVQHALNRAVDYVVSVSKGVGQWSKERISKRKMSERRMAALKQNSQESESEDA----DSTYHSSTSDISA----------------------------------SANQAIPFQIKNYHKSISENKEIVKLVSVLSTSINSTKKEIMNALERFSIYHHIWKKDREETIQKFIQGNPFLSEFESQILYYRDLELEINAEPEFISVGALALYTVDLKLALTAETKSWMVDFGQYCNRKYRMEMEQIFTFIDEASKKLNRQIKDLDDIRIAMATLKEIREHQISIDFQVGPIEESYSMLHKYGLLIAKEEAEKVDTLRYTWEKLLSRSTEVQNELVSLQPKFRGELIKNVETFVEDCQHFYHDYDRVSP--EGQLHFQAQTQLF----SCIYIPLGYITFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNSVIDTVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIITNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWLKNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQ--GGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDL----GVDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLPLKANLAVQENRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCRHKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTYKVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIANIIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAAKWILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALGKRQRIETRYVSMGQGQEVHARKLLQHSMANGGWALLQNCHLGLDFMDELMDTITETDSVHDTFRLWMTTEVHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDVSNMVQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKK-----GVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSTGGGETREAIVGRLADDMLEKLPPDFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKASWASTTLGFWFTELLERNRQFHSWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYA-----ENNGVKDARLYSSPIYKKPVRTDLNYIAAVDLRTSHPPEYWILRGVALLCDVK 4525          

HSP 2 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 416/869 (47.87%), Postives = 575/869 (66.17%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPE-LEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            K+KEER AKR++LD RH Y+L  V+    LE +EVE++IL+G QIE M++FF+ D    L  ++Q+ E  E    +Q +         R+ K KVF+T+G +  L G CV F R++    I    I +DVNF +++ +  G+L+ +E+ +S + +P  R +  GWG+L   +    ++  ++SL++FV VLS A+ES+ E+V L+ C   DLK ++ P D   + N+ + L K+E C+  W+KQIEQVLAESDQ+R+EAD++GPRAELD+WKKRM++FNYLLDQLK PEVKA +G+L  AKSK +K W E+D RITDAANEAKDNVK+LYTLE+ C PLY +NP  M++ IP LI+++RMIHSIS+YYNTSEK+TSLFVK+         +Y SND+                                   RL            EMYIFGKFDTF RRLS I+ +F  I TY+ L D+ IEGLE+M  +F  IV T+KKK Y+FLDQRRT+F QD+++F +Q  ELHN +  FMD  FD I +T RA+  L++FERL IPDLGI +KY +IL ++GRD+E + + Y++ K DPP+A D+P  AGKI WARQL+ RIQ PM++F+ Q   LL TP+AK II+NYN++A+ L+ FE++YH +W+ Q  +   GL +SL+++ PET +L+VNFDP IL   RETD M+ + L+IPP A  L+ K+   K+ +NKL L      +V  S    +EQL++  +AK+   I PGLT+ NWTS+ + +Y+  +   L  LELLL R  DL ++RID VL+EMST  LC LP D P T +EFV  T+ELCIK A++L +KS  VE++ NELINML
Sbjct:   13 KLKEEREAKRAQLDSRHDYVLSIVSSCVGLEKSEVEDAILEGTQIERMEQFFAVDGLPHLILYYQDTEATEAGYNNQTQC------PHRIKKAKVFVTEGTDVALTGICVFFTRANTSKPITSENIHRDVNFNMLDTTGVGLLKSVEQLLSEIFIPTLRKMNYGWGELASPQAQAVKQDFISSLDSFVSVLSGAQESLQEKVNLQECETFDLKTLKGPSDYTAVANSADALEKIEACMKTWIKQIEQVLAESDQLRKEADDLGPRAELDHWKKRMSRFNYLLDQLKSPEVKAVLGVLLVAKSKLIKVWRELDIRITDAANEAKDNVKYLYTLEKFCDPLYNSNPVSMVEAIPGLINAIRMIHSISRYYNTSEKITSLFVKVR-------VSYKSNDH-----------------------------------RL------------EMYIFGKFDTFQRRLSKILNLFSTITTYNALQDSKIEGLETMATRFQAIVLTMKKKQYSFLDQRRTDFDQDYEEFCKQTSELHNQLKTFMDNTFDKIQNTERALYVLKKFERLGIPDLGISDKYQRILQNFGRDIEMISRIYNKQKTDPPIAPDLPPTAGKILWARQLYSRIQEPMDLFQ-QLPGLLSTPDAKPIIRNYNRVAKVLLEFEVLYHHSWMAQTEAVKAGLQASLLVKSPETGQLFVNFDPQILTQIRETDCMLGMGLDIPPFAAILQQKKEVFKKNYNKLQL--KRFDRV--SWKPAFEQLLMPHVAKVDEAILPGLTSLNWTSLNIDKYLCRITAALDNLELLLHRVNDLVEFRIDAVLQEMSTATLCVLPEDEPCTCEEFVQTTKELCIKGAQMLHTKSSLVEEAANELINML 816          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 4257.6 bits (11041), Expect = 0.000e+0
Identity = 2100/3720 (56.45%), Postives = 2731/3720 (73.41%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSA--KPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A + ++     RN EA+V   +++L +L +R+ A +      S   +    P FR +  L IPNIV  P+ E +Q  +N+   M++S++K I  W+       QL AE + + E           DE V++                       KP                          +++  ++V E+K+V K  S L   ++S + +    +   S +S LW +     ++ FL+ +P +++F   +  Y   E QI+   Q    GPI   TE LK+ L+ E   W+  +G A N +  A M +I +F + + ++L R I DLDD+R +MGAL+E+RE EIRI+  + P+EES+A+L R++L       ER+D + Y W++L     + Q  L  ++P  ++ LI  V++F+K  + FY DYDNSGP V GLPPREASDRL ++Q ++D L R+++T+S GEELFGL V +Y  L  IK+ELNLL KLYSLYN VI+SV+GYYDILW D++IEKI+NEL +FQNR RKLP  LK+W AF DL+KTIDDFN   PLL +M N AM  RHW+R++DLT H F+VE+  F+LRN++EAPLLK KE+IED+CISAVKE+DIEAKLK V  EWS H+  F TF+NRGELLL+G  TSE +++MEDSLM+L SL+SNRYN PFK  IQ  V KLSNSSE+IE+W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW +IM RAHE   V+QCCVGDETL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL++FDN+  V FHEK Y+ IL+  S EGE + + +P+ A+ NVE WL  LL+  +++LH +IR A   I D  F ++EF +M+PAQVGLLGIQ +WTRD+ EAL  +K+D+KIMQ TN++FL LLN LI  TT DL K+ERTK+ETLITIHVHQKDIFD LV+  ++SP DF+W KQ+RFYF++D DRCI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQ +   GFYSL++PG+F +V+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F   V ++ + L+  TRK+WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   S+V  + + L  L+ HECSRV++DR IDE D + F+  +E            +    + YFVDFLRDAPE   E  +D+    PK+YEP+P+F+ L ERLSMF + YNE VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK++YR AG E KG  F+FTDN+IKDE++LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+ P T +NLY YFL RVR NLH+ LCFSP+GEK R RAL FP L SGCT++WFQ+WP++ALV VAQH L ++ L C D VK  +V  +      V   C +YF ++RR   +T KSYL++I  Y+ +Y     +V +L ERM  GL++L EA+ ++  L  EL  KE+ L VA  +A  VL  VT +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL+ +E AL TIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+++D    D ER  VK SW E+LKL+ ++ FL+ LL F +D I EE+++LL PY   EDY+LE A+++CGNVAGLC+WT+AM +F+ +N+EV+PLK +L  Q   L  AQD+L  A++ L  K++ L   +  YD A+K KQ L  DA  C+KKMS A  L++GL  EK RWT  S +FE QI  +VGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASRY L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL++ED+ EELDP L+N+LEKNFIK G   KVKVGDKEVD+ + F LYITTKL+NP +SPEI AKT V+DF+VTMKGLEDQLLG VI IEK+E+E  R +LL++ ++NKRK++ELE +LL RL + +GSLVED++L+ VL   K T+ +VS ++  AA+TE  IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+ +S KS    +R+++I+  +T  ++ +  R LY+  +  FTLLLALK+D++  ++   EL   +KGG++LDL +++ KP +WI+D TWLNLV LS LH F+ L+ Q+  +++ W++WFD+  PE+  +P GYE+ LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V   + ++  EA+ + PL+  LS+G+DPT  I+  AK   I    ISMGQGQEVH+RR++A++M +G W+LLQNCHL +D+++E  + +  + N++  +RLW+T++ H +FPINFLQ +IKFTNEPP+G++A L+R++  +TQ+ L+   +  W+ +FY++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHLD I  K+     G++W C+RYM+ E+QYGGRVTDD D RLL    + +F E MF   F       I     + +Y  +I  LP  D P  FGLH NADI+Y T      L TIL+IQPKDS  GEGETRES V K   EML+K+P++++P +V   + KMGAFQPM IFLRQE+DR+ +VI  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P  W+KISWE+ +LGFWF EL++RN QF  W  +GRP+ FW+TGFFNPQGFLTAMRQE TR +   GWA D+VIL N VTR   E++  PP     GVYIYGL+L+GA WDKRN +L E+ PK+L++ LPV++++A+   T+ K+     +Y  P+YKKPRRT+LTYI +  L  S++ +HW +RGVA+LCD K
Sbjct:  791 AFYIMMGQLCQRNTEALVTATKSSLNALHRRLLAASSSYRSSSPSGATIQVPLFRVSVELAIPNIVFRPSFEHIQGILNKGVNMVLSMAKDIPLWNYFHLQQDQLQAEQVAAREHG---------DETVVS-----------------------KP------------------------ILLRSLDRHVTEHKDVNKSLSQLVPLVSSLKADAGDILEDLSQFSALWNQDPAEQVKAFLQTNPILADFSTQLSLYSAYETQIHELPQTCTVGPILFETESLKMSLIQECHTWKREFGAALNQQASAGMTEISSFVDGVNRQLQRPISDLDDVRESMGALRELREEEIRIETIMGPVEESFALLNRHDLFFNDGNAERIDGVVYAWKELKVMAKETQKKLSDVEPHMKAELIAGVEVFQKSVESFYGDYDNSGPGVTGLPPREASDRLQVYQAKFDELWRKYVTFSSGEELFGLPVGEYPDLHRIKRELNLLSKLYSLYNSVIDSVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKGSDTSEKVALMEDSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQLLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRVVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKFLDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITDVEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKR-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPA-MNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 4442          

HSP 2 Score: 543.888 bits (1400), Expect = 4.790e-154
Identity = 303/758 (39.97%), Postives = 461/758 (60.82%), Query Frame = 3
Query:  501 CVVFMRSSQGTQINENTIAKDVNFIVINGS-NGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDE--DSRRAMMNSLENFVLVLSNARESINERVALK-VCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNEL 2762
            C+ F+R +    I    I+++VNF +++ S + +L  LE  +++VM    ++ +  WG ++  +     +  + S++ F   LS+   ++ E+  L  + +  DL  I+ P D     NN+E +  +E  +  W KQIEQVL ES++IRRE+D+IGP AEL +WK+RM  F  L+D++K P VK  IGIL AAKSKT+  W E+D  IT  ANEAKDNVK+L TL++    L ++ P  M+ +IPKL++S+ MIH +SQ+YNTSE MTSLFVK+TNQM+T+ KAY+    T+ VW L+ +EL+KR+ +C ELN+ YQ CF++ K ++   PHERQ ELSE YIFGKFDTFC+RL  I  +   ++ +SVL     EG+E + +++  IVSTIK K YN LD R+ EF  D+ +F  QIQ L+ ++   +D       +T + ++ L RFE      + + +KYM +L  Y  D+E V K Y + K D PV++  PL AGKI W++ LF++I+ PM++ +    ++L+ P+ + II++YN+LA  L+ +E+I+ +AWV  +    +GLN+SL+ RHP TKE YVN DP +L + +E + M KL   +P    ++  K+  LKE+  KL +M+     V   IP   +  M   +  +   + PGLT  +WTS+ +  +I  VY  L ELE +L    D+   RI+  LE M +  L  LP + PVT + F+ +T        + L+  SQ VE S+ E+
Sbjct:    1 CLFFLRITDKA-ITTTNISQEVNFGMLDCSESSILHNLEFLLTQVMNQALKS-QEDWGAIKDGQMNPDVQNFLRSVDKFTFTLSSVMRNMEEKFKLHHIPSAPDLSHIQKPEDYSYAANNSELVEDLEAVLVYWAKQIEQVLTESERIRRESDDIGPSAELAHWKRRMITFCSLMDEIKDPYVKKIIGILHAAKSKTMSKWKELDASITIVANEAKDNVKYLSTLDKFFELLEKSTPTSMLKHIPKLMNSIHMIHRVSQFYNTSEHMTSLFVKVTNQMVTTSKAYLCQGVTK-VWELDRKELLKRMKECIELNQEYQQCFRQMKEKIQQNPHERQLELSENYIFGKFDTFCKRLEKITDMATTLEDFSVLQFMKFEGVEKIYMRYQNIVSTIKSKTYNVLDHRKLEFDNDYIEFRNQIQVLYQSVDALIDTWLQRPLTTEQVLELLSRFENGVGRQMDLNQKYMVVLQRYECDLEFVRKCYQKEK-DNPVSQLTPL-AGKIEWSKHLFKKIELPMQILK-DKLDILQMPDRRKIIRSYNRLAAVLLEYEMIHQKAWVEGVELGLSGLNASLLTRHPTTKEFYVNLDPLVLEVLQEANNMYKLGALVPDGIHDMAAKEPQLKEYRYKLQMMLKEFHAVVKKIPGVLKSPMKPFIRSVETALSPGLTILSWTSLNIDYFIGCVYKALQELEQVLKVVTDILDCRINHTLESMCSTTLLTLPENEPVTPEMFLTHTAATISTERETLKVASQQVERSMLEI 752          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3252.61 bits (8432), Expect = 0.000e+0
Identity = 1563/2679 (58.34%), Postives = 2022/2679 (75.48%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQ +   GFYSL++PG+F +V+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F   V ++ + L+  TRK+WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   S+V  + + L  L+ HECSRV++DR IDE D + F+  +E            +    + YFVDFLRDAPE   E  +D+    PK+YEP+P+F+ L ERLSMF + YNE VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N +EDLK++YR AG E KG  F+FTDN+IKDE++LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+ P T +NLY YFL RVR NLH+ LCFSP+GEK R RAL FP L SGCT++WFQ+WP++ALV VAQH L ++ L C D VK  +V  +      V   C +YF ++RR   +T KSYL++I  Y+ +Y     +V +L ERM  GL++L EA+ ++  L  EL  KE+ L VA  +A  VL  VT +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL+ +E AL TIKP DI+TVRKL KPPHLI RIMDCVL+LFQ+++D    D ER  VK SW E+LKL+ ++ FL+ LL F +D I EE+++LL PY   EDY+LE A+++CGNVAGLC+WT+AM +F+ +N+EV+PLK +L  Q   L  AQD+L  A++ L  K++ L   +  YD A+K KQ L  DA  C+KKMS A  L++GL  EK RWT  S +FE QI  +VGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASRY L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL++ED+ EELDP L+N+LEKNFIK G   KVKVGDKEVD+ + F LYITTKL+NP +SPEI AKT V+DF+VTMKGLEDQLLG VI IEK+E+E  R +LL++ ++NKRK++ELE +LL RL + +GSLVED++L+ VL   K T+ +VS ++  AA+TE  IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+ +S KS    +R+++I+  +T  ++ +  R LY+  +  FTLLLALK+D++  ++   EL   +KGG++LDL +++ KP +WI+D TWLNLV LS LH F+ L+ Q+  +++ W++WFD+  PE+  +P GYE+ LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V   + ++  EA+ + PL+  LS+G+DPT  I+  AK   I    ISMGQGQEVH+RR++A++M +G W+LLQNCHL +D+++E  + +  + N++  +RLW+T++ H +FPINFLQ +IKFTNEPP+G++A L+R++  +TQ+ L+   +  W+ +FY++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHLD I  K+     G++W C+RYM+ E+QYGGRVTDD D RLL    + +F E MF   F       I     + +Y  +I  LP  D P  FGLH NADI+Y T      L TIL+IQPKDS  GEGETRES V K   EML+K+P++++P +V   + KMGAFQPM IFLRQE+DR+ +VI  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P  W+KISWE+ +LGFWF EL++RN QF  W  +GRP+ FW+TGFFNPQGFLTAMRQE TR +   GWA D+VIL N VTR   E++  PP     GVYIYGL+L+GA WDKRN +L E+ PK+L++ LPV++++A+   T+ K+     +Y  P+YKKPRRT+LTYI +  L  S++ +HW +RGVA+LCD K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQGPWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKR-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTESKKPA-MNLYSCPVYKKPRRTDLTYIFSLFLRSSQNPDHWTLRGVALLCDCK 2685          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1990.7 bits (5156), Expect = 0.000e+0
Identity = 1197/3586 (33.38%), Postives = 1936/3586 (53.99%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSL---YNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE---KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFV-------VRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIK-WIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQE--STNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVF-----NTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSH---QGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVCSKSA-EHWIMRGVAMLCDI 14099
            Q K  +  + +++E+ K+Q  ++  + +    ++T +  +  +  +W   KD+ ++ + + +P V+ FD  I  Y  + + +  E        + L    LK  LL     W+  + +  ++   ++++++ +F ++   RLS+  + L D+  ++  L+ ++ +  +I+  I PI E YA+L +YE+ V     E ++ L   W             L   +   +S LI + + F+K    F + + ++GP    + P  A  ++   + + + L+        G  +F +       +  ++K+++ LQ+++ +   + D+     G +      +  E + N          KL +  KD  W   +  +  I+ F  ++PL+  + N A++ RHW ++       FD  S  F L  I+   L    E I DI  +A KE  IE  L+ +   W    L     K++G   LRG  T E+   +ED+ + LS + ++R+   F+K++      LS   E+IE  +TVQ  W+YLE +F+  DI KQL +E   F  +  SW  IM R  ++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++            +S +GE ++   PV  E  VE WL  +    + +L   +R  + ++        +++  +P Q+ +   Q+ WT D T AL+ +K  +D+  ++   ++ + +LN   +    +L K+ R K   L+T+ VH +D+  +L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++RA P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+ A+  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+GKT     L   L+     GEP     RE  +NPKA++  +++G  ++STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E  ++ +LF        RY  + L +K    +  V       V   C L + L   ++     DS    R+  E  +IFS++WS+ A ++ E R K++ ++R    I+   P     ++DT+++Y V ++N  W  +  K+ +      + P Y  I+VP VD VR  +L+  + S +  VLL G  GT KT +    L S +       ++N SS T     Q  IES V+KR+   Y P  G+KM VF+DD+NMP ++ +G Q   E++R  I+  GF+   +      + DL  + +M  PGGGR  I  RL+  F + N T PT + I RIY   G     K + F   V  +   L   T +L+ +  ++  PTP+K HY+FNLRD+S+++QGL+    D   + + + RLW+HEC RV SDRL+D +D++ F   +   L     V F    P  +   F DFLR++                +IYE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS+TRLA++I  +  FQ+ +T+ Y    F ED+K +YR  G ENK TVF+F D +I DES+LE INN+L+SG +  L+  +E+DEI S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+G+ FR R   +PAL +  TI+WF +WP++AL+ VA+  L    L  +D ++ K+  +   +HQ V  FS+ +K   + +R   +T  +YL  +  YK +    +  +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L   NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  A+  L E  E L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +  LVGD ++ +AF+SY GPF    R ++ +  W   +R   VP +        LS P  + EWN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E +  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+  ++G    +K+GDKE++   +F  Y+TTKLSNPH++PEI +KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +V+ Q+  +  TE +I+ ARE YR  ++R S+L+F++ DL  ++PMYQ  L  ++NLF+ SI  S +S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+   +  +  +E N  L+GG  LD K     P   W+ D  W N+  L KL  F  L+       + W  W+    PE   +P  +E   +E +K+L++R    DR  +    ++   LG  F+E     + ++  ++  +TPL+ +LS G DPT  +   A+   +  +   +S+GQGQ   + R+I + +  G WV L NCHL + ++ EL +++ E      +  +RLW++S  H +FPI  LQ  IK T EPP G++ N++R +  +++  +L     + ++ + +SL F H  + ERRKF  LGWNI Y FN +DF      +  +LD        +   I W  ++++I+ I YGG VTDD+D RLL      YF   +    FF   +  +V +      +   Y +YIS LP  ++P  FG + NADI+      + +  T+LS+QP+ +       G +RE  V +   ++L KIP+  I ++   K+ K     P+N+ L QEI R + ++H +R++L +L+  I G+VVM+  L +  +CI DA++P +WEK       L  W  +L  R  QF +W    R PV FW++GF  P GFLTA+ Q   R ++  + D++     VT      L  PPK+GV I GLFLEGA WDK+   L+EA+P  L   +P I+   ++ + +  +     MY  P Y  P R+      +++   +L       +HWI RG A+L  +
Sbjct:  998 QRKPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGH---LASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG--TDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFE-------RYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRM-VELWFIFSLIWSVCASVDEEGRKKIDTFLR---EIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDY-GFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY---GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARK--DNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKV--ELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLD--------EYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFF--KVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPA-EIDYEGTRKLLK-DDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNV-SVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAK----NMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSL 4504          

HSP 2 Score: 168.703 bits (426), Expect = 1.515e-40
Identity = 160/702 (22.79%), Postives = 312/702 (44.44%), Query Frame = 3
Query:  459 VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVS--------------TIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQH--QNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQIN-STHTGLNSSLIIR-HPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTS 2501
            +++     A +  Q   F+R+   + I E +    V F  + G  G ++GL   M+ V  P    L   W +  K+  S       L  F+  L+++R  +     L +  E    R    +   N+V   E  M V H    W +QI+ VL+ +  +    D +GP  E+ +WK R A  + +  QL+ P V+    ILQ   S  +  + ++ ++I +++ +A+ NV FL  L+E C  L Q  P  +   +  +++ +R+I   S Y+NT +++T+L  KI+N++I  C   IS +     + +  ++++   ++CC     ++  +  T  +L ++   + + L ++ IF   D+F +R   +I+I E  + ++   D     L     +    V+               + +   + LD R   + +D+  F  ++++L   + N +   F+ +      +Q L  F+ L+  +     I+ K + +   +  ++  +     R     PV   MP  AG+I W + L  R++  ME+    H   ++    E  VI   Y KL +TL          W + ++   H+ L+  L+IR   +T  L +NF+ ++L L  E     +L+ EIP     +  ++  L      ++L+V    ++   +  +   L   R+  L + I+PGL+  +W++
Sbjct:  121 LYVDYAMPAQVVEQMSYFIRAPD-SMITEESFRSSVQFGSVRG--GAIEGLLRMMNGVHTPQV-TLSTTWPETSKNNYS-----AELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLE--MVVIH----WTRQIKAVLS-AQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSSKQILNDCIQCC---LAWKELYLHTS-QLHHKHSSQGWSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPV--QMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVI---YVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWST 797          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1985.3 bits (5142), Expect = 0.000e+0
Identity = 1197/3586 (33.38%), Postives = 1936/3586 (53.99%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSL---YNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE---KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFV-------VRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIK-WIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQE--STNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVF-----NTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSH---QGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVCSKSA-EHWIMRGVAMLCDI 14099
            Q K  +  + +++E+ K+Q  ++  + +    ++T +  +  +  +W   KD+ ++ + + +P V+ FD  I  Y  + + +  E        + L    LK  LL     W+  + +  ++   ++++++ +F ++   RLS+  + L D+  ++  L+ ++ +  +I+  I PI E YA+L +YE+ V     E ++ L   W             L   +   +S LI + + F+K    F + + ++GP    + P  A  ++   + + + L+        G  +F +       +  ++K+++ LQ+++ +   + D+     G +      +  E + N          KL +  KD  W   +  +  I+ F  ++PL+  + N A++ RHW ++       FD  S  F L  I+   L    E I DI  +A KE  IE  L+ +   W    L     K++G   LRG  T E+   +ED+ + LS + ++R+   F+K++      LS   E+IE  +TVQ  W+YLE +F+  DI KQL +E   F  +  SW  IM R  ++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++            +S +GE ++   PV  E  VE WL  +    + +L   +R  + ++        +++  +P Q+ +   Q+ WT D T AL+ +K  +D+  ++   ++ + +LN   +    +L K+ R K   L+T+ VH +D+  +L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F F +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++RA P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+ A+  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+GKT     L   L+     GEP     RE  +NPKA++  +++G  ++STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E  ++ +LF        RY  + L +K    +  V       V   C L + L   ++     DS    R+  E  +IFS++WS+ A ++ E R K++ ++R    I+   P     ++DT+++Y V ++N  W  +  K+ +      + P Y  I+VP VD VR  +L+  + S +  VLL G  GT KT +    L S +       ++N SS T     Q  IES V+KR+   Y P  G+KM VF+DD+NMP ++ +G Q   E++R  I+  GF+   +      + DL  + +M  PGGGR  I  RL+  F + N T PT + I RIY   G     K + F   V  +   L   T +L+ +  ++  PTP+K HY+FNLRD+S+++QGL+    D   + + + RLW+HEC RV SDRL+D +D++ F   +   L     V F    P  +   F DFLR++                +IYE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS+TRLA++I  +  FQ+ +T+ Y    F ED+K +YR  G ENK TVF+F D +I DES+LE INN+L+SG +  L+  +E+DEI S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+G+ FR R   +PAL +  TI+WF +WP++AL+ VA+  L    L  +D ++ K+  +   +HQ V  FS+ +K   + +R   +T  +YL  +  YK +    +  +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L   NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  A+  L E  E L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +  LVGD ++ +AF+SY GPF    R ++ +  W   +R   VP +        LS P  + EWN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E +  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+  ++G    +K+GDKE++   +F  Y+TTKLSNPH++PEI +KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +V+ Q+  +  TE +I+ ARE YR  ++R S+L+F++ DL  ++PMYQ  L  ++NLF+ SI  S +S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+   +  +  +E N  L+GG  LD K     P   W+ D  W N+  L KL  F  L+       + W  W+    PE   +P  +E   +E +K+L++R    DR  +    ++   LG  F+E     + ++  ++  +TPL+ +LS G DPT  +   A+   +  +   +S+GQGQ   + R+I + +  G WV L NCHL + ++ EL +++ E      +  +RLW++S  H +FPI  LQ  IK T EPP G++ N++R +  +++  +L     + ++ + +SL F H  + ERRKF  LGWNI Y FN +DF      +  +LD        +   I W  ++++I+ I YGG VTDD+D RLL      YF   +    FF   +  +V +      +   Y +YIS LP  ++P  FG + NADI+      + +  T+LS+QP+ +       G +RE  V +   ++L KIP+  I ++   K+ K     P+N+ L QEI R + ++H +R++L +L+  I G+VVM+  L +  +CI DA++P +WEK       L  W  +L  R  QF +W    R PV FW++GF  P GFLTA+ Q   R ++  + D++     VT      L  PPK+GV I GLFLEGA WDK+   L+EA+P  L   +P I+   ++ + +  +     MY  P Y  P R+      +++   +L       +HWI RG A+L  +
Sbjct:  879 QRKPIHSIIEQDEEICKIQGAIAAGMVTNASYLQTYLKTWDKHREIWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDP-VLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGH---LASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRG--TDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSF-EGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFE-------RYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRM-VELWFIFSLIWSVCASVDEEGRKKIDTFLR---EIEGSFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFY-KIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDY-GFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIY---GTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES----------------QIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARK--DNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKV--ELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLD--------EYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFF--KVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPA-EIDYEGTRKLLK-DDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNV-SVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAK----NMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSL 4384          

HSP 2 Score: 107.071 bits (266), Expect = 7.368e-22
Identity = 152/716 (21.23%), Postives = 281/716 (39.25%), Query Frame = 3
Query:  459 VFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSII--KIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQH--QNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINS-THTGLNSSLIIR-HPETKELYVNF--------------------------DPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTS 2501
            +++     A +  Q   F+R+   + I E +    V F  + G  G ++GL   M+ V  P    L   W +  K+  S       L  F+  L+++R  +     L +  E    R    +   N+V   E  M V H    W +QI+ VL+ +  +    D +GP  E+ +WK R A  + +  QL+ P V+    ILQ   S  +  + ++ ++I +++ +A+ NV FL  L+E C  L Q  P  +   +  +++ +R+I   S Y+N            T   IT+                    L++++ +C                       ++QF   E         F  RL S +  K+  I  T+    D S++ L+S+                + LD R   + +D+  F  ++++L   + N +   F+ +      +Q L  F+ L+  +     I+ K + +   +  ++  +     R     PV   MP  AG+I W + L  R++  ME+    H   ++    E  VI   Y KL +TL          W + ++   H+ L+  L+IR   +T  L +NF                          + +   L  E     +L+ EIP     +  ++  L      ++L+V    ++   +  +   L   R+  L + I+PGL+  +W++
Sbjct:   60 LYVDYAMPAQVVEQMSYFIRAPD-SMITEESFRSSVQFGSVRG--GAIEGLLRMMNGVHTPQV-TLSTTWPETSKNNYSAE-----LHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLE--MVVIH----WTRQIKAVLS-AQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIWVNSSYFN------------TRDRITA--------------------LLRKICEC-----------------------QQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATF----DKSLQVLQSV---------------QDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQHLSGREAIKRTIDRKTVDVYNLFHSELVEINLVMCRTSSLIPV--QMPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVI---YVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKGKTGLLDINFNKYSCIHNTCILQNRLGFFNVTNQHTESECTTLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSKLHWST 680          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4707.9 bits (12210), Expect = 0.000e+0
Identity = 2307/3721 (62.00%), Postives = 2879/3721 (77.37%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY----DIS-VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAE---ALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+++     IS  K + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER + K +      A++ N  D D E  V+++         N+S   SIS                                + F +  KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +  L++LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   E  +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++  ++QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  952 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMISFLDGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKKNILERKITAMRGNSNDSDSE-DVIVE---------NISEVASIS-------------------------------TVAFVHN-KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGGVSQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4617          

HSP 2 Score: 864.759 bits (2233), Expect = 0.000e+0
Identity = 426/867 (49.13%), Postives = 615/867 (70.93%), Query Frame = 3
Query:  189 EERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIG-LTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGS-NGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            EE+ AKR++LD RH Y+L  VA   +LE +EVE++IL+GNQIE +D+FF+      + F++Q+ E   E G     G +T    +R  KPKVF+T+GK+  L G C+ F+RSS    +    + ++V+F +++ S N +L  +E  +S + +P  + +  GWG+L   ++  + ++  + SLE FV VLS A++S+ ++V LK C   DL+ ++ P D + + N++E L ++E  + +W+KQIEQVLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH  +  FMD  F+   +T R+I  L +FERL IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+  + L  M+   +++ + +    EQL+   +AK+   I+PGL + NWTS+ +++Y+ ++    A+LELLLDR  DL  +RID VL++MS   LC+LP + PV+ ++F+  T++LC K A  LQ+KS  VE++ NELINML
Sbjct:   18 EEKEAKRAQLDGRHDYVLGIVAACLNLEKSEVEDAILEGNQIERIDRFFAVGGLRHIMFYYQDVE-AAEAGHLGSFGAVTSTLVARNKKPKVFLTEGKDVALTGVCIFFIRSSSTKPVTMENVHREVHFNMLDTSGNSLLGSVESLLSDIYIPALKTMDNGWGELVDPQQAGNVKQDFLGSLEGFVGVLSGAQQSLMDKVNLKKCETYDLRTLKGPCDYLTVANSSEGLERIEEGMKVWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHTQLKTFMDSTFERNYNTERSIIMLEKFERLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQMEVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDNLQFMLMEDKRIKSKVHAPLEQLIAPHIAKIDEAIQPGLLSLNWTSLNIEKYLKNIAEKHADLELLLDRVNDLVVFRIDAVLQDMSITPLCKLPEEEPVSCEQFLQMTKDLCAKGAVTLQAKSCMVEEAANELINML 882          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000035049.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4670.15 bits (12112), Expect = 0.000e+0
Identity = 2298/3719 (61.79%), Postives = 2866/3719 (77.06%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINR-RQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQS-IEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER +   L    L S            +D N+       N+S   SIS                                + F +  KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +  L++LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT Q+ +E       L GD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  552 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKLMLVVLLLGS------------LDMNIFYFCLLENISEVASIS-------------------------------TVAFVHN-KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQNKLEKYRYFLCLSGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4212          

HSP 2 Score: 551.592 bits (1420), Expect = 2.824e-156
Identity = 276/507 (54.44%), Postives = 371/507 (73.18%), Query Frame = 3
Query:  918 ESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSL----RRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEY 2423
            +S+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL            TT+ + S       F  L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++
Sbjct:   21 KSNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSIL------------TTKVVTSCFFLLILFHLLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKH 511          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021565.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4594.65 bits (11916), Expect = 0.000e+0
Identity = 2240/3535 (63.37%), Postives = 2778/3535 (78.59%), Query Frame = 3
Query: 3507 KNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            KN +KNV+ENKE+ K+ S+LST INST+KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++N+ S+VI  +     LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  720 KNYFKNVSENKEIVKLCSVLSTSINSTKKEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTT----LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4236          

HSP 2 Score: 561.992 bits (1447), Expect = 2.204e-159
Identity = 280/512 (54.69%), Postives = 375/512 (73.24%), Query Frame = 3
Query:  909 VLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQS------LRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEY 2423
            VLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL            TT+ + S      L    +L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++
Sbjct:   69 VLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSIL------------TTKVVTSCFFLLILFHLYQLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKH 564          

HSP 3 Score: 107.457 bits (267), Expect = 6.820e-22
Identity = 50/98 (51.02%), Postives = 71/98 (72.45%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKER 3254
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER
Sbjct:  605 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKER 702          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021598.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4548.42 bits (11796), Expect = 0.000e+0
Identity = 2220/3507 (63.30%), Postives = 2750/3507 (78.41%), Query Frame = 3
Query: 3591 KEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPET--VEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            KEV TA+ RF +Y H+W K +D  +E+F+   P +SEF+  I  +  LE  IN E +Y   G IALFT  LK+ L SETKAW +  G+ CN KY++EME IF F E++ K+L+RQIKDLDDIRIAM ALKEIRE++I +D  + PIEESYAML +YEL V K+ETE+VDTLRYTW+KL+ RG++VQ+ L+ IQP FR  LI  VQ F +DC +FY DY+ +GPM+ GL P+EASDRLI+ QNR+DNL R++ITY+GGEELFGL VT Y +L +IKK+LNLLQKLY LYN+VI  VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD TSEII+ MEDSLMIL SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ VIG+GH+C +R F   +   V KLI +TRKLWQ TK+KM PTP+KFHY+FNLRDLSRIWQG++    D+ S       LW HEC RV++DR     D+ WF++  ++   DD    +         YFVDFLRDAPE   ++   +D+ F +PKIYEP+ SF  LK+RL+MF + +NE++RG+ +++VFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+T+LAS+IA Y  FQIT++R YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK +P+ P T ENLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+QH L  + + C   +K+++V+ +      V   C++YF +YRRS  +T KSYLS+I  YK +Y+   A V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ VAEEKL AAKPAL+EAE AL TIKP DI+TVR L +PPHLI RIMDCVL+LFQ+K++P   D E+     SW ESLKL+   NFL +L  FP+D INEE+++LLQPYF  +DY++E A++ CGNVAGLC+WTKAM  FY +N+EV+PLK +LA Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+A+RY L IDPQ+QGK WI NKE  + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKRK+KELED+LL RL +T+GSLVED++L+ VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+DM++N V+ EE   L+KGG++LDLK    KP KWI+DMTWLNLV LSKL  FS ++EQI  +EK W+ WFDK+ PE+E +P GY+  LD F++LLLIR WCPDRT+  AR+YI  ++G  ++E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQE+H+R+++ + M  G W LLQNCHL +D+++EL   I E+ N++  +RLWMT+E H QFPI  LQ++IKFTNEPP+G++A L+R++    QD LD   +  WK M Y++ FLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I   NTVD Y  YI  LPT D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE++V +   +ML K+P+++IPF+V E++ KMG FQPMNIFLRQEIDR+ ++I  VR TLTDLKLAIDG ++M++ LRDALDC++DA+IP  W+K SWES+TLGFWF EL++RN QF  W+ + RP CFW+TGFFNPQGFLTAMRQE+TR++ GWA DSVI+ N VT++  +++  P  EGVY+YGL+L+GA WD+RN +L+E+KPK+L++ +PVI I+A          +D + Y  PIYKKP RT+L YIA  +L   +S +HWI+RGVA+LCD+K
Sbjct:  633 KEVLTALERFKSYHHIWQKDRDNVIEKFVSGSPLLSEFESQILHFRDLELAINTEPEYICVGIIALFTADLKLALTSETKAWMVDLGRHCNKKYRSEMENIFVFIEEINKKLNRQIKDLDDIRIAMAALKEIREHQITLDFQVGPIEESYAMLNKYELLVAKEETEKVDTLRYTWEKLLVRGNEVQNELMAIQPNFRGELISTVQTFIQDCSEFYSDYEMNGPMIVGLAPQEASDRLIMFQNRFDNLHRKYITYTGGEELFGLQVTQYPQLLEIKKQLNLLQKLYGLYNNVIEIVNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGDSTSEIIASMEDSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMVPQPFDLFS-------LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQGQKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIG-NFLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYA-----DNTSTKDNRFYSCPIYKKPVRTDLNYIAAVDLKTVQSPDHWILRGVALLCDVK 4118          

HSP 2 Score: 576.63 bits (1485), Expect = 6.310e-164
Identity = 284/519 (54.72%), Postives = 384/519 (73.99%), Query Frame = 3
Query:  885 LWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMV 2438
            +W+KQIEQVLAES+Q+R+EAD++GPRAELD+WKKR++KF+YLLDQLK PEVKA +G+L AAKSK LK W  +D RITD+ANEAKDNVK+LYTLE+ C PLY ++P  MID+IP+L++++ MIH+IS+YYNTSEK+TSLFVK+TNQMIT+CK+YI+N+ T  +W    + ++++L    +LN+ YQ  F +TK      P ERQF+ SE+YIFGKFDTF RRL  II IFE I TYS L ++ IEGLE +  KF   V+TIKKK Y+FLDQRRTEF  D+++F++Q  +LH +IL         + ++   +  L    +L IPDLGIEEKY KIL +YG D+E V K Y++ K +PP+ RD+P +AGKI WARQL  RIQ PM++F+ QH   L+T EA+ II+NYNK+A+ L+ +EI++H++W++Q+    +GL++SL+++ PET EL+VNFDP IL L RET+ M KL LEIPP A  L+ KQN  K+ F N   L VN +  V N I  ++ Q  +
Sbjct:    3 VWIKQIEQVLAESNQLRKEADDLGPRAELDHWKKRLSKFHYLLDQLKTPEVKAVLGVLTAAKSKLLKIWRLLDTRITDSANEAKDNVKYLYTLEKFCDPLYNSDPVSMIDSIPRLMNAIGMIHNISRYYNTSEKITSLFVKVTNQMITACKSYITNNKTAKIWDQAQDVVVEKLKSAIKLNEFYQHAFHKTKETREQIPTERQFDFSEVYIFGKFDTFQRRLEKIIHIFETITTYSSLQNSKIEGLEMVTTKFQSTVATIKKKQYDFLDQRRTEFDDDYEEFVKQTHDLHVSILT------TKVVTSCFFLLILFHLYQLKIPDLGIEEKYQKILQNYGHDIEMVSKVYTKQKNEPPLGRDLPPVAGKIVWARQLLHRIQRPMDLFQ-QHSTALQTEEARRIIRNYNKVAKVLLEYEILFHRSWLKQVLVAKSGLHASLLVKSPETLELFVNFDPLILTLIRETECMAKLGLEIPPFAATLQQKQNVYKKNFDN---LQVNSLGIVFNLIKTKHCQATI 511          

HSP 3 Score: 109.768 bits (273), Expect = 1.518e-22
Identity = 52/106 (49.06%), Postives = 75/106 (70.75%), Query Frame = 3
Query: 2967 AHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKS--SAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAA 3278
            A ELL HFNHRN++A++KV RNTLE++RKRI   +M+  +   K   + +P F+ N  L IPNI+M+P ++EVQ T+N+    I++VSKG+ QWSKER + + L A
Sbjct:  533 ACELLSHFNHRNVDALLKVTRNTLETIRKRIQMSSMINGNAISKQKINGQPIFKANITLAIPNIIMVPALDEVQQTLNKAVENIVNVSKGVGQWSKERMSKEVLTA 638          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4284.95 bits (11112), Expect = 0.000e+0
Identity = 2110/3541 (59.59%), Postives = 2682/3541 (75.74%), Query Frame = 3
Query: 3504 MKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEF--DFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPKE---GVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTK-MYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            +K   K ++E+K+V KV   LST + S + E    +  F+ +S +W +V+      FL      S F   +I+     LE QI+    +   G +   T+ LK+ L+ E + W+  +G A N K   +M++I+ F ++L KRLSR + DLDD+R AM ALKEIR+ EIRIDM I PIEES ++LL+YEL  Q    ERVD L Y W+ L ++    Q+ LI +QPE +++L++ V+ F  D  +FY++Y+  GP V G+PPREASDRL + Q ++D L R+++T+SGGEELFGL VT+Y +L+ I++EL LLQKLY LYN VI ++NGYY+ILW D+DIEKI+ EL +FQNR RKLPK LK+W AF DL+K IDDF+   PLLE+M N AM  RHW+R+S LT H FDVES+ F+L+NI+EA LLK+KE+IEDICISAVKEKDIEAKLK+V +EWSAH   F  FK+RGELLL+G  TSE I++MEDSLMIL S++SNRYN PFK  IQ  V KLSN++EIIE W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  N++QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLS+FDN+  V FHEK Y+ IL   S EGE + L +PV A+ NVE+WL  LLN  +++LH +IR A+ +I+D+ F + +F  MYPAQ+GLLGIQ++WTRD+ EAL  AK+DRK+MQ TN++FL LLN LI  TT DL ++ERTK+ETLITIHVHQKDIFD LV+  +KS SDF+W KQ+RFYF+ED+D+CI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLK+ FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I HPPW+LKLIQL+ETQRVRHGMMTLGPSGAGKT CI++LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+LK WL                 + P      +  L  KM+ LE   ++QA DLL+        K + Q S+ H  RL+IF+VMWSIGALLE++DR K+E +++ +++  L+LP +  D   T+F++++ ENG+W HW+ KV EY+YPKDS PEY SILVPNVDNVRTDFLM+T+  Q KAVLLIGEQGTAKTVMI  Y S  +PEYH  KSLNFSSAT+P MFQR+IES++DKRMG+TYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQ +E KGFY+L+KPG+F SV+D+ FVAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C++R F + V  + S L+  TRK+WQ+TK KM PTP+KFHY+FNLRDLSRIWQG++   S+V  S+  L+ L+ HECSRV+SDR ID+ D  WFE  I     +    E  +   + +YFVDFLRDAPE   +  +D+    PK+YEP+PSFE L +RL ++ + YNE VRGS ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLAS+IA Y  FQIT+TR Y  NN ++DLK +YR AG++  G  F+FTDNEIKDES+LEY+NN+LASG ++ LF+++E+DEI   +   MKK  P+   T ENLY YFL RVR NLH+VLCFSP+GEKFR RAL FP L SGCT++WFQ+WP++ALV VAQH L  + + C + VK+ +V+ +      V   C++YF +YRR   +T KSYLS+I  YKT+Y      V  L+ RM+ GL KL EA+ ++  LSKEL +KE++L+VAS +A+ VL  VT +  AAE VK +V+ VKDK  AIV++I +D+  AEEKL  A+PALQEAE AL TIKP DI+TVRKL +PPHLI RIMDC L+LFQ+KIDP   D ER  VK SW E+LKL+ ++ FLNSLLTFP+D I EEI++LLQPY   EDY+LE+A+K CGNVAGLC+WT+AM  F+ +N+EV+PLK +LA Q   LA AQ +L +A+  L  K+  L  V+  YD A++ KQAL  DA  CR+KM  A  L+ GL  EK RWT  S  F++QI  LVGD+++ + F+SY GPFNQ++R  +   W+  + +  +P ++ ++++  L +   IGEWNLQGLPND LS++N IIVT+ASR+ L IDPQ QGK WI N+E  + +  T+  +KYF+ HLED L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL+NP ++PEI AKT+VIDF+VTMKGLEDQLLG VI  EK+ELE  R +L+++ + NKRK++ELED+LL RL +T+GSLV+D++L+ VL   K T+ +VS ++  AA+TE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+  S KS    +RI +II  +T  ++ +  R LY+  +  FTLL+ALK+D++   +   E   L+KGG+ LDL +++PKP KWI+DMTWLNLV LS L  F+ L+ Q+  +EK W+AWFD +APE+  +P GY+ +LD F++LLLIR WCPDRT+  AR YI  +LG  + E     + ++  E+D +TPL+  LS+G+DPT  IE  +K  +     ISMGQGQEVH+RR++ ++MQ+G W+LLQNCHL +D+++EL   +  +  V+  +R W+T+E H +FPIN LQ ++KFTNEPP+G++A L+R+++ ++Q+ LD   +  WK + Y +AFLH TVQERRKFGPLGWNIPYEFNQADF A   F+QNHLD +  K+     G++W C+RYM+ E+QYGGRVTDD D  LL    + +F E MF   F       I    T+DEY  YI  LP  D P  FGLH NADI+Y T      L TI++IQPKDS  G GETRES+V +   EML+K+P ++IP +V  ++ KMG  QPMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALD ++DA+IP +W KISWES+TLGFWF EL++RN QF  WL DGRP  FW+TGFFNPQGFLTAMRQE TR +   GWA DSVIL N VTR   E++  PP     GVYIYGLFL+GA WD+RN +L+E+ PK+L+ +LPV++++A+        ++    ++  P+YKKPRRT+LTYI +  L   +  +HW +RG+A+LCD K
Sbjct:  509 LKPLDKQISEHKDVTKVIIQLSTIVLSLKAEAANVLNSFTKFSGIWNQVR-----TFLCSSRTFSLFICCYILFHLQQLETQISELPAHCIVGSVDFTTDSLKMALVQECRHWKRVFGSALNKKAAMDMDEIYLFIDNLSKRLSRPVLDLDDVRGAMDALKEIRDAEIRIDMMIGPIEESNSLLLKYELVFQDGNAERVDGLAYAWKNLNTQAVYTQNLLIKVQPEMKTDLLDGVEKFHIDAAEFYKNYELLGPGVEGIPPREASDRLQVFQAKFDELWRKYVTFSGGEELFGLPVTEYPELQRIRRELALLQKLYGLYNAVIENINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKGSDTSEKIALMEDSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWL----------------QTLPAFQHEILWNLSPKMQILECMYIKQAIDLLQ------KSKQNKQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQ-DHSAPLELPTVSGDQ--TIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIAV---EDHGQEIMNNALKESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKR-----GVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQQGYLHACPVYKKPRRTDLTYIFSLFLRSIEVPDHWTLRGIALLCDSK 4011          

HSP 2 Score: 235.343 bits (599), Expect = 1.533e-60
Identity = 130/336 (38.69%), Postives = 200/336 (59.52%), Query Frame = 3
Query:  708 MNSLENFVLVLSNARESINERVALKVCTEID-LKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFT 1712
            ++SL+ F+  LS+AR ++  ++ LK     + L+ +  P D +N   N+E + K+E  + +W+KQIEQVLAES+Q+R+EAD+IGP                                               D  +T+AANEAKDNVK+LYTL++   PL + +P     +   L++S+RMI+S SQYYNTSE MTSLF+K+TNQ +++CK+Y+S+   + +W L+ +EL++R+ +C  LN+ YQ  F + K +L   P+ERQFE SE YIFGK DTFC+RL  I  I   +++ + L    IEG+E + +++  IV+  K K+Y+ LD R+ E +
Sbjct:   13 LDSLDKFIGTLSSARHNLEGKIELKRVDSGNFLENMHNPSDFINAGGNSEIIEKLEAMLSIWIKQIEQVLAESEQMRKEADDIGPS----------------------------------------------DCNVTNAANEAKDNVKYLYTLDKFFGPLGKASPV----SSHILMNSIRMIYSTSQYYNTSEHMTSLFLKVTNQTVSTCKSYLSHGVIK-IWDLDRQELIRRIKECVFLNEQYQNSFHKVKEKLKETPNERQFEFSENYIFGKLDTFCKRLEKISDISNNLESLADLQTIKIEGVEKISIRYETIVTNTKSKSYDVLDHRKQEVS 297          

HSP 3 Score: 87.4261 bits (215), Expect = 7.887e-16
Identity = 37/97 (38.14%), Postives = 63/97 (64.95%), Query Frame = 3
Query: 2061 LLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALK 2351
            L+   E K II++YNK+A  L+ FE++YH+ W +  +    GL++SL++RHP TKELYVN DP ++ +  ET  + K+  E+P   +++  + + +K
Sbjct:  306 LVSGLEMKKIIRHYNKMASVLMEFELLYHRGWCKCADIAKNGLHASLLVRHPNTKELYVNLDPMVMEVLHETKYLQKMGFEVPDVILSMATRGDHIK 402          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 5409.73 bits (14032), Expect = 0.000e+0
Identity = 2688/4653 (57.77%), Postives = 3477/4653 (74.73%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAK----PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE MD+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F+RS     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV +LS A+ S+ E+V L+ C  I+LK ++ P D + + +N E + KVE C+ +W+KQ+EQ+LAE+ Q+R+EAD++GPRAEL++WK+R+++FNYLLDQLK P+VKAA+ +L AAKSK LK W + D RITDAANEAKDNVK+LYTLE+ C PLY ++P  MID IP LI++++M++SIS YYNTSEK+TSLFVK+TNQMI++CKA+I+N+ T T+W+   E +M+++    +L + YQ+CFQETK +L   P E+QF+ SEMYIFGKF+TF RRL+ I+ IF   KTYSVL D+ IEGLE M  K+  IV+ IKKK YNFLDQR  +F QD+++F ++I ELHN++  FMD  F+ I ST +A+ +L++FERLNIP+LGIEEKY  I  ++  D++ + K Y++ K DPP+AR+ P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T EL+VNFDP IL+L RET  M +L L + P A  L  K++  K+  + + +M++  ++V   +P   EQLM   +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+LL  KS  VE++VNELINML   +   E          ++     S ++     +         + +       K+ +  + E A ELL HFNH+N +A++KV RNTLE++R+RI    M+ + D +  S AK    P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++EN              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P + EF+  I  + +LE +INAE +Y   G IAL+T  LK+ L +ETKAW    G+ CN KY+AEME I T  E+ +K+LSR IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPM  GL P+EAS RLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IK++LNLLQK+YSLYN+VI +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + + KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFFIDAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  P+ P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LSKEL  KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG VI  EK+ELE  R  LL+  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  + +TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+DMTWLNLV LSKL  FS +++QI  +EK WR WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+++ E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G WVLLQNCHL +D+++EL  V+ E+  V+  +RLW+T+E H QFPI  LQ++IKF NEPP+G+RA L+R++  ++QD LD  V   WK M Y++AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKDS  G  ETRE++V +   +ML+K+P ++ PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLA+DG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF EL++RN QF  W+++GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT+F  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI IFA     +     D ++Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVE-GAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNPETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEEN-------------ELQETLEIA-----------------------SINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4973.3 bits (12899), Expect = 0.000e+0
Identity = 2518/4658 (54.06%), Postives = 3313/4658 (71.12%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSS-AKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI     V      +S     F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRI----FVGSQGRRRSEDIVSFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4973.3 bits (12899), Expect = 0.000e+0
Identity = 2518/4658 (54.06%), Postives = 3313/4658 (71.12%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSS-AKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI     V      +S     F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRI----FVGSQGRRRSEDIVSFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4973.3 bits (12899), Expect = 0.000e+0
Identity = 2518/4658 (54.06%), Postives = 3313/4658 (71.12%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSS-AKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI     V      +S     F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRI----FVGSQGRRRSEDIVSFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1984.53 bits (5140), Expect = 0.000e+0
Identity = 1196/3584 (33.37%), Postives = 1939/3584 (54.10%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDR-------LIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTD---CGEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE-RPI--MLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY--ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGE-WVHWNSKV-EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD-PPNERT-YFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLK-TIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTP----LIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQ-DYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT--------VDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK-DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLT----YIANAELVC-SKSAEHWIMRGVAMLCDI 14099
            Y  V  ++++ K+Q+ +S+ + +    ++  +  +  Y  +W   KD+ +  + + +P VS FD  I  Y  + + +  E    +   + L    LK  L+     W+  +           +  + ++ +D  +++S   + L+++ +++  +  ++ +   ++  I PI E + +L +YE+PV     E +++L   W          +  L   + +F++ LI     FKK      ED++  GP    +    A D+       L+  ++  +NL            +F +       L+ ++KEL+ LQ+++ +  D   S N +    +  +  E + +       R  +L K  KD  W   E  R  I+ F   +PL+  + NPA++ RHW ++ +     FD ES+ F L  I++  + +  E+I +I  SA KE  IE  L+ +   W + +L    +K++G   LRG  T E+   +ED+ + LS++ ++R+   F+KD+      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F  ++ +W  IM R +++ N L+       L  L+       +I QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK +K  +      ++E +   +S +GE ++   PV  E  VE WL  +    + +L  ++R    ++        +++  +  QV +   Q+ WT D T+ L+ AK  SD+KI++ +                    K+ R K   L+TI +H +D+ ++L K  +   S FDWL Q RFY+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +D++ +GR++ GL+QSG+WGCFDEFNRI++ VLSV AQQI  +LS       +F F +G  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF +  +LA+K YTLY L  +QL++Q HYDFGLR + S+LR  G+++R  P  +++  ++  +RDMN++KL   D PLF +++ DLFP I+L    Y +L   I ++I E  +   P  + K++QL+ET+  RH  M +G +G+ KT    +L  +LT     GEP+    RE  +NPKA++  +++G  D++TN+WTDGI S++ R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV N+  ASPATVSR GMVY     L W P ++ WL KR   E  P+  M E F N      + +   L+      E   +   C L   L   ++  + +      +  E  ++FS++WS+ A ++ + R K+++Y+R    I+   P     ++DT+++Y V+     W  +  K+ + + YP ++ P Y  I+VP VD VR ++L++T+ + +  VLL+G  GT KT +    L S          +N S+ T     Q  IES V+KR    Y P  G+ M  F+DD+NMP  + +G Q   E++R  I+  GF+          + D+  +AAM  PGGGR  I  RL+  F I N T PT + I RI+   G     K + F   V  + + +   T  ++ +   +  PTP+K HY+FNLRD+S+++QG++    D   +   + RLW+HEC RV SDRL+D +D++ F   +   L     + F    PN+R   F DFL++                PK+YE +    +LK  +      YN +    P+ LV F +A+ H+ +I RVI   +GN+LLVG+GGSG+QS+ RLAS I DY  FQI +T+ Y    F +D+K +YR AG E + T F+F D +I DES+LE INN+L+SG +  L+  +E +EI + +    +    + P++ ++L+ Y ++RVR+NLH+VLC SP+G+ FR     +PAL +  TINWF +WP+EAL+ VA+  +    L  ++ +  K+  +   +H  V     K   + RR   +T  +YL  +  YK +    +  +     +++ GL K+ E +E + ++S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K A    K +     A++ L  A PAL+EA  AL ++   DI  ++   +PP  ++ +M  V+IL              +G + +W E+ + L   NF+ SL+ F +D I+++++  +  Y  + D+  +   +       LC W +AME +  + R V P +  + +    L + Q  L  A++ L E  E L ++K +YD  + +K+ L   +     K+  A  L++GL  EKARW       E  +G LVGD ++ +AF+SY GPF   +R ++ +  W   IR   VP +    I   L+NP ++ +WN+QGLP+D  S EN IIVT+ +R++L IDPQ Q   WI N E    +   +     + + LE A+  G P++++++ E LDP LN VL K+  +IG  + +++GDKEV+ +  F  Y+TTKLSNPH++PE  AKT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   +  KRK+KELED +L  L    GSL++D  L+  L  +K T+ +V+ Q+  +  TE  I+ ARE YR  ++R S+L+F++ D+  ++PMYQ  L  ++ LF+ SI +S +S  ++ RI+++    T  ++ +  R+L++  +  F+  +  K+   +  +  +E N  L+GG  LD +  +D     W+ D  W N+  L KL  F GL+       + W  W+   +PE   +P  +E   +E +++L++R    DR       +I   LG  FIE     + S+  ++  ++PL+ +LS G DPT     L EH    H      +S+GQGQ   + R++ + + +G WV L NCHL + ++  L ++++  +  + +  +RLW++S  H  FPI+ LQ +IK T EPP+G++AN+ R +  +T+  +        +K + ++L F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+I+ + YGG VTDD+D RLL      YF +      F+     ++ V +T        +  Y+ YIS LP+ D P +FG H NAD++      + + ET+LS+QP+    +  G++RE  V +   ++  KIP   I ++   K+  +    P+N+ L QEI R +K++  +  +LTDL+  I G++VM+  L +  +CIFDA +P +W K+      L  W  +L  R  QF  W +  R PV FW++GF  P GFLTA+ Q   R ++  + DS+     V+      L  PPK+GV++ GL+LEGA WD++N  L+EA+P  L   +P I+        + +++    MY  P Y  P R   T    ++   +L   S +++HWI RG A+L  +
Sbjct:  960 YVLVERDEDIRKIQAQISSGMTNNASLLQNYLKTWDMYREIWEINKDSFIRRYQRLNPPVSSFDADIARYTEVANNVQKEETVLNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEMAAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTVGHTAALDQIAQMRAMLMAMRDEENNLRSNL-------GIFKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRG--TEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDI-QKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAV-GMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEAIRGNLT------KIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYF-EGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNELV---PVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLRE---IEGSFP-----NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNA-PFY-KIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIF---GTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKE----------------PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARA--EQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL--------------RGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFH--ALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLD--------EYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFY-----RLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPE-MIDYEGTRKLLALDP-SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNN-ISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHF----RPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSL 4454          

HSP 2 Score: 91.6633 bits (226), Expect = 3.360e-17
Identity = 73/279 (26.16%), Postives = 131/279 (46.95%), Query Frame = 3
Query:  474 GKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKI 1310
            G     + Q V F+R +      EN   + V +  + G+   +  L   +S V +P    +   W      E  R   ++ L  F+  L++ R  +     L +  E       + +D   +V + E + ++E  +  W +QI++VL+  + +    +N+GP  E+++W  R    + +  QL    VK    IL  AKS  L  + ++ ++I D + +A+ N+ FL  L E    L    P  + + +PKLIS +R+I   S +YNT E++T+LF K+
Sbjct:  164 GMPVQTQNQIVYFIRQAPVPITPEN-FEETVQYGTVRGA--YIPALLRLLSGVYVPQIF-MNKSW-----PESIRNHFVSHLHRFLASLTDTRYKLEGHTVLYIPAEA------VQMDPEVVVKDKELVQRLETSMIHWTRQIKEVLSAQESVE-TGENLGPLEEIEFWHNRCMDLSSISKQLVKKGVKHIESILFLAKSSYLTPFRKLAQQIQDGSRQAQSNLTFLSILREPYQELAFMKPKDISEKLPKLISLIRIIWVNSPHYNTRERLTALFRKV 426          

HSP 3 Score: 63.929 bits (154), Expect = 8.554e-9
Identity = 68/294 (23.13%), Postives = 116/294 (39.46%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDV------EAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTG-LNSSLI-IRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWT 2498
            F+  + T++      LD + T + +D++ F   I++L     N +   F+ +      +  L  F RL        E  M+       D+      E  + +   NK+ P +   M   +G+  W R L RRI   M      H  L      +  I  Y ++A+ +        Q W   ++      L+ SL+ I   +   L VNFD  +LIL  E D   +L  E P   +N+  +   L+     L+L+     ++   +  + + L   R+  L + I PGL   NW 
Sbjct:  466 FHKNLQTLRAVRGGILDVKNTSWHEDYNKFRGGIKDLEVMTQNLITSAFELVRDVEHGVLLLDTFHRL-----ATREAIMRTYEKKAVDLYMLFNSELALVNRELNKKWPYLEPYMTQYSGQAHWVRILRRRIDRVMNCLSGAH-FLPHIGTGEESIHTYQQMAQAIDEMVRKTFQEWTATLDKDCIRRLDMSLLRISQEKVGMLDVNFDKTLLILFAEIDYWERLLFETPHYVMNVAERAEDLRILRENLLLVARDYNRIIAMLSPDEQALFKERIRFLDKKIHPGLKKLNWA 753          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 5443.63 bits (14120), Expect = 0.000e+0
Identity = 2707/4664 (58.04%), Postives = 3486/4664 (74.74%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKE-FHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXX---XVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKE---RKTAKQLAAEALQSNE-KDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI------EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++K E+ AKR+ LD RH YL   VA   DL  TEVE++IL+GNQIE +D+ F+      L F++Q+ E E ETG    +G   +   ++ KPKVF+T+G +  L G CV F+R+     I  + I ++V+F +++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV VLS A+ES+ E+V L+ C  ++LK ++ P D + + NN E L K+E C+ +W+KQ EQVLAE++Q+ +EAD++GPRAEL++WKKR++KFNYLL+QLK P+VKA + +L AAKSK LKTW EMD RITDA NEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSEK+TSLFVK+TNQ+I++CKAYI+N+ T ++W    + + +++L   +L + YQ CF +TK +L   P+ +QF+ SEMYIFGKF+TF RRL+ II IF  +KTYSVL D++IEGLE M  K+  IV+TIKKK YNFLDQR+ +F QD+++F +Q  +LHN +  FMD  F  I +T +A++ L++FERLNIP+LGI++KY  IL +YG D++ + K Y++ K DPP+AR+ P IAGKI WARQLF RIQ PM++F+ QH  +L T EAK II++YN++A+ L+ FE+++H+AW+RQI   H GL +SL+++ P T EL+VNFDP ILIL RET+ M ++ LE+ P A +L  K++  K  F N  M++  Y Q+V + IP   EQL+V  +AK+   ++PGL    WTS+ ++ Y+++ +  + +LELLLDR  DL ++RID +LEEMS+  LC+LP + P+T +EF+  T++LC+  A++L  KS  VE++VNEL+NML   E   E +         V    E     ++       + ++  A+  +     + K+    + E A ELL HFNH+N++A++KV RNTLE++RKRI +   + +  S     +K ++ P FR +  L IPNIVM P +E+VQ T+N+    IISV KG+ QWS E   +K  ++    ALQSNE  D D E+G        N  Q  +  A                                 S NL    Q KN YKNV+ENKE+ K+ S+LST INST+KEV T+M  F  Y+H+W K K+  ++ F+   P +SEF+  I  +  LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IF   E+  K+L+R IKDLDDIRIAM ALKEIRE +I ID  + PIEESYA+L RY L + ++E ++VDTL Y W+KL++R  +VQ+ L+++QP F+  LI  V++F +DC +FY DYD +GPM  GL P+EASDRLI+ QN++DN+ R++ITY+GGEELFGL  T Y +L +IKK+LNLLQK+Y+LYN VI +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD TSEII+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG+GHYC +R F   V + V+KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSR+WQG++NT S+VI     LL+LW HEC RV++DR    SD+ WF++ +      EF  +   +V+        TYFVDFLRDAPE   E ++++    PKIYEP+ SF  LKERL+MF + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA YV FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK FP+   T ENL+ YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C+ YF ++RRS  +T KSYLS+I  YK +Y      V  L  RM  GL+KLKEA E++  LSKELE KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKD+  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TI+P+DI+TVR L +PPHLI RIMDCVL+LFQ+K+     D E+     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L +K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W   ++   +P  K +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+ + +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLE+NFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R  L++  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  +A+TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+D+TWLNLV LSKL  FS +++QI  +EK W+ WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL +D+++EL  +I E+  V+  +RLWMT+E H QFPI  LQ++IKF N+PP+G+RA L+R+++ ++QD LD      WK M Y++AFLH TVQERRKFG LGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  +RYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKD+  G  ETRE++V +   +ML+K+P +++PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLAIDG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF ELI+RN+QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT++  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI I+A     +     D + Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVE-EAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATSHGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDYLTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYLLEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYSSDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASIWNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRLAKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEFCKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADIDMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQ-QHPAVLSTAEAKPIIRSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRETECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEY-QRVKSKIPAAIEQLIVPHLAKVDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPLCQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEKISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLSHFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPNIVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVEMGE-------NELQDTLEIA---------------------------------SVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDCFKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTADLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAALKEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKLVSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYRKYITYTGGEELFGLPATQYPQLLEIKKQLNLLQKIYTLYNSVIETVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGDSTSEIIANMEDSLMLLGSLLSNRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDC----GIDTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRDPRFYSCPIYKKPVRTDLNYIAAVDLRTAQTPEHWVLRGVALLCDVK 4624          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 5409.73 bits (14032), Expect = 0.000e+0
Identity = 2688/4653 (57.77%), Postives = 3477/4653 (74.73%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY-DISVKSSAK----PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE MD+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F+RS     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   R+  ++SLE FV +LS A+ S+ E+V L+ C  I+LK ++ P D + + +N E + KVE C+ +W+KQ+EQ+LAE+ Q+R+EAD++GPRAEL++WK+R+++FNYLLDQLK P+VKAA+ +L AAKSK LK W + D RITDAANEAKDNVK+LYTLE+ C PLY ++P  MID IP LI++++M++SIS YYNTSEK+TSLFVK+TNQMI++CKA+I+N+ T T+W+   E +M+++    +L + YQ+CFQETK +L   P E+QF+ SEMYIFGKF+TF RRL+ I+ IF   KTYSVL D+ IEGLE M  K+  IV+ IKKK YNFLDQR  +F QD+++F ++I ELHN++  FMD  F+ I ST +A+ +L++FERLNIP+LGIEEKY  I  ++  D++ + K Y++ K DPP+AR+ P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T EL+VNFDP IL+L RET  M +L L + P A  L  K++  K+  + + +M++  ++V   +P   EQLM   +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+LL  KS  VE++VNELINML   +   E          ++     S ++     +         + +       K+ +  + E A ELL HFNH+N +A++KV RNTLE++R+RI    M+ + D +  S AK    P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++EN              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P + EF+  I  + +LE +INAE +Y   G IAL+T  LK+ L +ETKAW    G+ CN KY+AEME I T  E+ +K+LSR IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPM  GL P+EAS RLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IK++LNLLQK+YSLYN+VI +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + + KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFFIDAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  P+ P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LSKEL  KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q      A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++   +P    +++ E L +   I EWNLQGLPND LS++N IIVT+ASRY L IDPQ+QGK WI NKE+++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG VI  EK+ELE  R  LL+  + NKR++KELED+LL RL +T+GSLVED++L++VL+  K+T+ +V+ ++  + +TE +IN AREEYR ++ RGS+LYFLIT++  VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  ++ +  R LY+  +  FTLLL LK+D++ N V+ EE   L+KGG++LDLK   PKP KWI+DMTWLNLV LSKL  FS +++QI  +EK WR WFDK+ PE+E +P  Y+  LD F++LLLIR WCPDRT+  AR+YI  ++G+++ E V   +     E+D +TPL+ LLS+G+DPT  I    K+  I+   +SMGQGQEVH+R+++ + M  G WVLLQNCHL +D+++EL  V+ E+  V+  +RLW+T+E H QFPI  LQ++IKF NEPP+G+RA L+R++  ++QD LD  V   WK M Y++AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  KK     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF PDF       I   +TVD Y  YI +LP  D+P  FGLH NADI+Y +K  K +L+TIL IQPKDS  G  ETRE++V +   +ML+K+P ++ PF+V E++ KMG FQPMNIFLRQEIDR+ +V+  VR TLT+LKLA+DG ++M++ LRDALDC+FDA+IP  W+K SW S+TLGFWF EL++RN QF  W+++GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D+++L N VT+F  +++  PP EGVY+YGL+LEGA WDKRN +LIE+KPK+L++ +PVI IFA     +     D ++Y  PIYKKP RT+L YIA  +L  +++ EHW++RGVA+LCD+K
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERMDQLFAVGGLRHLMFYYQDVE-GAEAGHCGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFIRSDPSKAITPENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIRQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIIELKSLKEPTDYLALASNPETVEKVECCMRVWIKQMEQILAENSQLRKEADDVGPRAELEHWKQRLSRFNYLLDQLKSPDVKAALALLAAAKSKLLKVWRDTDIRITDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMIDAIPTLINAIKMVYSISHYYNTSEKITSLFVKVTNQMISACKAHITNNGTATIWSQPQEIVMQKIAAVIKLKQGYQSCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHRRLAKIMDIFTTFKTYSVLQDSKIEGLEDMATKYQDIVAAIKKKEYNFLDQREMDFDQDYEEFCKRINELHNDLQRFMDITFEKIPSTRQALSTLKKFERLNIPNLGIEEKYQIIFQNFATDIDTISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTAEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHAGLEASLLVKAPGTGELFVNFDPQILVLFRETQCMSQLGLPVSPFAAALFQKRDMFKKNFSDMKMMLSEYERVKLKMPPAIEQLMFPHLARVDEALQPGLAVLTWTSLNIGGYLENAFAKIKDLELLLDRVNDLIEFRIHAILEEMSSMALCQLPQDDPLTCEEFLQMTKDLCVSGAQLLHFKSSLVEEAVNELINMLLDVDVPPEEAAENVCHENASPSGNTSGRREGHSEALASSFNAGASSLPLTATARKKKETEVLEEARELLSHFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSNDASKAKQNHLPIFRASVTLAIPNIAMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMHERKMAAVKNNEDSDSDAEVEEN-------------ELQETLEIA-----------------------SINLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKRYNHIWQKEKEDTIMTFIAQNPLLPEFESRILYFQSLEQEINAEPEYIRVGSIALYTADLKLSLTAETKAWMAVIGRHCNRKYRAEMENILTVVEESQKKLSRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMASGLKPQEASGRLIIFQNQFDNIYRKYITYTGGEELFGLPVTPYPQLLEIKRQLNLLQKIYSLYNNVIETVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKK-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARDPRLYCCPIYKKPVRTDLNYIAAVDLKTAQAPEHWVLRGVALLCDVK 4621          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 4973.3 bits (12899), Expect = 0.000e+0
Identity = 2518/4658 (54.06%), Postives = 3313/4658 (71.12%), Query Frame = 3
Query:  150 MRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQL---EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSS-AKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++E L EKQ + +E R  ++ ++   H+Y+   + +   L+   VEE ILD   ++    FF      TL F +QE E+    G +    +TG+ +   M  ++++       LKG C+ F+R      IN  TI +DV F  ++ S G+L+G++  +  + LP        WG L   ++ E  +   + ++  ++  L +A  SI   V LK    ID  ++    +     +++E + ++E  + +W KQIEQVL ES+Q+R+EAD+ GP  EL++WK+  AKFN++++Q+K    KA I +L  A SK LK W ++D RITD+ANE+KDNV++LYTLE+ C PLY  +   M   I  LI+++RMIHS+S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++  T  VW  E   ++K++  C  L K YQA F +T+ ++     E+ FE+SEMYIFGKF+ FC+RL  I ++  I++TYS L++++IEG++ +G+KF  I   IKK  Y+ LD RRTEF  DF +F+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP L +E  +   +IL  Y  ++E   K Y   K+DPP+AR+MP IAGKI W RQLFRRI  P+  F  ++ ++L + E K +I+ YN++A  L+ FE+ YH AW ++++     L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A NL   ++ LK     L  ++ Y   +   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  L +     V++ +   +    + A +L  KS++VE++V ELI +     E     +   +   S +E+R  +           +D  + T     +    + +    +   E+   F+H+ L+++ K  R +L+++++RI     V      +S     F +   HL IPN+VM+P+++++Q  +NR   + + VS+G++ W +++   +Q+  ++ Q+N +  D                               SG   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +   ++EFL ++P ++E    I  Y TLE +I         G + L TE +K+ L  E KAW++   +  N +YK +M  + TF  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+Y +L R+E+ V K+E+E VDTLRY++ KL S+   VQ  L+ +QP+F+SNL+E+V++F +D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V+ S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+  SID+I+ +IG G++   R FR  + +MV  L+ ++R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  SS   LL L+ HEC+RV++DR I   D QWF   +   ++++   E         YFVDFLRD PE   +  +D+ F VPKIYE VPSFE L E+L  + + +NE +RG+ ++LVFF DAM H+VKISR+IR   GN LLVGVGGSGKQS+++LASFIA Y  FQIT+TR YN++N +EDLK++Y+ AG E KG  F+FTDNEIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPKEAL+ VA + L D+ +VC    K  +V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK++Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  VKN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+K K  L +DA MCRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  ++   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE+ R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+ +E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W+ WFDKDAPE+E IP GY   LD  +KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D  TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL +++  +      +R+W+T+E HD+FPI  LQ +IKFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  +I +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P N++P +V  ++ KMG    MNIFLRQEIDR+ KVI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GASWD+RNG+L E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:  148 LQETLKEKQARFREARENRKMKIGPSHKYIFEVLGEKLGLDLVTVEELILDCPSLDPFTSFFEKGGCKTLKFLYQEGEV---PGFECGRTITGVPKGGKMM-RIYVDNAAPDKLKGLCLFFVRCRNDVAINSKTIHEDVLFSFLDASKGLLEGIKHMLKSIFLPAILA-TSNWGALNQSKQGESEKHIFIETIHRYLASLDDATISIEGTVMLKKVDNIDFSKLHTFEEVTAAASSSEMVHQLEEVLMVWYKQIEQVLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLKNWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDLVSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGTNHVWDQETPAVLKKIQDCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQGIKKNQYDILDPRRTEFDTDFTEFMGKINILEIQIQAFMNSTFGKILSSQQALQLLQRFQKLNIPCLHLEINHTIERILQCYVAELEFTKKLYLSQKDDPPLARNMPPIAGKILWVRQLFRRINEPINYF-FKNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQGLLQYYDDLCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLMLESFFKEVESVLDMFNQLLKKVNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNETYTKECADILNHKSRHVEEAVKELILIF----EQIYEVKYTGKAAKSVKEQRKRVVFGSEAEETEGLDFESTT----MEVDTNDKEDEFKKECKEVYAFFSHQLLDSLQKATRLSLDTMKRRI----FVGSQGRRRSEDIVSFIKTEVHLAIPNVVMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ--VRQI--KSFQNNSRGSDQPPA---------------------------SGKPLKKEERSF--------EETIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVKEFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYGILNRFEVKVTKEESEGVDTLRYSFNKLQSKAVSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYETEGPMVPNIPPQEASNRLQIFQANFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4731          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 4956.73 bits (12856), Expect = 0.000e+0
Identity = 2481/4554 (54.48%), Postives = 3263/4554 (71.65%), Query Frame = 3
Query:  456 KVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHF--RNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYM--KILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFS-HWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            K++I       LKG C+ F+R      IN  TI ++  F V++ S G+L G+ + ++ + LP     N  G   Q ++ E  +     ++  ++  L  AR SI   V LK    ++  ++    +     +N+E + ++E  + +W KQIEQVL ES+Q+R+EA + GP  EL++WK+  AKFNY+++Q+K P  KA I +L  A SK LK W ++D RITD ANE+KDNV++LYTLE+ C PLY ++   M   I  LI+++RMIH +S+YYNTSE+MTSLF+K+TNQM+T+CKAYI++     VW  E   ++K++  C  L K YQA F +T+  ++    E+ FE+SEMYIFGKF+ FC+RL  I ++  +++TYS L++++IEG++ M +KF  I   +KKK Y+ LD RRTEF  DF DF+ +I  L   I  FM+  F  I S+ +A+Q L+RF++LNIP LG+E  +   +IL +Y  +++A  K Y   K+DPP+AR+MP IAGKI W RQL+RRI  P+  F  ++ ++L +P+ K +I+ YNK++  L+ FE++YH AW+R+I+  H  L ++L +RHPET +L VNFDP IL + RET  M+K+KL++P  A  L   ++ LK     L  ++ Y  ++   +P  +  LM  +M K+  ++  GLT   W+S+ L+ +   V   L     LL +  DL +  ID VL+E++   L  LP      V++ +   +    + A +L  KS++VE++V ELI++      +   +  +   V    E+R  +            + N +      +    + +    +   E+   F+H+ L+++ K  R +L+++++RI   ++  Y          F +   HL IPN+VMIP+++++Q  +NR   + + VS+G++ W +++                              I   +S + +  +      ++G   K  +R+         E+ + A      ++KN Y  VAE+K+++K+  LLS+ +NS RK    A+  F  Y  LW + +D  ++EFL ++P ++E    I  Y T E +I+        G + L TE +K+ L  E KAW++   +  N +YK +M  +  F  +  K+LSR I+DLDD+R AM AL  IR+NEI++DMT+ PIEE+YA+L R+E+ V K+E+E VDTLRY++ KL S+   VQ+ L+ +QP+F+SNL+E+V++F++D   F E Y+  GPMVP +PP+EAS+RL I Q  +D+L R+F+TYS GE+LFGL VTDY  L   +KELNLLQKLY LY+ V++S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G  + EII++MEDSLM+L SLLSNRYN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ +EM+G YSLDKPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F +FNCTLP+ ASID+I+ +IG G++   R F+  +  M+  L+ + R LWQ TK KM PTPSKFHY+FNLRDLSRIWQG++  +++  +S   LL L+ HECSRV++DR I   D QWF  ++   ++++   +         YFVDFLR+ PE   +  +DS F VPKIYE +PSF+ L E+L  + + +NE +RG+ ++LVFF DAM H++KISR+IR   GN LLVGVGGSGKQS++RLASFIA Y  FQIT+TR YN+ N  +DLK++Y+ AG + KG  F+FTD+EIKDE++LEY+NN+L+SG I+ LF+++EMDEI   +   MK+  P+HP T +NLY+YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WP+EAL+ VA + L D+ +VC   +K ++V+ + + H  V  +C  YF +YRR   +T KSYLS+I+ YK +Y      ++   ERM  GL KL EA E++  LS++L +KE+ L+VAS +A+ VLA VT    A+  +KN+V+ VKDK   IV++I  ++  AE KL AAKPAL+EAE ALNTIKPNDI+TVRKL KPPHLI RIMDCVL+LFQKKIDP   D E+   K SW ESLKL+++T FL SL  FP+D INEE ++LLQPYF  +DY  E+A+K CGNVAGL +WT AM  FY +NREV+PLK +LA Q   LA A  +L  A+ +L EK+  L  V+ ++D A+  K  L +DA  CRKKM  A+ L++GL  EK RWT QS EF++QI  LVGD+++ + F+SY GPFNQ FR  +    WE  +R   +P  + ++++  L +P  IGEW LQGLP D LS++N IIVT+A+RY L IDPQ+QGK WI +KE E+ +  T+  +KYF+ HLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK GT  KVKVGDKE DI   F LYITTKL NP F+PEI AKTSVIDF+VTMKGLE+QLL  VI  EK+ELE  R +LL+  + NKRK+KELED+LL +L+ T+GSLV+D++L+ VL   KQT+ +VS ++  AA+TE +IN A+EE+R  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  SEKSP  Q+RI +II  +T  ++ + VR LY+  +  F LL+ LK+D++  +V+  E   L+KGG+ALDLK   PKP +WI+DMTWLNLV LSKL  F+ ++ QI  +EK W++WFDKDAPE+E IP GY   LD   KLLLIR WCPDRT+  AR+YI  +L + + E V   +     E+D +TPL+  LS+G+DPT  I+  AKK  ++  TISMGQGQEVH+R++I  +MQ+G WVLLQNCHL ++++ EL + +  +   +  +R+W+T+E HD+FPI  LQ ++KFTNEPP+G+RA L+R+FA + QD LD   +  WK M Y++AFLH TVQERRKFGPLGWNIPYEFN ADF+A   FIQNHLD    KK     G+ W  VRYMI E+QYGGRVTDDFD RLL    + +F E MF+P F      KI +  T+D+Y  YI +LP+ DNP  FGLH NADI+Y + T   +LETI +IQPK+S  G GETRE+IVY+   +ML K+P ++IP +V  ++ KMG    MNIFLRQEIDR+ +VI  +R +L+DLKLAI+G ++M++ LRDALD ++DA+IP +W+++SW+S+TLGFWF EL++RN QF  W+ +GRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA D+V + N V R   EE+  PP EGVYIYGL+++GA+WD+RNG+L+E+ PK+L+  LPV++IFA+         +D K+Y+ PIYKKPRRT+LT+I    L    S +HWI+RGVA+LCDIK
Sbjct:    3 KLYIDNAAPDKLKGLCIFFVRCRNDVAINVKTIQEEALFTVLDASKGLLNGIRDMLANIFLPAVLATNNWGALNQSKQGESEKHIFTETINRYLSFLDGARISIEGTVKLKTIDNVNFSKLHTFEEVTAAASNSETVHQLEEVLMVWYKQIEQVLIESEQMRKEAGDSGPLTELEHWKRMSAKFNYIIEQIKGPSCKAVINVLNVAHSKLLKNWRDLDARITDTANESKDNVRYLYTLEKVCQPLYNHDLVSMAHGIQNLINAIRMIHGVSRYYNTSERMTSLFIKVTNQMVTACKAYITDGGLNHVWDQETPVVLKKIQDCIFLFKEYQASFHKTRKLISESSGEKSFEVSEMYIFGKFEAFCKRLEKITEMITVVQTYSTLSNSTIEGIDIMAIKFRNIYQGVKKKQYDILDPRRTEFDTDFLDFMTKINGLEVQIQAFMNSSFGKILSSQQALQLLQRFQKLNIPCLGLEINHTIERILQYYVAELDATKKLYHSQKDDPPLARNMPPIAGKILWVRQLYRRISEPINYF-FKNSDILSSPDGKAVIRQYNKISYVLVEFEVVYHTAWIREISQLHYALQATLFVRHPETGKLLVNFDPKILEVVRETKCMIKMKLDVPEQAKRLLKLESKLKADKLYLQGLLQYYDELCQEVPSVFVNLMTPKMKKVESVLRQGLTVLTWSSLTLESFFQEVELVLDMFNQLLKKISDLCEMHIDTVLKEIAKTVLISLPESGATKVEDMLTLNETYTKEWADILNHKSKHVEEAVRELISIF-----EQIYEVKYTGKVGKQSEQRKHVVFGSETGEG---ENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLDTMKRRIFVASL--YGRKQSEDIISFIKSEVHLAIPNVVMIPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQ------------------------------IRPIKSVIPSPTTTDVTHQNTGKLLKKEERSF--------EEAIPAR-----KLKNFYPGVAEHKDISKLVLLLSSSVNSLRKAAHEALQDFQKYKTLWTEDRDVKVKEFLANNPSLTEIRSEILHYATFEQEIDELKPIIVVGALELHTEPMKLALSIEAKAWKMLLCRYLNEEYKKKMSYMIAFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIEEAYAILNRFEVEVTKEESEAVDTLRYSFNKLQSKAVSVQEDLVQVQPKFKSNLLESVEVFREDVINFAEAYELEGPMVPNIPPQEASNRLQIFQASFDDLWRKFVTYSSGEQLFGLPVTDYEVLHKTRKELNLLQKLYGLYDTVMSSISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAASCILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK-----GVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAI----NSTAPKDPKLYVCPIYKKPRRTDLTFITVVYLRTVLSPDHWILRGVALLCDIK 4490          
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 4071.16 bits (10557), Expect = 0.000e+0
Identity = 2029/3492 (58.10%), Postives = 2622/3492 (75.09%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS-----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNE---RTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQ 10619
            ++KEE+ AKR+RLD RH YL   VA   DL   EVE+++L+GNQIE +D+ F+      L F++Q+ E   E G     G       ++ KPKVF+T+GK+  L G CV F R+     I    I ++V+F  ++ ++G +L  +   +S + +P  R    GWG+LE  +D+   ++  ++SLE FV +LS A+ S+ E+V L+ C  ++LK ++ P+D + + +N E + KVE C+ +W+KQ+EQ+LAE++Q+R+EAD++GPRAEL++WKKR++KFNYLLDQLK P+VKA + +L AAKSK LK W + D R+TDAANEAKDNVK+LYTLE+ C PLY ++P  M+D IP LI++++MI+SIS YYNTSE++TSLFVK+TNQMI++CKA+I+N+ T T+W+   + +M+++    +L + YQ CFQETK +L   P E+QF+ SEMYIFGKF+TF +RL+ I+ IF   KTYSVL D+ IEGLE M  K+  +V+ IKKK YNFLDQR+ +F QD+D+F +Q  ELH+ +  FMD  F+ I ST +A+ +L++FERLNIP+LGIE KY  +  ++G D++ + K Y++ K DPP+ARD P IAGKI WARQLF R++ PM++F+ QH  +L+T EAK +I++YN++A+ L+ FE++YH+AW++QI   H GL +SL+++ P T +L+VNFDP ILIL RET  M ++ L + P A  L  K++  K+  + + +M++  Q+V   +P   EQLM+  +A++   ++PGL    WTS+ +  Y+++ +  + +LELLLDR  DL ++RI  +LEEMS++ LC+LP D P+T +EF+  T++LC+  A+ L  KS  VE++VNELINML   +   E          ++     S        +         + +       K+ +  + E A ELL +FNH+N +A++KV RNTLE++R+RI    M+ +  S     VK +  P FR +  L IPNI M P +E++Q T+N+    IISV KG+ QWS E  + +++    + + + +ED +    ++E+              + E L  +                       S NL    Q +N YKN+++NKE+ K+ S+LST I+ST+KEV T+M RF  Y+H+W K K+ T+  F+  +P +SEF+  I  + +LE +INAE +Y   G IAL+T  LK  L +ETKAW +  G+ CN KY++EME IFT  E+ +K+L+R IKDLDDIRIAM ALKEIRE +I  D  + PIEESYA+L +Y L V K+E ++VDTLRY W+KL++R S VQ+ L  +QP FR  LI  V++F +DC +FY DYD +GPMV GL P+EASDRLII QN++DN+ R++ITY+GGEELFGL VT Y +L +IKK+LNLLQK+YSLYN+VI +VN Y D LW +V+IEKI++EL EFQNRCRKLP+ LKDW AF D++KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+E PLLK+KEEIEDICISAVKE+DIE KLK V  EW    L F +FK RGELLLRGD TSE+I+ MEDSLM+L SLLSNRYN+PFK  IQ+ V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I ++ F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+ TDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT+CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  +  +   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D  DTMFDY V+ +G W HW+  + EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE H  K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQ +E  GFY+L+KPG+F S++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ AS+D+I+ VIG G+YC +R F   V + V KL+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG++N  S+VI  + +LLRLW HEC RV++DR    SD+ WF++ +   L + E  E + P  +     YFVDFLRDAPE   E  +++   +PK+YEP+ S   L+ERLS+F + YNE++RG+ +++VFF DAM+H+VKISRVIR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN +N +EDLK +YR AG++ KG  F+FTDNEIK+ES+LEY+NN+L+SG ++ LF+++E+DEI S +   MKK  PK P T +NLY+YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCTI+WF +WPK+ALV V++H L  + + C   +K+++V  +      V   C  YF ++RRS  +T KSYLS+I  YK +Y+     V  L  RM  GL+KLKEA E++  LS+EL +KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +AEEKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LF ++++    D ++     SW ESLKL+ + NFL +L  FP+D INEE+I+ L PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q    A A  DLQ A+  L +K+  L +V+ EY+ A+  KQ
Sbjct:   21 RLKEEKEAKRARLDGRHDYLFAIVASCLDLNKPEVEDALLEGNQIERIDQLFAVGGLRHLMFYYQDVE-GAEAGQFGSSGGVNPASGKMKKPKVFVTEGKDVALMGACVFFTRADPSKAITAENIHREVSFNTLDTADGGLLNSVRRLLSDIFIPALRASSHGWGELEGLQDASSIQQEFLSSLEGFVGILSGAQNSLKEKVNLQKCDIVELKSLKEPMDYLALASNPETVEKVECCMRVWIKQMEQILAENNQLRKEADDVGPRAELEHWKKRLSKFNYLLDQLKSPDVKAVLAMLAAAKSKLLKVWRDADIRVTDAANEAKDNVKYLYTLEKCCDPLYSSDPVTMVDAIPTLINAIKMIYSISHYYNTSERITSLFVKVTNQMISACKAHITNNGTATIWSQPQDIVMQKIAAAIKLKQGYQCCFQETKQKLKQNPSEKQFDFSEMYIFGKFETFHQRLAKIMDIFTTFKTYSVLQDSKIEGLEDMVTKYQDVVAGIKKKEYNFLDQRKMDFDQDYDEFCKQTNELHSELQRFMDTTFEKIQSTRQALSTLKKFERLNIPNLGIEAKYQIVFQNFGTDIDMISKLYTKQKYDPPLARDQPPIAGKILWARQLFHRLEQPMQLFQ-QHPFVLRTVEAKPVIRSYNRIAKVLLEFEVLYHRAWLQQIEEIHVGLEASLLVKAPGTGQLFVNFDPQILILFRETQCMSQMGLPVSPFAAALFEKRDMYKKNFSDMKMMLSEYQRVKLKMPPAIEQLMLPHLARVDEALQPGLAVLTWTSLNIGTYLENAFEKIKDLELLLDRINDLIEFRIHAILEEMSSVALCQLPQDDPLTCEEFLQMTKDLCVNGAQKLHFKSSLVEEAVNELINMLLDVDVLPEEASEKVRHENASPNGDTSGGGEGCAEALASSFNAGTSSLPLTTIARKKKEMEVLEEARELLSYFNHQNTDALLKVTRNTLEAIRRRIHFSHMINFRDSKGASKVKQNHLPIFRASVTLAIPNISMTPALEDIQQTLNKAVECIISVPKGVRQWSSELLSKRKMRERKMAAVQSNEDSDSDTEVEES-------------ELQETLELA-----------------------SVNLPIPVQTQNYYKNISDNKEIVKLVSVLSTVISSTKKEVITSMDRFKCYNHIWQKEKEDTIMTFIAQNPLLSEFESRILYFQSLEQEINAEPEYICVGSIALYTADLKFSLTAETKAWMMVLGRHCNRKYRSEMENIFTVVEEFQKKLNRPIKDLDDIRIAMAALKEIREQQISTDFQVGPIEESYALLNKYGLLVAKEEMDKVDTLRYAWEKLLARASDVQNELGALQPSFRKELISTVEVFLQDCQQFYLDYDLNGPMVSGLKPQEASDRLIIFQNQFDNIYRKYITYTGGEELFGLPVTQYPQLLEIKKQLNLLQKIYSLYNNVIETVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFSSFKTRGELLLRGDSTSEVIASMEDSLMLLGSLLSNRYNMPFKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQ--AGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDPGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAVIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAV-VSLVEEEFGEEKTPVVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQ 3470          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A267H528 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018625g1 PE=4 SV=1)

HSP 1 Score: 6044.92 bits (15681), Expect = 0.000e+0
Identity = 2968/4660 (63.69%), Postives = 3643/4660 (78.18%), Query Frame = 3
Query:  132 RVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKG-GWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-EFCLDD--SEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDI 14099
            RV  L   EN+ EKQ K+KEER A+R RLDERH +LL QVADFY +E +EVE+ ILDGN ++ M+ FF++  T  +  H+QEP+L+KE  DQIRIG  G K +R  KP++F++ G  AP++G C VFMR      + E  I++DV F  I+GS+G+L+G+E+ +S V++P  R L+G GWGQLE  E +R   +N LENFV +L+ A+E+IN+RV LK CT  DLKR++   D     +  + L  VE C   W+KQIEQVLAE++QIRREADN+GPRAELDYWK+RMAKFNYLLDQLK  +VK  +G+L AAKSK+LKTW EMDRRITD ANEAKDNVKFLYTL+EHC PLY ++P  M+D IPKLI+ +RMIHSIS+YYNTSE+MTSLFVK+TNQMIT+CK+YIS   +ET+W+    +++ +L  C  LN+ YQACFQ TK +L   P E++FE SEMYIFGKFDTFCRRL  II++F+ ++ ++ L+D+ IEG+E M  KFNVIV  +KKK Y+FLDQRRT+F  DF+DF RQIQEL  +I  FMD  F+ +TS+ RAIQ+L+RFERL IP LGI+EKY KIL  YG+++EA ++ Y++NK+DPP+ARD+P I GKI WARQLFRRI+ PM +F+ +  +LL++ + K ++KNYNKLAE L++FE++YH+AW++Q+ +   GL +SL++RHPE+K L+VN DP+IL L RET++M++L +++P AA +L+ +Q  +K  +++L  ++    +V +++PQEYE LM  R+ +LRR +EPGLT+ NW S+    YI  V   + ELELLL RA+DLR++RID VLEEM+ ++LCELP+  P T+D FV  TQ LC K A+LLQ KS NVE++VNELINML GEE                 ++R  +    S+  +  ++           ++ K+ K  I EAA ELL HFNHRN++AIVKV +NTLE+LRKRI+A T+++YD    ++ +PFFRC A L IP + M P  EEVQ  VN++ Y IISVSKG+SQWSKERKT +    E    +E+D D +  V    +   R     S A +   G SD  T R   +   G       E+G S       Q  N +K+V+ENKEVAK+ SLLS  INS +K V++AM RF  Y ++W + ++  L+EF++  P++ E++  I ++   E  INAE   YDCGPIA+FTE LK+GLL+ETKAWR+ +G++CN+KYK+EME  F F +D+EK+LSR IKDLDDIRIAM ALK+IRENEIRIDM I+PIEESYAML +++LPV K+E ERVDTLRYTW+KL + G +VQ++L+TIQ +FR NL+  V +FK+DC  FY DY  SGPMVPG+PPREASDRL+I QNR+DNL R+FITY+GGEELFGL V++Y +L  IKKELNLL KLYSLYNDVIN+VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDHT EIIS MEDSLM+LSSLLSNRYN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  ++++L+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT SDV+     +  LW HEC RV+SDR     D+ WF R +    ++D   EV +  +P +   YFVDFLRDAPE   +  DD+ F +P++YEP+P+F+ L ERL  F   YNE +RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN+ N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  FPLVC D VK+ ++  + V+H  V  +C +YFN+YRRS  +T KSYLS++  YK +Y+        L  RM +GL+KL EAQE++ +LS+EL +KE+ L VA+ EAE VL  V  Q  AA+ +KN+V+ VKD+  AIV+ I  D+ +AE KL AAKPAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVLILFQ+++D   PD ER  VK SW ESLKL+++T FL+ L  F +D +NEE I+ L PY   EDY+LE A++ CGNVAGL +WTKAM++F+W+N+EV+PLKD+LA Q + L KA DDL +A+  L EKE  LA V+  Y+ A+++KQALE DAA CR+KMS A QL+ GL DEK RWT QS E++SQIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  +++  +P ++ ++++E L     I EWNLQGLPND+LS EN IIVTQASRY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+LY+TTKL NP ++PE+YA+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A DT+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W + VR LY+ D+ TFTLLL LK+DM    V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI  SEK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRT+  A+RYI  +LG+ F E V   + ++  E++ +TP++GLLS+G+DPT  IE  AKKH  +   ISMGQGQE+H+RR+++ ++Q G WVLLQNCHL +DY+ E+   + E+  V+  + LW+T E H +FPI+FLQ +IKFTNEPP+G++A L+R+F   TQD+LD   +  W+ M Y +AFLH  VQERRKFGP+GWNIPYEFN AD NA   F+QNHLD +  KK     G++W  VRYM+SEIQYGGRVTDD+D  LL    K +F E MF+P F       I  F  ++EY  YI NLP  D P  FGLH NADISY  +TTK IL+ ILSIQPKDS  G GETRES+VYKQ  ++L+K+P +++PF+V E++ KMG  QPMNIFLRQE+DR+ +VI  VR TLTDLKLAIDG ++MN+ LRDALD ++DAKIP +W KISW+S+ LGFWF ELI+RN QF  W+  GRP CFW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VT+    ++  PP EGVY++GLFLEGA WD+RN RL EA+ KIL + LPV++I+A+         +D K+Y+ PIYKKPRRT+LTY+A  +L  S+ A+HW++RGVA+LCD+
Sbjct:   21 RVSVLTSGENIKEKQQKLKEEREARRHRLDERHHHLLAQVADFYCIEKSEVEDGILDGNNVDQMELFFAAGGTCKILVHYQEPDLDKEGPDQIRIGQPGSKSTRAQKPRIFVSDGSSAPIRGPCAVFMRPDSQQAVTEANISRDVTFFSIDGSDGILRGVEQVLSTVLVPQLRELQGSGWGQLECQEHAREQFLNGLENFVNMLNTAQETINDRVVLKPCTGFDLKRLKTITDINQAASQADSLAAVEECAASWMKQIEQVLAETEQIRREADNVGPRAELDYWKRRMAKFNYLLDQLKSNDVKQVLGVLNAAKSKSLKTWFEMDRRITDNANEAKDNVKFLYTLDEHCMPLYHSDPVKMVDMIPKLINGIRMIHSISRYYNTSERMTSLFVKVTNQMITACKSYISQGGSETIWSQPTADVISQLKDCIRLNEEYQACFQRTKQKLEQMPGEKRFEFSEMYIFGKFDTFCRRLKKIIEMFQTMELFAHLSDSKIEGMEMMAAKFNVIVVGLKKKPYDFLDQRRTDFDNDFEDFKRQIQELQGSIQGFMDSRFEKLTSSQRAIQTLKRFERLKIPRLGIDEKYQKILAFYGKELEAAVRIYNKNKDDPPIARDLPPIGGKICWARQLFRRIEEPMVLFK-KMPHLLQSADGKKLVKNYNKLAEALVAFEMLYHRAWIKQLQTAQDGLKASLLVRHPESKRLFVNLDPEILTLIRETELMVRLGMDVPLAAQHLRARQATIKRHYDELNSLLEDYSRVLSTVPQEYEPLMGPRLGRLRRALEPGLTSLNWMSLATDSYIRDVRADMCELELLLARAKDLREFRIDRVLEEMANVRLCELPDSEPWTIDSFVERTQSLCQKGAQLLQVKSVNVEEAVNELINMLVGEEL--------------DDDDRSEMGAEESEERQREVESAGERPAQLGGRRKKDEKEQIEEAAMELLNHFNHRNMDAIVKVTKNTLEALRKRISASTLISYD-KAANTQRPFFRCFATLSIPQVAMHPTTEEVQQCVNKSCYCIISVSKGVSQWSKERKTTR----EKFSYDEEDFDFDGEVTTARSDARRPSIAASVAHTDISGQSDGATSRAGFRSHRGRTES---EEGTS-QYAVQMQANNYFKSVSENKEVAKLASLLSAAINSQKKAVQSAMERFYIYRYIWEQNREEALQEFVQQSPRLGEYEAKILDFEQKEETINAEPPSYDCGPIAIFTERLKLGLLTETKAWRLMFGRSCNLKYKSEMEDFFAFMDDIEKKLSRPIKDLDDIRIAMAALKDIRENEIRIDMGISPIEESYAMLFKHDLPVPKEEAERVDTLRYTWEKLRAHGIEVQNHLVTIQTDFRDNLVHEVVVFKQDCADFYSDYGGSGPMVPGVPPREASDRLVIFQNRFDNLHRKFITYTGGEELFGLPVSEYPELHKIKKELNLLTKLYSLYNDVINTVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDHTGEIISFMEDSLMVLSSLLSNRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEVGKLVEPTH---YFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKK-----GVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAI-----NGPTKDEKLYVCPIYKKPRRTDLTYVAAIKLRTSQPADHWVIRGVALLCDV 4639          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A1I8J1U1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 6032.98 bits (15650), Expect = 0.000e+0
Identity = 2960/4644 (63.74%), Postives = 3634/4644 (78.25%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKG-GWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-EFCLDD--SEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDI 14099
            K+KEER A+R RLDERH +LL QVADFY +E +EVE+ ILDGN ++ M+ FF++  T  +  H+QEP+L+KE  DQIRIG  G K +R  KP++F++ G  AP++G C VFMR      + E  I++DV F  I+GS+G+L+G+E+ +S V++P  R L+G GWGQLE  E +R   +N LENFV +L+ A+E+IN+RV LK CT  DLKR++   D     +  + L  VE C   W+KQIEQVLAE++QIRREADN+GPRAELDYWK+RMAKFNYLLDQLK  +VK  +G+L AAKSK+LKTW EMDRRITD ANEAKDNVKFLYTL+EHC PLY ++P  M+D IPKLI+ +RMIHSIS+YYNTSE+MTSLFVK+TNQMIT+CK+YIS   +ET+W+    +++ +L  C  LN+ YQACFQ TK +L   P E++FE SEMYIFGKFDTFCRRL  II++F+ ++ ++ L+D+ IEG+E M  KFNVIV  +KKK Y+FLDQRRT+F  DF+DF RQIQEL  +I  FMD  F+ +TS+ RAIQ+L+RFERL IP LGI+EKY KIL  YG+++EA ++ Y++NK+DPP+ARD+P I GKI WARQLFRRI+ PM +F+ +  +LL++ + K ++KNYNKLAE L++FE++YH+AW++Q+ +   GL +SL++RHPE+K L+VN DP+IL L RET++M++L +++P AA +L+ +Q  +K  +++L  ++    +V +++PQEYE LM  R+ +LRR +EPGLT+ NW S+    YI  V   + ELELLL RA+DLR++RID VLEEM+ ++LCELP+  P T+D FV  TQ LC K A+LLQ KS NVE++VNELINML GEE                 ++R  +    S+  +  ++           ++ K+ K  I EAA ELL HFNHRN++AIVKV +NTLE+LRKRI+A T+++YD    ++ +PFFRC A L IP + M P  EEVQ  VN++ Y IISVSKG+SQWSKERKT +    E    +E+D D +  V    +   R     S A +   G SD  T R   +   G       E+G S       Q  N +K+V+ENKEVAK+ SLLS  INS +K V++AM RF  Y ++W + ++  L+EF++  P++ E++  I ++   E  INAE   YDCGPIA+FTE LK+GLL+ETKAWR+ +G++CN+KYK+EME  F F +D+EK+LSR IKDLDDIRIAM ALK+IRENEIRIDM I+PIEESYAML +++LPV K+E ERVDTLRYTW+KL + G +VQ++L+TIQ +FR NL+  V +FK+DC  FY DY  SGPMVPG+PPREASDRL+I QNR+DNL R+FITY+GGEELFGL V++Y +L  IKKELNLL KLYSLYNDVIN+VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDHT EIIS MEDSLM+LSSLLSNRYN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  ++++L+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT SDV+     +  LW HEC RV+SDR     D+ WF R +    ++D   EV +  +P +   YFVDFLRDAPE   +  DD+ F +P++YEP+P+F+ L ERL  F   YNE +RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN+ N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  FPLVC D VK+ ++  + V+H  V  +C +YFN+YRRS  +T KSYLS++  YK +Y+        L  RM +GL+KL EAQE++ +LS+EL +KE+ L VA+ EAE VL  V  Q  AA+ +KN+V+ VKD+  AIV+ I  D+ +AE KL AAKPAL+ AE+ALNTIKP DI+TVRKL KPPHLI RIMDCVLILFQ+++D   PD ER  VK SW ESLKL+++T FL+ L  F +D +NEE I+ L PY   EDY+LE A++ CGNVAGL +WTKAM++F+W+N+EV+PLKD+LA Q + L KA DDL +A+  L EKE  LA V+  Y+ A+++KQALE DAA CR+KMS A QL+ GL DEK RWT QS E++SQIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  +++  +P ++ ++++E L     I EWNLQGLPND+LS EN IIVTQASRY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+LY+TTKL NP ++PE+YA+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A DT+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W + VR LY+ D+ TFTLLL LK+DM    V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI  SEK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRT+  A+RYI  +LG+ F E V   + ++  E++ +TP++GLLS+G+DPT  IE  AKKH  +   ISMGQGQE+H+RR+++ ++Q G WVLLQNCHL +DY+ E+   + E+  V+  + LW+T E H +FPI+FLQ +IKFTNEPP+G++A L+R+F   TQD+LD   +  W+ M Y +AFLH  VQERRKFGP+GWNIPYEFN AD NA   F+QNHLD +  KK     G++W  VRYM+SEIQYGGRVTDD+D  LL    K +F E MF+P F       I  F  ++EY  YI NLP  D P  FGLH NADISY  +TTK IL+ ILSIQPKDS  G GETRES+VYKQ  ++L+K+P +++PF+V E++ KMG  QPMNIFLRQE+DR+ +VI  VR TLTDLKLAIDG ++MN+ LRDALD ++DAKIP +W KISW+S+ LGFWF ELI+RN QF  W+  GRP CFW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VT+    ++  PP EGVY++GLFLEGA WD+RN RL EA+ KIL + LPV++I+A+         +D K+Y+ PIYKKPRRT+LTY+A  +L  S+ A+HW++RGVA+LCD+
Sbjct:    2 KLKEEREARRHRLDERHHHLLAQVADFYCIEKSEVEDGILDGNNVDQMELFFAAGGTCKILVHYQEPDLDKEGPDQIRIGQPGSKSTRAQKPRIFVSDGSSAPIRGPCAVFMRPDSQQAVTEANISRDVTFFSIDGSDGILRGVEQVLSTVLVPQLRELQGSGWGQLECQEHAREQFLNGLENFVNMLNTAQETINDRVVLKPCTGFDLKRLKTITDINQAASQADSLAAVEECAASWMKQIEQVLAETEQIRREADNVGPRAELDYWKRRMAKFNYLLDQLKSNDVKQVLGVLNAAKSKSLKTWFEMDRRITDNANEAKDNVKFLYTLDEHCMPLYHSDPVKMVDMIPKLINGIRMIHSISRYYNTSERMTSLFVKVTNQMITACKSYISQGGSETIWSQPTADVISQLKDCIRLNEEYQACFQRTKQKLEQMPGEKRFEFSEMYIFGKFDTFCRRLKKIIEMFQTMELFAHLSDSKIEGMEMMAAKFNVIVVGLKKKPYDFLDQRRTDFDNDFEDFKRQIQELQGSIQGFMDSRFEKLTSSQRAIQTLKRFERLKIPRLGIDEKYQKILAFYGKELEAAVRIYNKNKDDPPIARDLPPIGGKICWARQLFRRIEEPMVLFK-KMPHLLQSADGKKLVKNYNKLAEALVAFEMLYHRAWIKQLQTAQDGLKASLLVRHPESKRLFVNLDPEILTLIRETELMVRLGMDVPLAAQHLRARQATIKRHYDELNSLLEDYSRVLSTVPQEYEPLMGPRLGRLRRALEPGLTSLNWMSLATDSYIRDVRADMCELELLLARAKDLREFRIDRVLEEMANVRLCELPDSEPWTIDSFVERTQSLCQKGAQLLQVKSVNVEEAVNELINMLVGEEL--------------DDDDRSEMGAEESEERQREVESAGERPAQLGGRRKKDEKEQIEEAAMELLNHFNHRNMDAIVKVTKNTLEALRKRISASTLISYD-KAANTQRPFFRCFATLSIPQVAMHPTTEEVQQCVNKSCYCIISVSKGVSQWSKERKTTR----EKFSYDEEDFDFDGEVTTARSDARRPSIAASVAHTDISGQSDGATSRAGFRSHRGRTES---EEGTS-QYAVQMQANNYFKSVSENKEVAKLASLLSAAINSQKKAVQSAMERFYIYRYIWEQNREEALQEFVQQSPRLGEYEAKILDFEQKEETINAEPPSYDCGPIAIFTERLKLGLLTETKAWRLMFGRSCNLKYKSEMEDFFAFMDDIEKKLSRPIKDLDDIRIAMAALKDIRENEIRIDMGISPIEESYAMLFKHDLPVPKEEAERVDTLRYTWEKLRAHGIEVQNHLVTIQTDFRDNLVHEVVVFKQDCADFYSDYGGSGPMVPGVPPREASDRLVIFQNRFDNLHRKFITYTGGEELFGLPVSEYPELHKIKKELNLLTKLYSLYNDVINTVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDHTGEIISFMEDSLMVLSSLLSNRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEVGKLVEPTH---YFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKK-----GVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAI-----NGPTKDEKLYVCPIYKKPRRTDLTYVAAIKLRTSQPADHWVIRGVALLCDV 4604          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: A0A1I8FY30 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 5884.29 bits (15264), Expect = 0.000e+0
Identity = 2900/4645 (62.43%), Postives = 3552/4645 (76.47%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKG-GWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEP----VPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDI 14099
            K+KEER A+R RLDERH +LL QVADFY +E +EVE+ ILDGN ++ M+ FF++  T  +  H+QEP+L+KE  DQIRIG  G K +R  KP++F++ G  AP++G C VFMR      + E  I++DV F  I+GS+G+L+G+E+ +S V++P  R L+G GWGQLE  E +R   +N LENFV +L+ A+E+IN+RV LK CT  DLKR++   D     +  + L  VE C   W+KQIEQVLAE++QIRREADN+GPRAELDYWK+RMAKFNYLLDQLK  +VK  +G+L AAKSK+LKTW EMDRRITD ANEAKDNVKFLYTL+EHC PLY ++P  M+D IPKLI+ +RMIHSIS+YYNTSE+MTSLFVK+TNQMIT+CK+YIS   +ET+W+    +++ +L  C  LN+ YQACFQ TK +L   P E++FE SEMYIFGKFDTFCRRL  II++F+ ++ ++ L+D+ IEG+E M  KFNVIV  +KKK Y+FLDQRRT+F  DF+DF RQIQEL  +I  FMD  F+ +TS+ RAIQ+L+RFERL IP LGI+EKY KIL  YG+++EA ++ Y++NK+DPP+ARD+P I GKI WARQLFRRI+ PM +F+ +  +LL++ + K ++KNYNKLAE L++FE++YH+AW++Q+ +   GL +SL++RHPE+K L+VN DP+IL L RET++M++L +++P AA +L+ +Q  +K  +++L  ++    +V +++PQEYE LM  R+ +LRR +EPGLT+ NW S+    YI  V   + ELELLL RA+DLR++RID VLEEM+ ++LCELP+  P T+D FV  TQ LC K A+LLQ KS NVE++VNELINML GEE                 ++R  +    S+  +  ++           ++ K+ K  I EAA ELL HFNHRN++AIVKV +NTLE+LRKRI+A T+++YD    ++ +PFFRC A L IP + M P  EEVQ  VN++ Y IISVSKG+SQWSKERKT +    E    +E+D D +  V    +   R     S A +   G SD  T R   +   G       E+G S       Q  N +K+V+ENKEVAK+ SLLS  INS +K V++AM RF  Y ++W + ++  L+EF++  P++ E++  I ++   E  INAE   YDCGPIA+FTE LK+GLL+ETKAWR+ +G++CN+KYK+EME  F F +D+EK+LSR IKDLDDIRIAM ALK+IRENEIRIDM I+PIEESYAML +++LPV K+E ERVDTLRYTW+KL + G +VQ++L+TIQ +FR NL+  V +FK+DC  FY DY  SGPMVPG+PPREASDRL+I QNR+DNL R+FITY+GGEELFGL V++Y +L  IKKELNLL KLYSLYNDVIN+VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDHT EIIS MEDSLM+LSSLLSNRYN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQ +E  GFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+  SID+I+SVIG GHYC+ER F   V  ++++L+ LTR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQG+INT SDV+     +  LW HEC RV+SDR     D+ WF R +      S VV                           +D    V K+ EP    +P+F+ L ERL  F   YNE +RG+ ++LVFF DAM H+VKISR+I   +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN+ N +EDLK +YR AG++ KG  F+FTDNEIKDES+LEY+NN+LASG+++ LF ++EMDEI   +   MKK FP+ P T ENL +YFL R R NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ+WP++ALV VA H L  FPLVC D VK+ ++  + V+H  V  +C +YFN+YRRS  +T KSYLS++  YK +Y+        L  RM +GL+KL EAQE                              +    A EA +  + T+K    A V K                                       L KPPHLI RIMDCVLILFQ+++D   PD ER  VK SW ESLKL+++T FL+ L  F +D +NEE I+ L PY   EDY+LE A++ CGNVAGL +WTKAM++F+W+N+EV+PLKD+LA Q + L KA DDL +A+  L EKE  LA V+  Y+ A+++KQALE DAA CR+KMS A QL+ GL DEK RWT QS E++SQIG LVGD+++ +AF+SY GPFNQ FRL +  +W+  +++  +P ++ ++++E L     I EWNLQGLPND+LS EN IIVTQASRY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G PL+IEDI EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F+LY+TTKL NP ++PE+YA+TS+IDF+VTMKGLEDQLLG VI  EK ELE  R QL++  +NN + +K LED+LL RL +T+GSLV+D+ L+ VL + K TS DV  +I  A DT+ +I  AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  +W + VR LY+ D+ TFTLLL LK+DM    V+ EE   L+KGG++LDL  + PKP KWI+D TWLNLV LS LH FSG+++QI  SEK W+ WFDK+APE+E IP GY   LD F++LLLIR WCPDRT+  A+RYI  +LG+ F E V   + ++  E++ +TP++GLLS+G+DPT  IE  AKKH  +   ISMGQGQE+H+RR+++ ++Q G WVLLQNCHL +DY+ E+   + E+  V+  + LW+T E H +FPI+FLQ +IKFTNEPP+G++A L+R+F   TQD+LD   +  W+ M Y +AFLH  VQERRKFGP+GWNIPYEFN AD NA   F+QNHLD +  KK     G++W  VRYM+SEIQYGGRVTDD+D  LL    K +F E MF+P F       I  F  ++EY  YI NLP  D P  FGLH NADISY  +TTK IL+ ILSIQPKDS  G GETRES+VYKQ  ++L+K+P +++PF+V E++ KMG  QPMNIFLRQE+DR+ +VI  VR TLTDLKLAIDG ++MN+ LRDALD ++DAKIP +W KISW+S+ LGFWF ELI+RN QF  W+  GRP CFW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VT+    ++  PP EGVY++GLFLEGA WD+RN RL EA+ KIL + LPV++I+A+         +D K+Y+ PIYKKPRRT+LTY+A  +L  S+ A+HW++RGVA+LCD+
Sbjct:  102 KLKEEREARRHRLDERHHHLLAQVADFYCIEKSEVEDGILDGNNVDQMELFFAAGGTCKILVHYQEPDLDKEGPDQIRIGQPGSKSTRAQKPRIFVSDGSSAPIRGPCAVFMRPDSQQAVTEANISRDVTFFSIDGSDGILRGVEQVLSTVLVPQLRELQGSGWGQLECQEHAREQFLNGLENFVNMLNTAQETINDRVVLKPCTGFDLKRLKTITDINQAASQADSLAAVEECAASWMKQIEQVLAETEQIRREADNVGPRAELDYWKRRMAKFNYLLDQLKSNDVKQVLGVLNAAKSKSLKTWFEMDRRITDNANEAKDNVKFLYTLDEHCMPLYHSDPVKMVDMIPKLINGIRMIHSISRYYNTSERMTSLFVKVTNQMITACKSYISQGGSETIWSQPTADVISQLKDCIRLNEEYQACFQRTKQKLEQMPGEKRFEFSEMYIFGKFDTFCRRLKKIIEMFQTMELFAHLSDSKIEGMEMMAAKFNVIVVGLKKKPYDFLDQRRTDFDNDFEDFKRQIQELQGSIQGFMDSRFEKLTSSQRAIQTLKRFERLKIPRLGIDEKYQKILAFYGKELEAAVRIYNKNKDDPPIARDLPPIGGKICWARQLFRRIEEPMVLFK-KMPHLLQSADGKKLVKNYNKLAEALVAFEMLYHRAWIKQLQTAQDGLKASLLVRHPESKRLFVNLDPEILTLIRETELMVRLGMDVPLAAQHLRARQATIKRHYDELNSLLEDYSRVLSTVPQEYEPLMGPRLGRLRRALEPGLTSLNWMSLATDSYIRDVRADMCELELLLARAKDLREFRIDRVLEEMANVRLCELPDSEPWTIDSFVERTQSLCQKGAQLLQVKSVNVEEAVNELINMLVGEEL--------------DDDDRSEMGAEESEERQREVESAGERPAQLGGRRKKDEKEQIEEAAMELLNHFNHRNMDAIVKVTKNTLEALRKRISASTLISYD-KAANTQRPFFRCFATLSIPQVAMHPTTEEVQQCVNKSCYCIISVSKGVSQWSKERKTTR----EKFSYDEEDFDFDGEVTTARSDARRPSIAASVAHTDISGQSDGATSRAGFRSHRGRTES---EEGTS-QYAVQMQANNYFKSVSENKEVAKLASLLSAAINSQKKAVQSAMERFYIYRYIWEQNREEALQEFVQQSPRLGEYEAKILDFEQKEETINAEPPSYDCGPIAIFTERLKLGLLTETKAWRLMFGRSCNLKYKSEMEDFFAFMDDIEKKLSRPIKDLDDIRIAMAALKDIRENEIRIDMGISPIEESYAMLFKHDLPVPKEEAERVDTLRYTWEKLRAHGIEVQNHLVTIQTDFRDNLVHEVVVFKQDCADFYSDYGGSGPMVPGVPPREASDRLVIFQNRFDNLHRKFITYTGGEELFGLPVSEYPELHKIKKELNLLTKLYSLYNDVINTVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDHTGEIISFMEDSLMVLSSLLSNRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTM------SRVV--------------------------VEDMGEEVGKLVEPTHYFIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQE------------------------------SAAKPALEAAEEALNTIKPADIATVRK---------------------------------------LGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKK-----GVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAI-----NGPTKDEKLYVCPIYKKPRRTDLTYVAAIKLRTSQPADHWVIRGVALLCDV 4607          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: K1PX83 (Dynein heavy chain 5, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10017921 PE=4 SV=1)

HSP 1 Score: 5860.41 bits (15202), Expect = 0.000e+0
Identity = 2909/4703 (61.85%), Postives = 3616/4703 (76.89%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQG-TQINENTIAKDVNFIVI----NGSNG--VLQGLEEYMSRVMLPHFRNLKGGWGQL--EKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXT-----PMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY--DIS----VKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDR----------------------------LIDES-------------DLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSH-QGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            K+KEER AKR+ LDERH Y+L+ VAD   LE TEVE++IL+GNQIE+MD+F S +  + L F++QEPE   E  D +R+G    K S+  KPKVF+T G++ PL+G  +VF + ++    I E  I K+V F  +    NG NG  +L  +E  +S + +P  +NL  GWG L     E  R+  +N+L++FV VL  A+ES+ E+V LK C   DL +I+ P D   + N++E L  +E+C+ +WLKQ+EQVLAES+Q+R+EAD+IGPRAELD+WKKRM++FNYLLDQ+K P+VKA +G+L A++SK +K W E DRRITD ANEA+DNVKFLYTLE+ C PLY ++P  M++ IP LI+++RMIHSIS+YYNTSE+MTSLFVKITNQMIT+CK+YIS   TETVWT    +++++L  C +LN+ YQ CF +TK +L   P+ER FE SEMYIFGKFDTF RRL  II++FE I  YS L+++ IEG+E    +FNVIV+ +KKK Y+FLDQR+TEF  DFD+F R + ELH NI  FMD  F+ I STTRA+  L+RFE+LN+P LGI +KY +IL+HYG+D+E V K Y +NK DPPVARD+P IAGKIAWARQL+RRIQ PME+F+ Q   LL+ PEAK IIKN+NKLA+ L+ FE++YH+ W+RQI +  +GL +SL+I+HPET EL+VNFDP IL + RET+ M +L LEIPP AI ++ KQ   K+ ++ L +++   ++V N IP  +E LM   ++K+ + +EPGL+  +WTS+ +QEYI  VY  L ELELL+DRA DL ++RID VL+EMST +LC+LP D P   D F+ NTQ LC K A  LQ+KS  VE++ NELINMLC  + + E ++   E+    Q  +            +     P+   AH       KK +E++ +I EAA+ELL HFNHRN +A++KV +NTLESLRKRI + +MV Y  D       K  + PFF+  A L IPNIVM P ++EVQ TVN+ A MIISVSKG+++WS+ERK  ++ A           D E  V  D     RRQS VS A       SD+               +  +E+    N     Q KN +K V+ENKEV K+ SLLST INST+KEV TA+ RFS Y  +W K ++  L EF K+DPK+SE++  IK Y  LE +IN   ++YD GPIAL+TE LK+GL +ETKAW++ YGKACN KY  EME+IFTF EDL KRLSR +KDLDDIR AM ALKEIR++EIRIDM I PIEESYAML++++LPV K+ETE+ DTLRY+W+KL  + S+VQ  L+ +QP+F+S LIENV+ F  DC  FY  YD  GPM  G+PPREASDRLII QN +D L ++FITY+GGEELFGL V+DY KL  IKKELNLLQKLYSLYN+V+ +V+GYYDILW D++IEKI+NEL EFQN+CRKLP+ LKDWPAFEDL+KTID+FN MVPLLELMTN AMKPRHW RM+++TSH FDVESD FAL+NILEAPLL+FKEEIEDICISAVKEKDIEAKLK V A+W+  E  F  FKNRGELLLRGD+TSEI+S+MEDSLM+LSSLLSNRYN PFKK+IQ  V  L+NSSEIIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE  NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDN+KTVKFHEK Y+ ILA YS E E ++LEKPVKAE NVE WLM L+ MAQ+SLHGVIR A  SI D+ F +LEFLNM+PAQVG+LGIQ++WTRDSTEAL +A+ DRKIMQQTN+ FL LLN+LI QTT DL KVERTKFETLITIHVHQKDIFD L +  VKSP+DF+WLKQ+RFYF+ED D+C +S+TDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL  KKERKK F+FTDGD V ++PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKFYTLYKLCEEQLTKQVHYDFGLRNILS LRTLG  KR N  D E  +VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDKGGYP+LE AI RQIDEA +++HPPW LKLIQLFETQRVRHGMMTLGPSGAGKT CIH+LMKA+TDCGEPH+E+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTL+ KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMVYMSSS LDW P+L+ WL  R  NE+ I+++LF  SFP + +Y++Q L +KME LEAF++ QAC LLEGLIP KD+KDS  +S+ HYE LYIF++MW+IGA LE +DR K+E ++RSN++I LDLP   +D+++TMFDYMV  NG+W HW++KVE Y YP DSTPEYGSILVP VDNVRT+FL+NT++ Q KAVLLIGEQGTAKTVMIN Y+   NPEYH+ +SLNFSSAT P MFQRT+ES+VDKR+GSTYGPPAG+KMT+F+DDINMPVINEWGDQIANEIVRQ +E KGFY+L+KPGDF ++ D+ F+AAMI PGGGRNDIP+RLKR F I NCTLP+  SID+I+S IG GHY  +R F   VI+M +KL+ +TR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG+INT+  VI S K+LL LW HECSRV++DR                            ++D +             D  WFE+ +   + D    +F +      YF DF+RDAPE   +  +D+ F +PKIYEP+PSFE+L+ERL MF + YNE +RGS ++LVFF DAM+H+VK+SR+IR  +GN LLVGVGGSGKQS+T+LASFIA Y  FQIT+TR YN++N LEDLK +YR AG + KG  F+FTD EIKDE++LEY+NN+L+SG++A LF+++EMDEI+  +   MKK FP+ P + ENLY Y+L RVR+NLH+VLCFSP+GEKFR RAL FP L SGCT++WFQ+WPK+AL+ VA H L +F + C   VK++++  + +IH  V  +C+ YF +YRRS  +T KSYLS+I+ YKT+Y   K  +  L ERM  GL+KL EA + + LL +EL +KE+ L++AS +A+ VL  VT +  AAE VK +V+ VKDK   IV+ I  D+ +A EKL  A+PAL+EAE ALNTIKP DI+TVRKL KPPHLI RIMD VL+LFQK+++    D ER  +K SW E+LKL++ TNFL +L+ FP+D IN+E ++LL PY ++EDY LE A++ CGNVAGL +WT++M  F+ +N+EV+PLK +LA Q   L  A  DLQ A+  L EKE  LA V+  YD A++ KQ L  DA  CR+KM+ A  L+NGL+ E+ RWT QS EF +QIG LVGD++V +AF+SY GPFNQ FRL +   W   ++N  +P    + +++ L++P  IGEWNLQGLPND+LS +N IIVT+ASRY L IDPQ QGK+WI N+E    +  T+  +KYF+ HLED+++ G PL+IED+ EELDPAL+NVLEKNFIK+G+ LKVKVGDKE DI K F+LYITTKL NP ++PE+ AKTS+IDF+VTMKGLEDQLLG VI  EK ELE+ R +L++   +NK+K+KELED+LL RL +T+GSLV+D++L+ VLN  K T+ DVS ++  AA+T+ +I  AREE+R ++ RGS+LYFLI ++  VN MYQ+ LKQFL LF  S+  S KSP  Q+RIQ+II  MT  ++ + VR LY+ D+ TFTLLL LK+D+    ++ EE   L+KGG++LDL  + PKP KWIVD+TWLNLV LS LH FSG++EQ+  +EKQWR WFDK+APE+E IP GY   LD F++LLL+R WCPDRT+  AR+YI  TLGD + E V   +  +  E++++TP++ LLS+G+DPT  IE  AKK  ++   ISMGQGQEVH+RR++A+ M  G W+LLQNCHL +DY+ E+   + E+  ++  +RLW+T+E H +FPINFLQI+IKFTNEPP+GI+A L+R++A L+QD+LD   +  WK M Y +AF+H  VQERRKFGPLGWNIPYEFN ADFNA   F+QNHLD +  KK     G++W CVRYM  EIQYGGRVTDD+D RLL    K +F E MFQ +F       I     + EY +YI+NLP TD P +FGLH NADI+Y +K+ K +L+TIL IQPKDS   G GETRESIVY+ C +ML+K+P+++ PF+V  ++ KMG  QPMNIFL+QEIDR+ +VI  VR TL+DLKLAIDG ++M++ LRDALDC++DA+IP +W+KISW+S+TLGFWF ELIDRN QF  W  DGRPV FW+TGFFN QGFLTAMRQEVTR+H GWA D VIL N VTR   +++  PP EGVY+YGLFLEGA WDKR  +LIE KPK+L++ +PVI+I+A+        +EDT+MY  PIYKKPRRT+LTYIA   L  +++ +HW++RGVA+LCDIK
Sbjct:   17 KLKEEREAKRAHLDERHFYILQTVADSLGLELTEVEDAILEGNQIEMMDQFLSPNSVSQLLFYYQEPE-HVEPVDHLRVGPPQAKVSKTSKPKVFVTNGRDTPLRGVALVFTKVAEADVTITETNIMKEVTFTRLDTSGNGKNGSGLLHAVETLLSSIFIPALKNLDKGWGALGTPSGEQVRQDFLNTLDSFVSVLVGAQESLEEKVTLKPCETYDLSKIQTPADYQAVANSSEALEGIENCMNVWLKQLEQVLAESEQMRKEADDIGPRAELDHWKKRMSRFNYLLDQIKGPDVKAVLGVLHASQSKLIKQWQEHDRRITDLANEARDNVKFLYTLEKFCDPLYNSDPVGMLEGIPGLINAIRMIHSISRYYNTSERMTSLFVKITNQMITACKSYISCQKTETVWTQNQADVVRKLNDCIKLNEEYQRCFHKTKEKLEKMPNERPFEFSEMYIFGKFDTFTRRLKKIIEMFETISMYSHLSESKIEGIEQSATRFNVIVTNMKKKPYDFLDQRKTEFELDFDEFKRMVAELHQNIQMFMDQKFEKIVSTTRALVLLQRFEKLNLPGLGIYDKYQRILSHYGKDIENVSKLYQKNKNDPPVARDLPPIAGKIAWARQLYRRIQEPMEVFK-QQGKLLEMPEAKRIIKNFNKLAKVLLEFEMLYHRGWLRQIEAARSGLQASLLIKHPETAELFVNFDPQILTMVRETECMARLGLEIPPLAITMRAKQTEYKDNYSALQMLLQENKRVRNKIPTAFESLMGPHVSKVDKRLEPGLSKLSWTSLNIQEYIQEVYSVLGELELLMDRAHDLMEFRIDAVLKEMSTTKLCQLPEDEPWLCDAFLENTQMLCAKGAVALQTKSLVVEEAANELINMLCPVDFEDEDEKIEMEEDEEEQRSQAGSPTGSQGARTSSRKSRPVSSKAH----LVAKKKREMRENIEEAANELLAHFNHRNQDALMKVTKNTLESLRKRITSSSMVHYLGDSGGFGDAKKDSGPFFKTFATLAIPNIVMQPALDEVQQTVNKAAQMIISVSKGVAKWSEERKRPQKSAV----------DREHAVAAD-----RRQSVVSAA-------SDAA-------------GEKKEEETEMKNYTITQQAKNYFKAVSENKEVTKLVSLLSTSINSTKKEVTTALDRFSGYHPIWEKDREDDLVEFNKEDPKLSEYEAKIKHYEELEVEINGLPEFYDVGPIALYTENLKLGLTTETKAWKLHYGKACNQKYSMEMERIFTFIEDLTKRLSRPLKDLDDIRFAMAALKEIRDDEIRIDMLIGPIEESYAMLIKHDLPVNKEETEKCDTLRYSWEKLQVQTSEVQTELLQVQPQFKSELIENVKTFNTDCSDFYSTYDTQGPMCAGVPPREASDRLIIFQNNFDVLYKKFITYTGGEELFGLPVSDYPKLGQIKKELNLLQKLYSLYNNVLETVHGYYDILWADINIEKINNELLEFQNKCRKLPRALKDWPAFEDLKKTIDNFNEMVPLLELMTNKAMKPRHWNRMAEVTSHVFDVESDNFALKNILEAPLLEFKEEIEDICISAVKEKDIEAKLKQVIADWNNKEFTFAQFKNRGELLLRGDNTSEIVSLMEDSLMVLSSLLSNRYNAPFKKNIQLWVQNLTNSSEIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETPNVVQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNLKTVKFHEKFYDQILAIYSSENETIDLEKPVKAEGNVENWLMSLMLMAQKSLHGVIRTAAMSIQDSSFQLLEFLNMFPAQVGILGIQMIWTRDSTEALTHARYDRKIMQQTNQAFLDLLNILINQTTQDLTKVERTKFETLITIHVHQKDIFDDLCRMHVKSPTDFEWLKQSRFYFLEDQDKCQISVTDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLGAKKERKKAFIFTDGDNVTLSPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSCLRTLGTVKRQNKDDPEAMSVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKGGYPDLEGAIARQIDEAKLVAHPPWTLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHILMKAMTDCGEPHKELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLRAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVYMSSSGLDWKPILQCWLNSRPVNEQAIIMDLFERSFPLVLQYAVQNLTFKMEVLEAFIISQACKLLEGLIPSKDDKDSGSVSQSHYEHLYIFTLMWTIGAFLEWDDRIKVEEFMRSNDDIVLDLPPTNRDADETMFDYMVDTNGQWQHWSNKVEPYHYPTDSTPEYGSILVPMVDNVRTEFLINTISKQGKAVLLIGEQGTAKTVMINGYMGKYNPEYHLGQSLNFSSATTPLMFQRTVESYVDKRVGSTYGPPAGKKMTIFVDDINMPVINEWGDQIANEIVRQLMEYKGFYNLEKPGDFTNIADVQFLAAMIQPGGGRNDIPQRLKRQFVIINCTLPSNPSIDKIFSCIGCGHYITDRGFAKDVIDMTAKLVPITRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMINTECSVIKSEKELLWLWKHECSRVIADRFTNFEDQAWFNKTMSRVINEELSETHGAMVDSTHYFVDFMKFTTAEDGHWFEKTLLRVIGDELGEDFLEIVKPTYYFGDFMRDAPEATGDEPEDTDFDMPKIYEPIPSFEVLEERLQMFLQQYNEGIRGSGMDLVFFKDAMIHLVKVSRIIRTPRGNALLVGVGGSGKQSLTKLASFIAGYKTFQITLTRSYNVSNLLEDLKYLYRTAGAQGKGITFIFTDQEIKDEAFLEYLNNVLSSGIVANLFARDEMDEIMGELIPIMKKEFPRRPPSNENLYDYYLTRVRNNLHVVLCFSPVGEKFRARALKFPGLISGCTMDWFQRWPKDALIAVADHFLSNFNIECTAEVKKQVIQTMGLIHDGVAESCVSYFQRYRRSTHVTPKSYLSFINGYKTIYSDKKNEIGELAERMNTGLEKLIEAGQQVALLKEELAVKEKELAIASEKADKVLKEVTVKAQAAEKVKEQVQKVKDKAQGIVDAIESDKVIAYEKLEKARPALEEAEAALNTIKPADIATVRKLGKPPHLIMRIMDSVLLLFQKRVNTVEMDPERPCIKPSWGEALKLMSGTNFLQTLINFPKDSINDETVELLDPYLSQEDYTLEVAKRVCGNVAGLLSWTRSMAVFFEINKEVLPLKANLAVQEARLQVAMGDLQKAQAQLDEKEAELAKVREMYDQAMREKQTLLDDAETCRRKMTAAAALINGLQGERDRWTEQSKEFRAQIGRLVGDVLVCTAFLSYSGPFNQDFRLLLNQKWFKELKNRKIPCTLNLSVIDMLTDPTVIGEWNLQGLPNDELSTQNGIIVTKASRYPLLIDPQGQGKNWIKNREAHSELQLTSLNHKYFRTHLEDSMSLGRPLLIEDVAEELDPALDNVLEKNFIKVGSTLKVKVGDKECDIMKGFSLYITTKLGNPSYTPEVSAKTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVKLMEDVQSNKKKMKELEDNLLYRLTSTKGSLVDDEDLINVLNTTKTTAQDVSQKLQVAAETQTKITVAREEFRPVAARGSILYFLIVEMGLVNCMYQTSLKQFLYLFDLSMARSAKSPITQKRIQNIIDFMTFEVFKYAVRGLYEEDKNTFTLLLTLKIDLAAGKIKHEEFMTLIKGGASLDLNVVQPKPHKWIVDLTWLNLVELSNLHQFSGILEQVSRNEKQWRQWFDKEAPEEEVIPDGYNNSLDVFRRLLLVRSWCPDRTMSQARKYIADTLGDKYAEGVILDLEKMWSESNSRTPMVCLLSMGSDPTNNIEALAKKLKLECRNISMGQGQEVHARRLMAQGMANGGWLLLQNCHLSLDYVEEVLDQLIETETIHQEFRLWVTTEVHKKFPINFLQISIKFTNEPPQGIKAGLKRTYAGLSQDFLDISNMPQWKPMLYGVAFMHTVVQERRKFGPLGWNIPYEFNAADFNASVQFVQNHLDDMDIKK-----GVNWTCVRYMFGEIQYGGRVTDDYDKRLLNTFCKVWFGENMFQSNFCFYKGYIIPKCAKMQEYMDYINNLPGTDTPEAFGLHANADITYQSKSAKTVLDTILEIQPKDSSGGGSGETRESIVYRICDDMLEKLPNDYDPFEVKARLEKMGRLQPMNIFLKQEIDRMQRVISLVRSTLSDLKLAIDGTIIMSESLRDALDCMYDARIPKLWQKISWDSSTLGFWFTELIDRNGQFHTWCFDGRPVTFWMTGFFNAQGFLTAMRQEVTRAHKGWALDGVILHNDVTRQMKDDITTPPSEGVYVYGLFLEGAGWDKRGSKLIEPKPKVLFEPMPVIHIYAI---NTTSDKEDTRMYKCPIYKKPRRTDLTYIAAVFLKTNQNPDHWVLRGVALLCDIK 4670          
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Match: V3ZZA4 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_192667 PE=4 SV=1)

HSP 1 Score: 5779.91 bits (14993), Expect = 0.000e+0
Identity = 2859/4629 (61.76%), Postives = 3585/4629 (77.45%), Query Frame = 3
Query:  321 MDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQ-GTQINENTIAKDVNFIVIN----GSNG--VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS---RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIR--HPET--KELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVI--------STQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAY---DISV---KSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKT-AKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHER-KGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYT-EELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVC----SKSAEHWIMRGVAMLCDIK 14102
            MDKF   +    L F++QEPE EKE  D +R+G    K  +  KPKVFI +G + PL+G  ++F + +Q G  I +  I K+VNF  ++    G+NG  +L+ +E+ +SR+ +P  + +  GWGQL         R   +NSL++FV VL  A+ES+ ++V LK C   DL +I  P D M + N+TE L  +E C+ +W+KQIEQVLAES+Q+RREAD+IGPRAELD+WKKRM+KFNYL+DQ+K  +VKA +G+L AAKSK +KTW E+DRRITD ANEAKDNVKFLYTLE+ C PLY ++P  M+D IP LI+++RMIHSISQYYNTSE+MTSLFVKITNQMIT+CKAYI+ND +ETVW+   + + K+L  C  LN  YQ CF +TK +L   P+ER F+ SEMYIFGKFDTF RRL  II++F+ ++ YS L ++ IE +E+   KFNVIV+ +KKK Y++LDQR+ EF QDF+DF RQIQ+LH+NIL FMD  F+ I+ST RA+  LR+FERLN+P+LGI +KY +IL+HYG+D+E V + Y +NK DPPVARD+P IAGKIAWARQLFRRIQ PME+F+ +H  +L+T EAK IIKN+NKLA+ L+ FE++YH+ W+RQ+ +  +GL +SL+++  HPE+  KEL++NFDP IL + RETD M +L L+IPP AI ++ KQ   K+ +N L +M++  Q+V   IP  +E LM   +A +   IEPG+TT NW S+ + +YI +VY  LA+LELL+DRA D+ ++RID +L+EM++ +LCELP D P TV++F+ NTQ LC K A++LQ+KSQ VE++ NELINML   E +    +  EE+          + +E   S   + S+ S  P+   A +      KK +E++ ++ E+A ELL+HFN+RNL+A+++  R TLESLRKRI + +M  Y   D S    K  ++PFFR +A L IPNIVM P ++EVQ  +N+T   IISVSKG+SQWSKERK  AK    +A  S            + E    RR S +S        +   G+ R  G+ T             + +L    Q KN +K+V++NKE+AK+ SLLST INST+KE+ TA+ +FS Y  +WAK +D  LEEF+KDDPK+SEF+  I  Y  LE QI +E +YYD G IAL+TE LK+GL +ET+AWR+ YGKAC+ KY+ EME+IF F ED+ KRL+R IKDLDDIR +M ALKEIRENEIRIDM++ PIEESYA++ +++LPV K++ E+ DT+RY+W+KL ++ S VQ +L+ IQP FR NLIENV+IF +DCD FY+DYD +GPMVPG+ PREASDRLI+ QN++D L R++ TY+GGEELFGL VT+Y +L  I+KELNLLQKLY LYNDVI++V+GYYDILW +V+IEKI+ EL +FQ RCRKLPK LKDWPAF+DL+KTIDDFN MVPLLELM N AMK RHWQRMSDLTSH FD+ES+ F LRNILEAPLLK+KEEIEDICISAVKEKDIEAKLK V A+WS+ E  FG+FK RGELLLRGD TSEI+SIMEDSLM+LSSLLSNRYN PFKK+IQ  V  L+NSSEIIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM++AHE   V+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDN K VKFH+K  + IL+  S E E +ELEK VKAE NVE+WLM LL M+Q+S+HGVIR A  +I D+ FN+LEFLNM+PAQ+GLLGIQ++WTRDSTEAL N K D+KIM QTN+ FL LLN LI QTT +L K +RTKFETLITIHVHQ+DIFD+L +  +KSP DF+WLKQ+RFYF+ED D+C++SITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VLS KKERKK F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLA+CGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR NPTDTEQT VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE AI   + +A +I+HP W LKL+QLFETQRVRHGMM LGPSGAGKT CIH+LMKA++D GEPH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT + KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMVYMSSS L W P+LKGWLL R S E  I+LELF  SFP I RY++Q L++KM+ LEAF++ QA  L+ GLIP KDEK+    S+ HYERLYIF+VMWS+GA LE++DR KLE +IR N + KLDLP I   S+ T+FDY V  +G W+HWN KV++Y YP D TPEY +ILVPNVDNVRT+FL++T+  QEKAVLLIGEQGTAKTVMI  Y++  NPE H+ +S+NFSSAT P +FQRTIES+VDKR+G+TYGPPAG+KMTVFIDDINMPVINEWGDQIANEIVRQ +E  GFY+L+KPGD I+++D+ F AAMI PGGGRNDIP+RLKR F IFNCTLP+ +SID+I+SVIG GH+C ER F  +V N+V +L+ +TR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++NT+S VI+S + L+ LW HEC RV++DR ++  D  W ++ ++  + +    +  D  N   YF DFLRDAPE   +  DD+ F +PK+YEP+ S + LKERLSMF + YN+++RG+ ++LVFF DAM+H++K+SR+IR  +G+ LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N LEDLK +YR AG++ KG  F+FTD EIKDE +LEY+NNML+SG++A LF+++EMDEIL  +   MKK FP+ P + ENLY+Y+L RVR+NLH+ LCFSP+GEKFR+RAL FP L SGCT++WFQ+WPK+AL+ VA H L +F +VC + VK +I+  +  IH  V  NC  YF +YRRS  +T KSYLS+I+ YKT+Y   K  +  L ERM  GL KL EA EA+  L  EL  KE+ L++AS +AE VL  VT +  AAE VKN+V+ VKDK  AIV+ I  D++VAE KL AA+PAL+EAE ALNTIKP DI+TVRKL +PPHLI RIMDCVL+LFQ K+ P   D ++ + +K SW ESLKL+A TNFL +L+TFP+D IN+E ++ L PYF  EDY LE A++ CGNVAGL AWTKAM  F+ +N+EV+PLK +L  Q   L  A  DL +A++ L  KE+ LA+V+ EY+ A+  KQAL  DA  CR+KM+ A+ L++GL  EK RWT QS EF++QIG LVGD+++ +AF+SY GPFNQ FR+ +  +W   ++   +P +  +++   L++P  IGEWNLQGLP+D+LS++N IIVT+A+RY L IDPQ QGK WI N+E ++ +  T+  +KYF+QHLED+++ G PL+IED+ EELDPAL+NVLEKNFIK+G+ LKVKVGDKE DI K F LYITTKL NP ++PEI A TS+IDF+VTMKGLEDQLLG VI  EK ELE+ R  L+++ ++NKRK+KELED+LL RL +T+GSLV+D++L+ VLN  K T+ DVS ++  AA+TE +IN AREE+R ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP  Q+RI +II  MT  ++ + VR LY+ D+ TFTLLLALK+D++   ++ EE   L+KGG++LDL  + PKP KWIVD+TWLNLV LS LH FSG+++Q+  +EK W+ WFDKD+PE+E IP GY   LD F++LLL+R WCPDRTL  A++YI  TLGD + E V      + +E+D + PL+ LLS+G+DPT  IE  AKKH I+   ISMGQGQEVH+RR+ +  +Q G W+LLQNCHL +D++ E+   I E+ +++  +RLW+T+E+H +FPI+FLQ+AIKFTNEPP+GI+A L+R++ ++TQD+LD   +  WK M Y++ FLH  VQERRKFGPLGWNIPYEFN AD+NA   F+QNHLD +  K+     G+ W CVRYM+ EIQYGGRVTDDFD RLL      +F E MF  +F  +    I     + EY  +I++LP  D+P  FGLH NADI+Y + T K  L+TILSIQPKDS  G GETRESIV +   +MLDK+P +++PF+V+  + KMG +QP+NIFLRQEIDR+ +VI  VR TL DLKLAI+G ++M++ LRDALD ++DA+IP  W K+SW+S+TLGFWF ELIDRN QF  W  DGRP+ FW+TGFFNPQGFLTAMRQEVTR+H GWA DSVIL N VT++   E++  PP EGVY+YGLFLEGA WDKRN +L E +PK L+D++P+I+I A+        +  T MY+ PIYKKPRRT+LTYIA+  L C    S+S  HWIMRGVA+LCDIK
Sbjct:    1 MDKFMGENGMKRLMFYYQEPEAEKE-HDHVRLGPPTTKVVKSTKPKVFIAEGSDIPLRGIGLIFTKCTQTGVAITDINITKEVNFTRLDANTEGANGRGLLKAVEDILSRIFIPALKKIDNGWGQLNDKRAGNQVRTDFLNSLDSFVSVLVGAQESLQQKVELKPCEGYDLNKIHTPNDYMTVANSTESLESIEACMRVWIKQIEQVLAESEQMRREADDIGPRAELDHWKKRMSKFNYLVDQIKGHDVKAVLGVLMAAKSKMIKTWQELDRRITDTANEAKDNVKFLYTLEKFCDPLYNSDPVGMLDGIPGLINAIRMIHSISQYYNTSERMTSLFVKITNQMITACKAYITNDRSETVWSQPIDIVKKKLNDCIRLNAEYQDCFHKTKAKLEKMPNERPFDFSEMYIFGKFDTFTRRLKKIIEMFDTMEMYSHLAESKIEDMETQASKFNVIVTAMKKKPYDYLDQRKMEFDQDFEDFKRQIQQLHSNILQFMDNRFEKISSTQRALMLLRKFERLNLPNLGISDKYQRILSHYGKDIENVSRLYQKNKTDPPVARDLPPIAGKIAWARQLFRRIQEPMEVFQ-EHPQILQTNEAKKIIKNFNKLAKVLLEFEVLYHRGWIRQVEAIKSGLQASLLVQVVHPESTSKELFLNFDPQILSMIRETDCMGRLGLDIPPMAIKMRAKQAEYKDHYNALQMMLDENQRVRAKIPVAFESLMGQHLAHVDEAIEPGITTLNWMSLGIDDYIKNVYAALADLELLMDRAHDVTEFRIDAILKEMASTKLCELPEDEPWTVEKFLENTQMLCAKGAQILQTKSQTVEEAANELINMLVNSEPEAVEGDESEEEEGRQFFRTKQTGEETERSKSAAGSRQSARPLSSKALS----VAKKKREMRENLEESAMELLIHFNNRNLDALLRATRYTLESLRKRITSSSMAHYIGMDTSYGDSKKDSRPFFRTSAVLAIPNIVMQPALDEVQQALNKTVQTIISVSKGVSQWSKERKRRAKPQLLDASMSG-----------VGEYSFERRASAIS--------MMSEGSKRLEGEAT-------------ATSLTIQQQNKNYFKSVSDNKEIAKLASLLSTSINSTKKEITTALEKFSHYHSIWAKDRDDELEEFMKDDPKLSEFEAKIHHYNELEKQIMSEPEYYDVGAIALYTEKLKLGLTTETRAWRLHYGKACDNKYQNEMEEIFNFIEDMTKRLNRPIKDLDDIRFSMQALKEIRENEIRIDMSLAPIEESYALMNKHDLPVVKEDAEKCDTMRYSWEKLNAQASTVQSHLLEIQPNFRGNLIENVKIFIEDCDNFYDDYDKNGPMVPGVEPREASDRLIVFQNQFDTLYRKYQTYTGGEELFGLPVTEYPQLHTIRKELNLLQKLYGLYNDVIDTVHGYYDILWQEVNIEKITQELQDFQTRCRKLPKALKDWPAFDDLKKTIDDFNEMVPLLELMANKAMKNRHWQRMSDLTSHVFDIESEAFTLRNILEAPLLKYKEEIEDICISAVKEKDIEAKLKQVIADWSSKEFTFGSFKTRGELLLRGDTTSEIVSIMEDSLMVLSSLLSNRYNAPFKKNIQQWVQNLTNSSEIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTKAHETPQVVQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLSFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNTKRVKFHDKFVDNILSIISSEEEVIELEKHVKAEGNVEVWLMSLLQMSQKSVHGVIRTAAMAIQDSSFNLLEFLNMFPAQIGLLGIQMIWTRDSTEALTNVKYDKKIMAQTNQAFLDLLNKLIAQTTQELSKRDRTKFETLITIHVHQRDIFDELCRRNIKSPMDFEWLKQSRFYFIEDQDKCLISITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLSSKKERKKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLAACGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGANKRLNPTDTEQTIVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPELEKAIADNVADAKLINHPAWSLKLVQLFETQRVRHGMMALGPSGAGKTCCIHMLMKAMSDIGEPHKEWRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTTRVKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVYMSSSGLHWEPILKGWLLSRPSFETNIILELFQTSFPAILRYAVQNLVFKMDVLEAFIIAQATKLMSGLIPVKDEKE-GHYSQEHYERLYIFTVMWSVGAFLELDDRAKLEEFIRKNEDFKLDLPDIPSGSDATIFDYCVDADGNWIHWNQKVKDYTYPSDYTPEYCNILVPNVDNVRTEFLIHTICKQEKAVLLIGEQGTAKTVMITNYMNQYNPEEHLAQSVNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGKKMTVFIDDINMPVINEWGDQIANEIVRQLMETHGFYNLEKPGDIINLVDMQFCAAMIQPGGGRNDIPQRLKRQFAIFNCTLPSNSSIDKIFSVIGCGHFCAERGFTENVRNLVKQLVPVTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLNTESSVITSPELLMGLWKHECCRVIADRFVNPEDTAWIDKTLKRIVAEDLGEDHLDLVNPTLYFSDFLRDAPEATGDEPDDADFDMPKVYEPIESLDQLKERLSMFLQQYNDSIRGAGMDLVFFNDAMIHLLKVSRIIRTPRGHALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLLEDLKYLYRTAGQQGKGITFIFTDQEIKDEGFLEYLNNMLSSGVVANLFARDEMDEILGELVPIMKKEFPRRPPSNENLYEYYLSRVRNNLHISLCFSPVGEKFRQRALKFPGLISGCTMDWFQRWPKDALIAVAHHFLSEFEIVCSEEVKLQIIHSMGTIHDGVAENCTDYFQRYRRSTHVTPKSYLSFINGYKTIYANKKMEIGELAERMNTGLSKLIEASEAVAELKVELAEKEKELAIASEKAEKVLKEVTVKAQAAEKVKNQVQKVKDKAQAIVDMIDRDKEVAERKLEAARPALEEAEAALNTIKPADIATVRKLGRPPHLIMRIMDCVLLLFQNKVLPVTVDADKPEYIKPSWGESLKLMAGTNFLQALVTFPKDSINDETVEFLAPYFDSEDYTLETAKRVCGNVAGLAAWTKAMSYFFEINKEVLPLKANLIVQQSKLNSAMADLNAAQETLDAKEKELAVVRAEYEKAMSEKQALVEDAETCRRKMNAASALIDGLAGEKERWTEQSREFKAQIGRLVGDVLICTAFLSYSGPFNQDFRILLNKNWMKELKTRKIPYSANLNVTTMLTDPTTIGEWNLQGLPSDELSIQNGIIVTKAARYPLLIDPQGQGKSWIKNREGKNEMQITSLNHKYFRQHLEDSMSLGRPLVIEDVGEELDPALDNVLEKNFIKVGSTLKVKVGDKECDIMKGFTLYITTKLPNPSYTPEISAGTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVNLMEEVTSNKRKMKELEDNLLFRLTSTQGSLVDDEDLINVLNITKVTADDVSQKLKNAAETEIKINTAREEFRPVATRGSILYFLITEMSLVNVMYQTSLRQFLGLFDRSLARSIKSPITQKRILNIIEFMTYEVYRYAVRGLYEKDKLTFTLLLALKIDLQAGKIKHEEFMTLIKGGASLDLNVVTPKPHKWIVDLTWLNLVELSNLHQFSGILDQVSRNEKLWKQWFDKDSPEEEIIPDGYNNSLDVFRRLLLVRSWCPDRTLPQAKKYIADTLGDKYAEGVILDTEKMWQESDNRNPLVCLLSMGSDPTTSIEALAKKHRIECKAISMGQGQEVHARRLTSFGVQNGGWLLLQNCHLSLDFVVEVMDTIIETESIHDEFRLWVTTEEHLKFPISFLQMAIKFTNEPPQGIKAGLKRTYTNITQDFLDISNMPQWKPMLYAVGFLHTIVQERRKFGPLGWNIPYEFNTADYNASVQFVQNHLDDMDIKR-----GVTWTCVRYMLGEIQYGGRVTDDFDKRLLNTFCTEWFDEKMFNSNFSFSKGYVIPKCQKIAEYHEFINDLPNNDSPEVFGLHGNADITYQSNTAKTSLDTILSIQPKDSSSGGGETRESIVSRLADDMLDKLPPDYVPFEVSNALKKMGEYQPINIFLRQEIDRMQRVISLVRTTLQDLKLAIEGTIIMSENLRDALDSMYDARIPKSWSKVSWDSSTLGFWFTELIDRNQQFHTWCFDGRPLSFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVILSNDVTKYQNKEDIPAPPTEGVYVYGLFLEGAGWDKRNNKLCEPRPKQLFDNMPIIHITAVNSTGGPTYDVRT-MYVCPIYKKPRRTDLTYIADVTLKCAQSQSQSPAHWIMRGVALLCDIK 4584          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4458.29 bits (11562), Expect = 0.000e+0
Identity = 2174/3556 (61.14%), Postives = 2747/3556 (77.25%), Query Frame = 3
Query: 3441 GSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            GS S  +    +SA+    +Q KN YK+V+ENKE+ K+ S+LST INS++K ++ A+ RFS Y H+W K +++T++EF + +P ++EF+  I  Y  LE +INAE ++   G +AL+T  LK+ L +ETK W + +G  C  KY+ EME++FTF ++  K+L+R IKDLDDIRIAM ALKEIRE++I ID  + PIEESYAML +YEL V K+E E+VDTLRYTW+KL++R S+VQ+ L+++QP FR  LI NVQ F +DCD FY++YD  GPMV GL P++ASDRLI+ QNR+DNL R+F+T++GGEELFGL VT + +L +I+K+L LLQKLY LYN+VI +VNGYYD+LW DV IE+I+NEL +FQ RCRKLP+ LK+W AF DL+KTIDDF+   PLLELM N AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD TSEIIS MEDSLM+L SL+SNRYN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V FH+K                                        R ++ V+ +     +   F V+       AQVGLLGIQ++WT+DS EAL NA+ DRKIM +T + FL LLN LI  TT DLG +ERTK+ETLITIHVHQKDIFD L    ++SPSDF+WLKQ RFYF+ED+DR +++ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  KD+    ++SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E KGF++L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GHYC +R F   V  +VS+L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++N  +DVI + K LL LW HEC RV++DR     D+ WF+  +   +++    E+RD   P    YFVDFL+DAPE   E  +++ F +PK+YEP+ SF  L++RL+MF   YNE++RG+ ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK++YR AG++ KG  F+ TDNEIKDES+LEY+NN+L+SG ++ LF+++EMDEILS +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP           FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK ++V  +      V   C+ YF +YRRS  +T  SYLS+I  YK +Y+  +  +  +   M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +A+EKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+  +  SW ESLKL+ + NFL SL  FP+D INEE+++LL PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +NREV+PLK +L  Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EKARWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + S W+  +R   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  L++    NKRK+KELEDSLL RL +T+GSLV+D++L++VL+  K+TS +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  + N+  R LY+  +  FTLLL LK+DM++N ++ EE   L+KGG++LDLK   PKP KWI DMTWLNLV LSKL  FS +++QI   EKQWR+WFDK+APE+E IP  Y+  LD FK+LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TP++ LLS+G+DPT +I    K+  ++   +SMGQGQEVH+R+++ + M  G W LLQNCHL +D+++EL   + E+ +++  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + Q+ LD   ++ W+ M YS+AFLH TVQERRK+GPLGW+IPYEFNQADFNA   F+QNHLD +  K+     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I    +VD+Y  YI  LP  D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++ PF+V +++  MG  +PMNIFLRQEIDR+ +V+  VR TLTDLKLAIDG +VM++ LRDALDC++DA+IP  W+K SW S+TLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP+EGVY+YGL+LEGA WD+RN RL+++KPK+L++ +PV+ ++A     +    +D+++Y  PIYKKP RT+   IA  +L  S+  E+WI+RGVA+LCD+K
Sbjct:  687 GSTSDIS----VSAHQVLPFQAKNYYKSVSENKEIVKLVSVLSTSINSSKK-MKNALERFSRYHHIWRKDRESTIQEFSQGNPLLAEFESQILYYKDLELEINAEPEFITVGALALYTADLKLALTAETKGWMLDFGHHCKRKYRTEMEQVFTFVDEASKKLNRPIKDLDDIRIAMAALKEIREHQITIDFQVGPIEESYAMLNKYELSVAKEEMEKVDTLRYTWEKLLARSSEVQNELVSLQPNFRGELISNVQTFVEDCDHFYQEYDKDGPMVMGLAPQDASDRLIMFQNRFDNLYRKFVTFTGGEELFGLPVTQHPQLLEIRKQLTLLQKLYGLYNNVIETVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKT---------------------------------------RRVNHVLISKQVKHHCILFKVMFKFVFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQ--GGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYK--EKHLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKR-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 4173          

HSP 2 Score: 611.683 bits (1576), Expect = 8.969e-175
Identity = 312/653 (47.78%), Postives = 435/653 (66.62%), Query Frame = 3
Query:  594 GVLQGLEEYMSRVMLPHFRNLKGGWGQLE--KDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLA 2546
            G+L+  E+ +S V +P  RN+  GWG+L   + +  ++  ++SLE+FV VL+ A+ES+ E    KV                 I + + QL +  H V       EQVLAESDQ+R+E D++GPRAELD+WKKRM++FNYLLDQLK P+VK+ +G+L  AKSK +KTW E+D RITD+ANEAKDNVK+LYTLE    PLY +NP  M++ I  LI+++RMIHSIS+YYNTSEK+TSLFVK+TNQMIT+CKAYI+N+ + T+W    + + +++     LN+ YQ CF +TK +L   P ERQF+ SEMYIFGKFDTF RRL+ I+ +F  I TYS L D+ IEGLE+M  +   IV T+KKK Y+FLDQRRT+F QD+++F +Q  EL                              L+IPDLGIEEKY K   +Y RD+E V + Y++ K +PP+ R++P +AGKI W+RQL+ RI+ PM++F+ QH N+L TPEAK II+NYN++A+TL+ +E+IYH+ W+ Q+     GL +SL++R P+T+ELYVNFDP IL   RETD + ++ LEIPP A  L+ KQN LK  +N L + +  IQ         +EQ++   +AK+   I PGLT+ NW+S+ + +++  V   L 
Sbjct:    8 GLLKSTEQLLSEVFIPTLRNMNHGWGELASPQAQTVKQDFISSLESFVSVLAGAQESLEE----KVTHLNTHHTHTHAHLHTYIRSISIQLCEF-HGVA------EQVLAESDQLRKEGDDLGPRAELDHWKKRMSRFNYLLDQLKSPDVKSVLGVLLMAKSKLIKTWRELDIRITDSANEAKDNVKYLYTLERFFDPLYNSNPVSMVEAIAGLINAIRMIHSISRYYNTSEKITSLFVKVTNQMITACKAYITNNGSATIWDQPQDVVAEKIRAAIRLNEEYQKCFHKTKQKLEQSPSERQFDFSEMYIFGKFDTFQRRLNKILTMFSTISTYSALQDSKIEGLETMATRLQNIVVTMKKKPYSFLDQRRTDFDQDYEEFCKQTTEL------------------------------LSIPDLGIEEKYQKAFQNYSRDIEMVSRIYTKQKMEPPIGRNLPPVAGKILWSRQLYLRIEEPMKLFQ-QHPNVLATPEAKRIIRNYNRVAKTLVEYEVIYHRGWMSQL--VRIGLQASLLVRCPDTRELYVNFDPQILTQIRETDCISRMGLEIPPFAAVLRQKQNVLKTHYNNLQVTLCGIQPA-------FEQMLTPHVAKVDEAILPGLTSLNWSSLNIDKFLSRVTAALG 609          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3365.86 bits (8726), Expect = 0.000e+0
Identity = 1629/2676 (60.87%), Postives = 2064/2676 (77.13%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  K       +SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQ +E KGF++L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+   G GHYC +R F   V  +VS+L+ LTR+LWQ TK KM PTP+ FHY+FNLRDLSRIWQG++N  +DVI + K LL LW HEC RV++DR     D+ WF+  +   +++    E+RD   P    YFVDFL+DAPE   E  +++ F +PK+YEP+ SF  L++RL+MF   YNE++RG+ ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N +EDLK++YR AG++ KG  F+ TDNEIKDES+LEY+NN+L+SG ++ LF+++EMDEILS +   MK+ FP+ P T ENL++YF+ RVR NLH+VLCFSP           FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK ++V  +      V   C+ YF +YRRS  +T  SYLS+I  YK +Y+     V  L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  AAE VK +V+ VKDK  AIV+ I  D+ +A+EKL AAKPAL+EAE AL TIKP+DI+TVR L +PPHLI RIMDCVL+LFQ++++    D E+  +  SW ESLKL+ + NFL SL  FP+D INEE+++LL PYF   DY++E A++ CGNVAGLC+WTKAM  F+ +NREV+PLK +L  Q   LA A  DLQ A+  L  K+  L +V+ EY+ A+  KQ L  DA  CR KM TA+ L++GL  EKARWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + S W+  +R   +P    +++ E L +   + EWNLQGLPND LS++N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLED+L+ G PL+IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VTM+GLEDQLLG VI  EK+ELE  R  L++    NKRK+KELEDSLL RL +T+GSLV+D++L++VL+  K+TS +V+ ++  AA+TE +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L+QFL LF  S+  S KSP   +RI +II  MT  + N+  R LY+  +  FTLLL LK+DM++N ++ EE   L+KGG++LDLK   PKP KWI DMTWLNLV LSKL  FS +++QI   EKQWR+WFDK+APE+E IP  Y+  LD FK+LLLIR WCPDRT+  AR+YI  ++G+ + E V   +     E+D +TP++ LLS+G+DPT +I    K+H      +SM     +H+        ++G W LLQNCHL +D+++EL   + E+ +++  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + Q+ LD   ++ W+ M YS+AFLH TVQERRK+GPLGW+IPYEFNQADFNA   F+QNHLD +  K+     G+ W  VRYMI EIQYGGRVTDD+D RLL    K +F E MF  +F       I    +VD+Y  YI  LP  D P  FGLH NADI+Y +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++ PF+V + +N MG  +PMNIFLRQEIDR+ +V+  VR TLTDLKLAIDG +VM++ LRDALDC++DA+IP  W+K SW S+TLGFWF EL++RN QF  W+ +GRP CFW+TGFFNPQGFLTAMRQE+TR++ GWA D ++L N VTR+  +++ +PP+EGVY+YGL+LEGA WD+RN RL+++KPK+L++ +PV+ ++A     +    +D+++Y  PIYKKP RT+   IA  +L  S+  E+WI+RGVA+LCD+K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPK-------LSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF---GTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRHISTSRLLSMLFFSYIHTH---THTHEQGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKR-----GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEV-KGLNTMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKDSRLYSCPIYKKPARTDQNIIAAVDLRTSQRPEYWILRGVALLCDVK 2659          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3135.13 bits (8127), Expect = 0.000e+0
Identity = 1535/2680 (57.28%), Postives = 1998/2680 (74.55%), Query Frame = 3
Query: 6081 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSI-QIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH--DGWAFDSVILGNRVTRFYTEELREPPK---EGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP+++E+T VMRVLRDMN+SKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+H PWVLKL+QL+ETQRVRHGMMTLGPSG GKT CIH L+KA+TDCG PH+E+RMNPKAITA QMFG LDV+TNDWTDG+FSTLWR+TLK KKGE+ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L+W P+L+ WL K  +++  ++L  F N+F     YS    IY  E +                                 RL++F+VMWS+GALLE+EDR ++E ++R N+   LDLP  ++D   T+F+++V+E GEW  W+ KV EY YPKDS P+Y SILVPNVDN RTDFL+ T+  Q KAVLLIGEQGT KTVMI  Y +  +PE H+ KSLNFSSAT+P MFQ+TIES++DKRMGSTYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQ +E  GFYSL++PG+F+SV+DL  VAAMIHPGGGRNDIP+RLKR F +FNCTLP+ +SID+I+  +  G++C ER F  SV ++   L+   R++WQ+ K KM P+P+KFHY+FNLRDLSRIWQG++   ++V    + L+ L+ HEC+RV++DR ID++D   F+  +E    +    +         YFVDFLRDAPE   +  +D+   +PKIYEP+PSF  L ERL++F + YNE+VRGS ++LVFF DAM+H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQI +TR YN  N +EDLK++YR AG + KG  F+F DN+IKDES+LEY+ N++ASG ++ LF+++E+ EI   +   MK+  P+ P T +NLY YFL RVR NLH+VLCFSP+GEK   RA+ FP L SGCT++WFQ+WPK+ALV VAQH L  + L C + VK+ ++  +      V   C +YF ++RR   +T KSYLS+I  Y+T+Y     +V  L ERM  GL +LKEA++A+  LSK L +KE+ L VAS +A+AVL  V  +  AAE VK +V+ VKDK  AIV++I  D++VAE KL AAKPAL  AE AL TIKP DI+TVRKL KPPHLI RIMD VL+LFQ+++D    D ER  ++ SW E+LKL+ ++ FL+ LL F +D INEE+++LL PY + EDY+LEAA++ CGNVAGLC+WT+AM  F+ +N+EV+PLK +L  Q   LA AQD+L  A++ L  K++ L   +  YD A+  KQ+L  DA  CR+KMS A  L++GL  EK RWT  S EF+ QI  L GD+++ + F+SY GPFNQ++R  +   W+  +  N +P +++ +++  L +   +GEWNLQGLPND LS++N IIVT ASRY L IDPQ QGK WI N+E  H +  T+  +KYF+ H+ED L+ G PL+IED+ EELDP L+N+LEKNFI+ G+  KVKVGDKEVD+ K+F LYITTK++NP +SPE+ AKT+++DF+VT+KGLEDQLLG VI  EK+ELE+ R ++L + ++NKRK++ELED+LL RL +T+GSLVED++L+ VL   K T+ +VS+ ++  AA+TE +IN+AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F +SI +S KS    +R+ +I+  +T  ++ + VR LY+  +  FTLLL LK+D++  ++   E   L+KGG++LDL +++PKP +WI+DMTWLNLV LS LH FS L  Q+  +++ W++WFD+ APE+  +P GYE++L  F KLLLIR WCPDRT+  AR YI  ++G  + E V   + S+  E D +TP+   LS+G+DPT  IE  AK        ISMGQGQEVH+RR++A++M +G W+LLQNCHL +D+++EL + I  S N+   +R+W+T+E H +FPINFLQ ++KFTNEPP+GI+A L+R+++ +TQD L+   +  W+ + +++AFLH TVQERRKFGPLGWNIPYEFNQADF +   F+QNHL+ +  K      G++W C+RYM+ E+QYGGRVTDD D RLL   T+ +F E MF   F       I    T+ EY ++I  LP  D P   GLH NADIS  T     IL TI++IQPKDS  G  ETRES V +   EML+K+P +++  +V   + KMG  QPM IFLRQE+DR+  +I  VR TLTDLKLAIDG ++M++ LRDALD ++DA++P +W++ SW+S TLGFWF EL++RN QF  W  +GRP  FW+TGFFNPQGFLTAMRQE TR +   GW  D+V+L N VTR   E++  PP     GVYIYGLFL+GA WDKRN +++E+ PK+L+  LPV++++A+   T  K+ +   +Y  P+Y+KPRRT+LT+I    L   ++ +HW +RG+A+LCD K
Sbjct:   12 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIVLDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMTDCGTPHKELRMNPKAITASQMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKKLPASQAELILNFF-NTF-----YSRLKYIYLTEKVIG-------------------------------RLFVFAVMWSVGALLELEDRSRMEMFLR-NHPAALDLPNTQQDQ--TIFEFVVNEAGEWDPWSVKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSPAKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLVKGVAWEEYFVDFLRDAPEITGDEPEDTEVVIPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTRTYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTIDNLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHFLSGYSLQCSEEVKQSVIGTMGTFQDLVAQTCTEYFQRFRRQTYVTPKSYLSFIKGYQTIYSEKIGNVRTLAERMNTGLDRLKEAEQAVNELSKALAVKEKELEVASKKADAVLQEVAVKAQAAEKVKTQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALAAAEAALQTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSASRYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVGEELDPVLDNILEKNFIRSGSTYKVKVGDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTSTQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLINIMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNISHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHPFSRLPSQVSQNDRGWKSWFDEAAPEEAPLPDGYESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGVILDMDSMCTENDKRTPMTCFLSMGSDPTENIERLAKSKGFPCRPISMGQGQEVHARRLLAQSMADGGWLLLQNCHLGLDFLDELLETINTSENIAESFRVWVTTEVHPKFPINFLQSSVKFTNEPPQGIKAGLRRTYSSITQDQLEITNMPQWRPLLFAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLEDVDVKL-----GVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCFYRGYTIPNAKTLPEYHSHIDALPLVDTPEVLGLHPNADISCQTNMASEILSTIINIQPKDSSGGGDETRESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSEDLRDALDSVYDARVPKLWQRSSWDSATLGFWFTELLERNQQFHSWTFNGRPHQFWLTGFFNPQGFLTAMRQETTRMNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYAVSSATDPKRPQGVSLYPCPVYRKPRRTDLTFIFTLFLRTVQNPDHWTLRGLALLCDCK 2646          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2011.5 bits (5210), Expect = 0.000e+0
Identity = 1194/3575 (33.40%), Postives = 1955/3575 (54.69%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEE-YIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDV--FSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSH-WESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLK-TIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLD--SFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFF---INPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPK---DSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGR-PVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN----LTYIANAELVCSK-SAEHWIMRGVAMLCDI 14099
            Q K  +  + +++E+ K+Q+ ++  + +    ++  +  +  +  +W   KD+ +  +   +P VS FD  I  Y  + + +  E        + L    LK  L+     W+  + +  ++     ++++ +F +D   RLS+  + L ++   +  L+ ++ +  +I+  I PI E +A+L +YE+ V+++  + ++ L   WQ            L   + +F+S L  + + FKK      +D++++GP    +    A +++ + + + ++L+    T   G  +F         +++++K+++ L +++ +        + +    +  +  E + +          KL + LKD  W   E  +  I+ F   +P++  + +PAM+ RHW ++       FD  S  F L  I+   L +  E I +I  +A KE  IE  L+ +   W    L    +K++G        T E+   +ED+ + LS++ ++R+   F+K++      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F +I+ SW  IM R +++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++ +     A   +S +GE +E   PV  E  VE WL  +    + +L   +R    ++        +++  +P Q+ +   Q+ WT D T+ L+  K  +D+  ++   ++ + +L+        +L K+ R K   L+T+ VH +D+ D+L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCSD +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F+F   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++R  P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+  I  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+ K+    +L KAL+     GEP      E  +NPKA++  +++G  D+STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E   +  LF         +   +    +   E   V   C L + L   ++     D+    R+  E  +IFS++WSI A ++ + R K++ ++R    ++   P     ++DT+++Y V ++N  W  +  K+ + + YP ++ P Y  I+VP VD VR  FL+N++   +  VLL G  GT KT +    L   +P      ++N SS T     Q  IES V+KR   TY P  G+KM  F+DD+NMP ++++G Q   E++R  I+   +Y      D    +D+  +A+M  PGGGR  I  RL+  F + N T P  + I  I+   G     K + F+  V  + S L   T +L+ +   +  PTP+K HY+FNLRD+S+++QGL+ +  D   + + + RLW+HEC RV SDRL+D++D + F   +   L     + + +  P  ++  F DFL++                P +YE +  F+ LK  +    + YN T    P++LV F DA+ HV ++ RVI   +GN+LLVG+GGSG+QS++RLA++I +Y+ FQ+ +T+ Y    F ED+K +YR  G +NK TVF+F D +I DES+LE INN+L+SG +  L+  +E +E+ S +    +K      +T + ++ Y ++RVR+NLH+VLC SP+GE FR R   +PAL +  T++WF +WP++AL+ VA+  L    L   + ++ K+  +   +HQ V  FS  +K   + +R   +T  +YL  +  YK +    +A +     +++NGL K+ + +  +  +S ELE  ++ ++    + E  L  + +Q   A+  +  V    +K  A   K +   + A+  L  A PAL+EA  AL ++   D++ ++   +PP L++ +M  V+IL              +G + +W E+ + L  +NF+  L+ F +D I++ ++  +  Y T+ D+  E   +       LC W +AME +  + R V P +  L      LA+ Q  L  AE    E EE L  +K +YD  + +K+ L   +     K+  A +L++GL  E+ RW       E  +G LVGD ++ +AF+SY GPF   +R ++ ++ W    R+  VP +   +    LS P  + +WN+QGLP+D  S EN +IVT+ +R+ L +DPQ Q   WI N E++  +   +     F + LE+A+  G P++++++ EELDP+L  +L K+F  IG  + +K+GDKEV+ +  F  YITTKLSNPH++PEI  KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   ++ KRK++ELED +L  L    GSL++D  L+  L  +K T+ +VS Q+  +  TE +I+ ARE YR  ++R S+L+F++ D+  ++PMYQ  L  +++LF  SI +S++S  ++ RI ++    T  ++ +  R L++  +  F+  +  K+      +  +E +  L+GG  LD +  +D     W+ D  W N+  L KL  F GL+       K W  W+    PE+  +P  +E + +E +K+L++R    DR       +I   LG  F+E     + ++  ++  KTPL+ +LS G DPT  +   A+   +      +S+GQGQ   + R+I + ++ G WV L NCHL + ++ +L ++++  +  + +  +RLW++S  H +FPI  LQ  IK T EPP+G+++N++R +  +T+      S  V++ K++F SL F H  + ER+KF  LGWNI Y FN +DF      +  +LD        +   I W  ++Y+I+ + YGG VTDD+D RLL      YF E      FF     P   I    + D YR YI  LP  ++P  FG H NADI+     T+ + +T+LS+QP+    +  G G +RE  V +   ++  K+P   + ++  +K+ +     P+N+ L QEI R + ++H +R +LT+L+  I G+VVM+  L +   CI DA++P +WEK       L  W  +L  R  QF  W      PV FW++GF  P GFLTA+ Q   R H+  + D++     V+      L  PPK+GV+I GL+LEGA WDK+N  L+EA+P  L   +P I+   ++ + K  +     MY  P Y  P R+      +++   +L     S EHWI RG A+L  +
Sbjct:  911 QRKPVHNIIEQDEEICKIQAAIAAGMTANASHLQAYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG--------TEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDIC-LVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRM-VELWFIFSLIWSICASVDEDGRKKIDNFLR---EMEGTFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNA-PFY-KIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWY------DRQMKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIF---GTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPIFGDFLKE----------------PHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARK--ENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKL--ELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLF-SLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLD--------EYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVP-ELVDYESTQKLLQDDP-SPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNV-SVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAK----NMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSL 4405          

HSP 2 Score: 84.3445 bits (207), Expect = 3.807e-15
Identity = 69/276 (25.00%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  498 QCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMN-----IVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKI 1310
            Q   F+R  + T I E +    V F ++ G +     +E  +  +M  H   +       E  +++    MN    F+  L++ R  +  +  L +           P++ +         + E + ++E  +  W +QI++VL   + +    D+ GP  E+D+WK R +  + +  QL+ P V     ILQ AKS  +  +  + ++I D   +A+ N+ FL  L E C  L    P  +   +  +I+  R+I   S YYNT E++T+LF K+
Sbjct:  141 QLAYFIREEE-TVIMEESFESSVQFGIVRGGD-----MESLLRLMMGIHASQVALSTAWPESIKNNYSTHMN---RFLTNLTDTRYKLVGKTVLYI-----------PVEALQHSPEVAARDKELVKRMEVVMIHWTRQIKEVLNAQETVEI-GDSSGPLEEIDFWKSRCSDLSGISQQLQKPGVLHIQAILQLAKSSYVPPFCRLAKQIQDGTQQAQSNLSFLSLLREPCEELALLKPREVEPKLAHIINVSRVIWVNSVYYNTRERLTTLFRKV 395          

HSP 3 Score: 64.3142 bits (155), Expect = 4.924e-9
Identity = 63/292 (21.58%), Postives = 128/292 (43.84%), Query Frame = 3
Query: 1641 FNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKH--YSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEA-KVIIKNYNKLAETLISFEIIYHQAWVRQIN-STHTGLNSSLIIRHPETKELY-VNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTS 2501
            F+  +  ++      LD R T +   ++ F  ++++L   + N ++  F  + S    +Q L  F+ L+       E   + L+    DV A++    Y  NKE             +  WAR + RRIQ  M++  +++ + L   E  K + +   +L + L       +  W + ++  +   LN  L+IR  E   +  +NFD ++L +  E     +L+ EIP        ++  L+     ++L+V    ++ +++  +   L   R+  L + ++PGL+   W+S
Sbjct:  435 FDKSLQVLRSVRKGILDVRNTSWHDSYNRFRAEVKDLEVMMQNLINTAFKTVNSVEEGVQLLDVFQHLSA-----REAIKRTLSRKTVDVYAMLSKEVYLVNKE-----------LSQAHWARAMQRRIQGQMQVCVLENAHFLPQIENDKKVREACMQLLQKLDELVRRMYSEWSQSLDRGSLKNLNQPLMIRCKEKAGMLDINFDKNLLKMFNEMYYWERLQFEIPHHVSEAYQRREDLRTMRENVLLVVRDYNRIISALSADEVGLFRERIRFLDKKLQPGLSKLLWSS 710          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1910.96 bits (4949), Expect = 0.000e+0
Identity = 1180/3542 (33.31%), Postives = 1932/3542 (54.55%), Query Frame = 3
Query: 3615 RFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYS-----GGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRN--ILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHEL----HFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-KQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKS-DRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFV-------VRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRS-------NNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKM-FSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKV-GDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI---QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQE---PMFQP-DFFINP--IQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGA-FQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTE-ELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAM 14087
            R+  Y  LW   K   +E+F    P    +D  +K Y  +  ++  +    D   + L  E L   +    +AW    G+  N   + ++  + +  + L + L +    L+D++  +  +  IR+  + +++    I+E Y  L  Y + V ++E +    +R  W  L S   QV   L   +  F     E +  +K++   F E ++  GP   G       D L   + RY + E   I        G E+LF L +T Y +L ++++E+  L+++Y +Y     +   +   LW +++I+ +      F    RKLPK ++  P    L   + +F   +PLL  + N A++ R+      L  H + +    + L++  ++ +P               VKE         V   W   +     +F   + RG +L   D   EI   ++D+ + L S+  +R+  PF   IQ     LS  SE+IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F +IDK + KIMS    +  + +CC+    LS L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI +++F      ET+  A  S EGE +EL++PV AE  VE W+  +L   +R+   + + A       +  V   L+ Y   V L G Q+ WT +  +      S +++ M+Q  ++    ++ L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D   V     +F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+IF GL+Q G+WGCFDEFNRID  VLSV + QI  + +    + K+F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P   E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E      P  V K++Q++ET   RH  M +GP+G GK+  I+ L +A T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   +   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P I    ++ +    + E L+  V       V Q   +L+ L+  +D      +S    E  +I ++  S+GA L    R K +  ++         +   L  P        T+FD+       +W+ W+S V +YI+  D+  ++  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT     +L++ NP++ M  ++NFSS T     QR++E+ V+KR   TYGPP G+ + VF+DD+NMP ++E+G Q    +++  ++  G Y   K  +   + DL F+AAM   GGGRN++  R    F +FN   P   ++  IYS I  GH    R F   + NM  KL   T +L+++    + PTPSKFHY+FNLRDLSR++ GL  T ++   +  + +R+W +EC RV  DRLI+E+D    + +I+  + +    E      +   F D+ R A    E          P++YE +  ++  K       + YNE    + +NLV F DA+ H+ ++ R+IRM +G+ LLVGVGGSGKQS+T+LA+F A    F+I ++R Y+ +NF EDLK++Y   G ENK TVF+FTD  + +E +LE INNML SGM+  LF  +E + +L+ +  +  K    H  ++E+++QYF+++   NLH+VL  SP+G+  R R   FP L +   I+WF  WP +AL  VAQ  L + P++      E ++  + ++H  V      +  + RRS  +T K+YL +I  Y T+ Q     +    +R++ GL KL+EA   +  L+K+L  ++  L+  S+  E++L  ++  T  AE  K        +     + I V+++ AE  L  A PAL+ A  AL  +  +D++ +R   KPP  +Q + +C+L++             R   + +W  +  +++  NFL SL+    D I+   +  ++ +    +   E  +      +G+  + +A+  +  V RE+ P ++ +A       +++ +L+  +  L   ++ L  +  +Y  A+  KQ L+ +A +  +++  A++L++GL  E  RWT    E + +   L+GD ++ +AF+SY G FN  FR +M +  W+  +   G+P+++   I   L++  +I  W  + LP D+LSV+N I+ T+ASR+ + IDPQ Q  +WI  KE ++++  ++F +  F + LE A+  G P + +D+ E +DP ++NVLEKN +K   G +V V GDKEVD    F LY+ TKL+NP +SP ++ K  VI+++VT+KGLEDQLL +++  E++ELE  R +L+++TS NKR +K+LEDSLL  LA + G+++++  L+  L + K  + +V  ++  A  T  +I++ R+ YR  +KRG++L+F++ +++ VN MYQ  L  FL +F  S+ +S  +  + +R+ +I++ +T+N++N+    L++  +  F+  + +K++       QEEL   LKG  +L+ K+   KP  W+ D  W ++V L++L  + F  L+E I  + K+W+ WFD D+PE    P  Y   L  F+KLLL+RC+  DR       Y+  T+G+ +++       ++  ++   +P++ +LS G +P   +   A++      ++  ++MGQGQE  + +++  A+  G W++LQNCHL + ++ +L + ++  T  +  +RLW+T++    FPI  LQ ++K   EPP G++ N++ ++  +  + L S     ++ + Y LAF H  VQERRK+G +GWN+PY+FN++DF  C   +  +L   T   +     I W  ++Y+I E+ YGGR  D FD R+L V    Y  +     FQP  FF N     +I    + + Y   I +LP  + P  FGLH NA+I Y T+  + +   ++ +QP+    G G +R+  + +   ++ +K+PS    F +     K+G    P ++ L QE++R ++++  +  +L++L+ A+ G V M+  L +    +F+ +IP +W K++ ++  +LG W I    R+ Q+  W+  G P   W++G   P+ +LTA+ Q   R  +GW  D   L   VT + +E E+ E P +G Y+ GL+LEGA WD   G L+ +KPK L   LP++ +  ++    + Q        +P+Y    R N   +  +  A+L  ++   HW+++GV +
Sbjct:  896 RWKRYHPLWNLDKSIMMEKFAAKKPACVTYDEKLKFYSNIGQEVAQQPLVKDVHVVRLDLEPLAHTVQENVQAWVSSLGRLLNDSAREDLYALRSELQQLSENLKKSPDTLEDLKFVLSTISNIRDMSVDVELRFRDIQERYRTLTMYNIQVPEEELQLAANIRNMWSDLFSESRQVDRSLGRAKKTFTEITKEQIVQYKQEVAIFAESFNMHGPGAVG-------DNLDKGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEVYK---AAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDRY------LFLHCYRL----YLLKDWSLIGSP-------------QGVKE---------VVDTWEVMKFSVQRYFKGTQERGYILGSVD---EIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLD-YQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQF-EGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPED------LSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDT--KFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH---TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRDPILFGDY-RTALSESE----------PRVYEDIQDYDACKALFQEILEEYNEN--KTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGH--SKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAH-SETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVM-------------RGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKN-VKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLE-KSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYL---TKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPS---AFDLDVIRKKLGPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCR-RNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQ----NTLRTPVYTTSMRRNAMGVGLVFEADLFTTEHHSHWVLQGVCL 4335          

HSP 2 Score: 159.073 bits (401), Expect = 1.070e-37
Identity = 152/670 (22.69%), Postives = 302/670 (45.07%), Query Frame = 3
Query:  783 VCTEIDLKRIRLPIDCMNIVNNTEQLMK-------VEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAAN---EAKDNVKFLYTLEEHCAPLYQNNPALMI-DNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFD---TFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGL-NSSLIIRHPETKE----LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-----NDVPVTVDEFVNNTQELCIKAAKLL 2720
            +C  + L  I+L I  +++    E L+        +E CV  W  QI  VL E  + + +A   GP AE+D+W++R A  + L +QLKLP VK  + ++  A+  T++    +D  +T+  N   EA +NV FL TLE H   L      ++I + IP++++ ++++  IS +YNT E+M  L  +I  ++       +   N   ++    E    ++L   ++   +++C+ E + R+     + ++E     +F K D   + C+ L +++++                   ++   +NV  S ++       D RR       DD +R +  L                     I+ L  F+  +I   G    +  ++  +   VE +   +   +E+PPV++  P +AG + W R LF RI+ P+  F+ +   +L   + K + + Y ++   +  +E+   + W ++       L N +L++    + +    L VNF P++  +  ET  + +L   +P  A N+ ++++      ++L  +V     + +S+      L+  ++ +LRR++  G    NW S+ + E+I      + + E L+ + +      +D  L+++ T  L + P      D+P  V EF    ++  +K   LL
Sbjct:  123 ICVVLSLGGIKLHIPELDLKQEVEALLANQEAVEILEQCVMNWQAQITIVLEEQQKKKPQAP--GPLAEIDFWRERAAALSALSEQLKLPVVKKILEVMTRAEPATVQN---LDLTVTELNNYLVEAVNNVDFLSTLERHFKNLATGVSFIVILETIPQMMNGLQLVWIISSHYNTDERMVPLMERIAWELSERVARVV---NIRLLFKERREVAKAKVLDGKKVLDQWKSCYFEVRARIETSGTDPRWEFDRKKLFEKTDYMASICQDLYNVLQV-------------------TLDEFYNVFGSEMRAVTR---DSRR------IDDVVRWVDSL------------------VVPIEEL-NFDPFDIRKTG---SWKMVMKDFRSKVEVINSMFVEQRENPPVSKIYPPVAGAVYWERLLFHRIKDPIIRFQ-ELPEMLDNEQGKSVTEKYLEVGRRMRDYEVKKVEGWRKETERMLPELMNRTLLLTVDSSGDRGIRLVVNFAPELKEIISETIYLDRLGYAVPELARNVALQEHRFLRCVDELKNLVKRCHSLMDSLNDAEFLLLTPQVQELRRVLRAGWRRLNWNSLGIAEFIGRSEQAVTKFESLVSQIKK-NARDVDAKLQDIETANLFKFPAPDKAGDLP-GVKEFFELVEKQRVKDVILL 731          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3591.2 bits (9311), Expect = 0.000e+0
Identity = 1850/3526 (52.47%), Postives = 2471/3526 (70.08%), Query Frame = 3
Query:  180 KIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKET---GDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDED--SRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIR----LPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKV-----IRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAE----SNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEK 10700
            + K  R  +R +LD RH+YL+ ++AD    +   VE++IL   + E +  FF ++ +  L F  QE    ++T     ++ +   G   S V   ++FIT G +    G C  F+R+++   I+   +A+++NF V+    G +LQG+E ++S +M+P  ++ +  WG ++  E+  +    ++S+  F+  LS  R++I ++V L    E DL  I     +P  C   V NTE + ++E  + +W+KQIEQVL ES+QIR+EADN+GP AEL YWKKR ++FN LL++LK   V+   G+LQAA+S++LK W E+D RIT+ A+EAKDNVK+LY+LE+   PL + +P  +   I  L+S++RM+H+IS+YYN+SE MTSLFVK+TNQMI +CKAY+     + +W  + + L++R+ +C  LN+ YQ CF ETK  L    + RQFE SE YIFGKFD+FC RL  +  + + +++ + L    IEG++ + +++  + +  K K Y+ LD R++EF  D+ +F  Q + L+ ++  F+D  F     T + ++ L +FER+    L + EKY  +L  Y RD++ V + Y + K++PP+ R++P ++GKI WARQLFR+I  PM+ F    +++L+T E K+ ++NYNK+A  L+ FE++YH+AW R ++     L SSL++R+P+ KE +VNFD  I  L  E   + KL  ++P A INL  K+  +K  H +L+  +    +  +SIP   + LM   +A +   I PGLT  +WTS+ +  YI+ +   + +L+    +  D+ + R++  L +MS   L  LP + P+ +  F+  T+ +   A K L ++S  VE SV +L+++L  +          +   +S    R S                   G ++  ++   +  +I +A   L +H+ ++    ++K+      R +L++LR+R+      A    V+    P F     L IPN+++ P+++++Q ++N+   +++ ++K IS W       KQ                   +ID              Q  S+  S  GT   P +  +    +  DE+ +   +N     +   K + E+K+V KV   LS+ ++  R E    +  FS +S LW++  +  ++EF+  DP +SEF+  +  Y  LE Q+     ++  GP+   TE LK+ L+ E + W+  +G A N K  A  +++  F+E + K L+R I DL+D+R AM AL E+R  EI+++  I P+EE++AML +Y+L  +    +RVD L Y W+ LM++  QVQ+ L+ +QP  +++L+  V  F KD   F  DYD  GP   G+ P+EASDRL + Q ++D+L R+F TYSGGEELFGL VTDY +L+ I++EL LLQKLY LYN VI SV+GYY+ILW D+DIEKI+NEL +FQN+CRKLPK LK+W AFEDL+K ID+FN   PLLE+M N AM  RHW+R++++T H FD+ESD FAL+NI+EAPLL FK++IEDICISA KE+DI+AKLKAV +EWS+    F  FK+RGELLL+G  T+E +++MEDSLM+L+SL+SNRYNVPFK  IQ  V KLSN++EIIE WM VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE   ++ CCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDPHTIQ+HLL +FDN+  V FHEK YE IL+  S EGE++ L +PV A+     NVE WL  LL   + ++H VIR A   I D  F + EF   +PAQVGLL  Q++WTRDS  AL NAK+DRKIM  TN++FL LLN LI  TT DL K ER K+ETLITIHVHQKDIFD LV+  +KS +DF+WLKQ+RFYFVE+ D+C++ ITDVDF Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK ++ QFVFTDGD+V+M+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELE AI  Q   A ++ HPPWVLK+IQL+ETQRVRHGMM LGPSGAGKT CIH+LMKA+TDCGEPHREMRMNPKAITAPQMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+++ WL    + +  ++     + F D+  +    +  KM+ LE   ++QA +LL+GL+P  DE+   ++   H +RL +FS+MWS+GALLE+EDR ++EA++R++ +  LDLP    D  D++F+Y+V ++G W HWN++V E+ YP+D+ PEY +ILVPNVDNVRTDFLM  +  QEKAVLLIGEQGTAKTVMI  Y++  + E H+ KSLNFSSAT P MFQRT+ES+VDKRMG+TYGPPAGRKMT+FIDDINMP+INEWGDQI NEIVRQ +E  GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+     GH+C ER F   V  +   L+  TR+LWQ+TK KM PTP+KFHY+FNLRDLSRIWQG++   S+V  SS  LL L+ HEC RV++DR   + D  WF   +   + D              YFVDF+RDAPE   E  DD+    PK+YEP+PSF  L ERL  F   YNE+VRG+ ++LVFF DAM+H++KISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT++R YN++N +EDLK +YR  G++ KG  F+FTDNEIKDE++LEY+NN+LASG ++ LF+++E+DEI   +   +KK  P+ P T ENLY YFL RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WFQ WP++AL  VA H L ++ + C   VK  +VD +AV    V   C++YF ++RR   +T KSYLS+I  YK++Y    ++V+LL+ERM+ GL KL+EA++++  LS+ELE+KE+ L+VAS  A+ VL  VT +  AAE+VK +V+ VKDK  AIV++I  D+ VAE+KL AAKPAL+EAE AL TIKP DI TVRKL KPPHLI RIMDCVL+LF++++D  +P+ ER  ++ SW E+ KL+    FLNSLLTF +D INEE++DLL PY   EDY+LE AR  CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   LA AQ +L  A+  L EK+  L  V+  YDTA++ KQ L  DA  CR+KM+ A  L++GL  EK
Sbjct:    9 QTKVTRDERRVQLDGRHKYLISKLADVLGQDEAAVEDAILADERFEQIKDFFVANGSKRLMFFCQESTQPRDTLYSRGEMSVSHVG---SNVSHKRLFITTGADEAFAGTCYFFLRTTEKA-ISTANMAQEINFGVLECPEGDILQGVESFLSSLMIPALKS-QETWGVIKSGENDPAVEVFLDSVNYFMQSLSGVRQNIQQKVQL---MEADLGTITYLCCIP-HCPVTVGNTEMVERLEAALRVWMKQIEQVLVESEQIRKEADNVGPSAELVYWKKRTSRFNSLLEELKSERVQKVTGLLQAARSRSLKHWKELDSRITEEASEAKDNVKYLYSLEKFFGPLAKYSPVSIKSGIEGLMSNIRMVHTISRYYNSSEHMTSLFVKVTNQMIATCKAYLHQGGGK-IWDHDWDNLLQRMSECIRLNEEYQHCFHETKQHLRQSNNPRQFEFSENYIFGKFDSFCMRLRKLSDMLQTMQSLAGLQHVRIEGIDKIFLRYQALATNTKAKTYDVLDHRKSEFDIDYKEFCSQTEGLYQSLQTFVDSWFGDALKTEKMLELLGKFERIAGGRLQLMEKYQLVLHRYARDMDMVRRTYQKQKQNPPIPRNIPPVSGKIMWARQLFRKIDIPMK-FLNNKRDVLQTSEGKITVRNYNKMAAVLLEFELLYHRAWSRAVDLVRNSLLSSLLVRYPKKKEFFVNFDLAIFELLMEAKHLHKLGFQVPEAVINLCQKEQQIKHHHTRLLEALQEYTQAVSSIPPILQPLMTPCVALVEDAILPGLTIISWTSLNIDTYIEEIQAAVVQLKQTTKQVVDIMECRVEATLYDMSFTPLLTLPEEEPLDMLAFMAATETMVASATKSLATQSDFVEKSVLDLLDLL--KSACRAPTTTSQGRSVSATRRRSSAVSVQ------------FPGTANTTQEPWGLATNIIQAEVFLSIHYIYKTWSCLLKLSVRAGTRRSLDALRRRLQTAGPYAEQQRVQQGHMPLFCTEIILAIPNVLLKPSLDDLQSSLNKAVNVMLGMAKDISVWKYAHLQQKQQQVR---------------LID--------------QGSSQQNSSLGTYCCP-QLEMQVARELGDENIVIKQIN----PRTLDKQITEHKDVGKVMFHLSSVLSFLRVESTEVLKNFSCFSSLWSQEPEEMVKEFMTTDPTMSEFNAQMVYYAQLEQQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPGEAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADER---RLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPS-HLDLPGSAND--DSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2631.67 bits (6820), Expect = 0.000e+0
Identity = 1300/2025 (64.20%), Postives = 1608/2025 (79.41%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQ--SITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 10853
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q  ++  +    A ++ F +T +  Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2021          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2627.43 bits (6809), Expect = 0.000e+0
Identity = 1302/2027 (64.23%), Postives = 1604/2027 (79.13%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSI----TRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 10853
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q I     R  S  A         +R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPASRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2023          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2608.56 bits (6760), Expect = 0.000e+0
Identity = 1305/2034 (64.16%), Postives = 1609/2034 (79.11%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFG-LRNIL-SVLRTLGQQK--RANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKI-SRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCF-QITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLL---NERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIR 10853
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G L NIL S++ +L      R           +R LR+  LS  +D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+ VIG GHY   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS + LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK  ++++     +  + GV     Q I    +F   +  F QIT++R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+  +  V ++    +RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR  +   W+  ++
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILENILLSLIHSLSDSVIIRHLTAKPWAKRTLRALRNTGLSTPIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVVRHDAQHIQFDLTFSTLFPVFTQITLSRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKRLCVCVIYTWGDRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2032          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2577.36 bits (6679), Expect = 0.000e+0
Identity = 1292/2038 (63.40%), Postives = 1591/2038 (78.07%), Query Frame = 3
Query: 4791 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNL-----SKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKK--------------------LLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPP--NERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFR 10817
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+T+EII+ MEDSLM+L SL+SNRYN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T G      P  ++      V R + +     + L+D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQ +E +GFY+L+KPG+F +++D+ FVAAMIHPGGGRNDIP+RLKR   IFNCTLP+ ASID+I+  +    +   R F   V  + ++L+  TR+LWQ TK KM PTP+KFHYVFNLRDLSRIWQGL+NT +DV+SS ++                    LLRL+ HEC RV++DR     D  WFE  +     +       +     ER +FVDFLRDAPE   +  +D+ F +PKIYEP+ S++ L++RL+ F + YNE+VRG+ ++LVFF DAMLH+VK   V+ +   N+ L+   G   Q +  L           I + R Y+ +N LEDLK +YR AG++ KG  F+FTDNEIKDE++LEY+NN+L+SG ++ LF+++EMDEILS +   MKK  P+ P TQENL+++F+ RVR NLH+VLCFSP+GE+FR RAL FPAL SGCT++WF +WPK+ALV V++H L  + + C   VK+++V  +      V   C  YF ++RRS  +T KSYLS++  YKT+Y+     V  L  RMQ GLQKLKEA E++  LS ELE+KE+ L VA+ +A+ VL  VT +  AAE VK +V+ VK+    IV+ I VD+ VAE+KL AAKPAL+EAE AL TIK +DI+TVR L +PPHLI RIMDCVL+LFQ++++P   D ER  V  SW ESLKL+ + NFL SL  FP+D I EE+++LL PYF   DY+++ ARK CGNVAGLC+WTKAM  F+ +N+EV+PLK +L  Q   L  A  DLQSA+  L  K+  L LV+  Y+ A++ KQ L  DA  CR+KM TA+ L++GL  EK RWT  S EF +QI  LVGD+++ +AF+SY GPFNQ+FR
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDNTTEIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCG------PPISDARDRYNVFRPLAVNAETKANLIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGSLANSRFIAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPEESTAVDLCPVIRPAPPDRPQLLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDM--LCDIDVRSANHTIYLLRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFR 2026          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 385.571 bits (989), Expect = 3.988e-107
Identity = 306/1087 (28.15%), Postives = 532/1087 (48.94%), Query Frame = 3
Query: 4236 EDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRM-SDLTSHHFD---VESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEI--WLMGLLNMAQRSLHGVIRAANNSIND-TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFY----FVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTE----QTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIIS----HPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRT---LKGK-KGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPL 7421
            E +    P+ P L P EA   L         L+++  + +   ++  + V    +L  + +E+     ++    ++   V   ++  W  VD+  + ++L  F  R  +LP+ +K +  ++ L   ++   S+  +L  + + A+KPRHW  +  D+         ++   F+L++++   L   +  +  I   A KE  IE  L  +K  W   E  +   ++   L L  +      +  ED   ++S   SN Y + F++D  D+ SKL+  SEI   W+ VQ  W+ L  +     DI   LP E  +F ++   +  I +RA +    ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F +I+++ F E   + I    S+EGE L L + ++ + +++   WL  L    + S+    R     + D T+  V+  ++ Y  Q  LL  Q++WT    + L   +  +   +   +   LL  L             + K E L+  ++H  ++  QL     K  +   W K  +FY     ++D++   +S +     Y+ E++G  ERL+ TPL    + TL  +L    GG   GPAGTGKTETVK  G+ LG+ VVVFNC D  D++ L R+  G++Q G+WGCFDEFNR+D  VLS  +  I  + +  +  K      + +   ++P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF D+  LA K     +L   + +   HY FGLR +  VLR        +P  +E    + TV+  L+ + L  L D DE +F   ++ +F     D  G P    AI + + +A   S       ++ K +Q +  Q+ +  ++ +G +G GKT     ++ A+    G  +    ++ K +T   ++G +  +T +W DG+F+++ RR    + G  K   IW+V D  +D  ++E +NSVLDDNK LTL NG+R+P+ P+ +I+FE  N+D+ +PAT++R G+++ S+   D C +
Sbjct: 1166 ESWSVRKPISPTLTPPEALKILEFFNESITKLKKKMHSVAAAAKMLLIPVVLNDQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWK--EAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKI-FEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIE-VIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLE---DFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVV--VSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNV------KKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEE-TPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRN------CSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIF-----DSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFST---DVCSI 2222          

HSP 2 Score: 305.064 bits (780), Expect = 9.310e-83
Identity = 310/1392 (22.27%), Postives = 625/1392 (44.90%), Query Frame = 3
Query: 7890 ILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIE---SFVDKRMGSTYGPPAG-RKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGG-GRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGL---INTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFEL---LKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIH-----QDVFSNCLKYF--NQYRR-SVQITQKSYLSYIDLYKTMYQTTKASVSLL--NERMQN-GLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFP---------RDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVEN-AIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSV--IDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQR-RIQHIISCMTVNIWNFIVRSLYKIDR--TTFTLLLALKVDMENNSVRQEELNVL 11954
            I++P +D ++ + +   + + ++ ++L G  G+ KT+++N  L  +N   +    +NFS  T        +    ++V    G T  P +  + + +F D+IN+P ++++G Q     +RQ +E +GF+   +   ++++  +H V A   P   GR  + ER  RH  I     P+  S+ +IY +     +     FRS            +  L+   K +   T  + HY+F+ R+L+R+ +G+   INT      + + L+RLW +E  R+ +DRL+   +   FE+ +   +D       +  PN+              +   +   +  +   ++ V   +L   ++ER   F     E      + +V     + H+++I R ++  +G+++L+G   +GK  +TR  +++      Q  I R  NL++F   LK        +   T  +  ++ I + ++LE +N +LA+  I  LF  EE D++L+ +  +  +       T++ LY +F+  +  NLH+V              +  PAL + C INW   W  + +  VA + +   P+   DF+  ++   L         +D   N L +F  N Y++  V +  +S   +ID  + + +   A    L  N+R  N GL+KL E+   +  L+K L  K   L+    EA + L  +  +   +E  +     +K       E IR  ++V  + +   +P + EA+  +  IK   ++ +R +  PP  ++ +M+ V  +   +              ++W +  + +   +F+++++ +          R  + EE +    P FT E   +  A K+CG    L  W  A   F  V   V PL+  +        K + +L +AE++  + E  + + K +Y   I+  +A++++ +  +  +  +  L+  L  EK RW   + +F      L+G+ ++ S + +Y G  N++ R  M    + ++    V  +     ++ L   ++  +W   GL  +   +EN +I++         +DP S     I N      ++ + F  + F + LE+A+  G  +II+D  E  DP ++ ++ + F   G  + V++GD EVD+   F L+I +   +P     I+ ++ V  + F    + +E ++  I +  E  E++  R  L+K  +  K K+K LE  LLE L N++G+++E+  L++ LN  K+ + ++  +++++ +   + +   EEY  I K    ++ ++      +  Y   + QFL+ F    I+  +     R R+  I+  +   ++     +L K  +     T+    K D+E+   ++  L ++
Sbjct: 2390 IVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNAL--RNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPE-NKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVPEFRS----YTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPR--QTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVD-------KYLPNQDL----------GNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELE------VPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLR-NKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQF-------------SNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLS--DPNFTYET--INRASKACG---PLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLS-FLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHS--CDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCLYKFDIESEQYKEAVLTMI 3723          

HSP 3 Score: 69.3218 bits (168), Expect = 2.064e-11
Identity = 51/213 (23.94%), Postives = 99/213 (46.48%), Query Frame = 3
Query: 12387 AKKHHIQIGTISMGQGQEV-HSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNV---NALYRLWMTSE-QHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMF-YSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLL 13007
            AK     +  I +G  + + +++  I+K+  EG W+LLQN  + + ++        E T     +  ++++MT     D+ P   LQ   +F  E   GI   ++  +      +    +   W V   + L++ H  +  R +  P G++  Y FN  DF   +++++N L       ++ T+ I W  VR  I+ I YGG++ ++ DL ++
Sbjct: 3804 AKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWG---SQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVL------ATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVV 4007          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 5492.55 bits (14247), Expect = 0.000e+0
Identity = 2712/4654 (58.27%), Postives = 3475/4654 (74.67%), Query Frame = 3
Query:  216 LDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRV-MKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVING-SNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL--GIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVIST----QEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXX------XXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--------PTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNV-SNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            +D RH +L+  VA    L   ++ E++LDGNQIE M+ FF  D    + F++QE +   E  + +R+G  G +++ +  KPKVF+T GK+  L G CV F+R +   QIN   I ++ +F V++   +G+L  +E  +  V +P        WG+L   + S  R   MN LE+FV +L++A+ S+ + V LK C  +DL  I  P D +   +++E L ++E  V  W+KQIEQVLAES+Q+R+EAD++GP+AELD+WKKRMAKFN LLDQ+K  + KA +G+L AAKSK LKTW E+D RITD ANEAKDNVKFLYTLE+ C PLY ++P  M+D IP LI+++RMI+S S+YYNTSE+MT+LFVK+TNQMIT+CK YI+    + VW     EL+++L  C  LN+ YQ CFQ+TK RL   P ERQFE SEMYIFGK +TF RRL+ II++   ++ +  L ++ IEGLE M  K  +I++T+KKK Y+ LD R+ EF  DF++F RQI EL   + NFMD  F+ I ST RA++ +R+FE L +  L   I+EKY +IL ++GRD+E + K Y R+K DPPVARD+P IAGKIAWARQ++RRIQ PM MF+ ++ ++L+T +A+ IIKNYNKL++ L+ FE++YHQAWV+Q+    +GL +SL++RHP+ K+L+VNFDP I+ L RET+ M++L L+IP +A  L  KQ++LK+  + L L++N  ++V   IPQ +  LM   +AK+   I+PGLT  NWTS+ L  Y+DSVY  L ELELL+DRA DL  +RID VLEEMS++ LCELP D P T+++F+  T+ LC + A LL++KS  VE++ NELI ML   E + E  E  ++         +++R      P   S  P  + +  G +         K         +E A ELL +FNHRN++AIV+V R TL+S R+RIAA        P       +  S   P F+ N  LQIPN+ M P ++E+Q  +N+ A  ++SVSKG+SQW +           AL+  EK +D +     +E+  +R  SNV S+ +S SE      + R P            D+     ++    Q  N +KNV+ENKEVAK+ S+LST +NS +KEV TA+  F+ YS +W   +D T+  FL++DPK+SEF+  I  Y  +E  I  E + Y  G IAL TE LK  L +ETKAW I + + CN KY+ EME+IFTF ED+ KRLSR IKDLDDIR+AM ALKEIR  EI+IDM I PIEESY ML RY++P+ ++E+ERVDTLRY+W+KL S  ++ QD+LI IQ  F+  LI+ VQ F  D   F  DY+++GPMVP +PPREASDRLII QNR+D L R++ITYSGGEELFGL VT+Y +L  IK+ELNLLQKLY LYNDVI++VNGYYDILW DV+IEKI+ EL +FQNRCRKLP+ LKDW AF DL+KTIDDFN   PLLELM N AMK RHW R+++LT H FD+ESD F+LRNI+EAPLLK KE+IED+CI+AVKEKDIEAK+K V A+WS  +L F  FKNRGELLLRGD+TSEI+S+MEDSLM+L SL+SNRYN PFKK+IQ  V KLSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRF NIDK W+KIM+RAHEN NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ I+A  S EGE +E+ KPV A+ NVEIWL  LL M+++SLH VIR A  +IND+ FN+LEFLN +PAQVGLLGIQ++WTRD+TEAL NAK D+K+MQQTN  F  LLN+LI+QTT +L +V RTKFETLITIHVHQ+DIFD L +  +++PSDF+WLKQ RFYF +D D C V+ITDV FIYQNEFLGCTERLVITPLTDRCYITLAQAL MSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI ++L+ KKERKKQF+F+DGD+VDMNPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLASCGFIDNI L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E TTVMRVLRDMNLSKL+D+DEPLF+SLINDLFPGI LDK GYPELE AI  + +E  +I+HPPW LKLIQLFETQRVRHGMM LGPSGAGKT CIHVLMKA+TDCG PH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGE IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CKI+FE HNIDNASPATVSRNGMVYMSSS LDW P+++ W+ KR   E  I+   F  S+ ++  +  + L+ KM+ L+   + Q   LL+GLIP+KD  D  Q S  H E LY+FS+MWSIGALLE++DR K+E ++R N    LDLP++ ++  + +F++MV++ GEW HWN++VEEY+YPKD  P++ SILVPNVDNV  D+L+ TV+ Q KA LLIGEQGTAKTVMI  Y+S  +PE H+ KS NFSSA+ P +FQRTIESFVDKRMGSTYGPPAG+KMTVF+DDINMP+INEWGDQ+ NEIVRQ +E KGFY+L+KPGDF ++ D+ F++AMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+SVIG G++CKER F + V +   KL+  TRKLWQ TK KM PTP+KFHY+FNLRDLSRIWQG++NT ++VI+S + L+ LW HEC RV+SDR  ++ D  WFE+ ++  + D    +++   +   YFVDFLRDAPE   +  +D+ F  PKIYEP+PSF+ L+ERL+M+   YN+++RG+ ++LVFF DAM+H++++SR+IR  +GN LLVGVGGSGKQS+TRL+SFIA Y  FQIT+TR YN +N +EDLK +YR AG+  +G  F+FTDNEIKDE +LEY+NN+L+SG ++ LF+++E+DEI   +   MKK FP+ P T ENLY+YFL R + NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA H L  F +VC   +K ++V  + VIH  V + C  YF ++RR+  +T KSYLS+I+ YK++Y   +  +  L +RM  GL KL EA +++  LSKEL +KE+ L+VAS +A+ VL  V+ +  AAE VK +V+ VKDK  AIV++I VD+ VAE KL  AKPAL+EAE AL TIKP  ISTVRKL KPPHLI RIMDCVL+L  KK+DP + D ER  +K SW ESLKL++ ++FLN+LL F +D IN+E ++LL  Y   +DY++E A++ CG+VAGLC+WT+AM  F+ +N+EV+PLK +LA Q   L  AQ DL  A+  L EK+  L   +  Y+ A+K KQ L  DA  CR+KM  A+ L++GL  EK RWT QS EF  QIG LVGD++V + F+SY GPFNQ+FR  + S+W+  +++  +P    +++   + +   +GEWNLQGLPND+LSV+N IIVT+A+R+ L +DPQ QGK WI N+E ++ +  T+  +KYF+ HLEDAL+ G PL+IED+ EELDPAL+NVLEKNFIK G+ LKVKVGDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT+KGLEDQLLG+VI  EK ELE+ R +LL+  S+NKRK+KELED+LL RL +T+GSLV+D++L+ VL+  K T+ +VS ++  AADTE +IN AREE+R ++ RGS+LYFLI ++S VN MYQ+ LKQFL LF  S+  S  SP   +RI +II  +T  +W +  R L++  +  FTLLLA K+D++N  ++  E   L+KGG++LDLK   PK  +WI DMTWLNLV LSKL  FS ++ QI  +EKQW+ WFDKDAPE+ +IP GY   LD F+KLLLIR WCPDRT+  AR+YI  ++G  + E V  ++     E+D +TPL+  LS+G+DPT +IE  AKKH      ISMGQGQEVH+R+++   MQ G W LLQNCHL ++++ EL   + ES +++  +RLWMT+E+H QFPI  LQ++IKFTNEPP+G+RA L+R++  ++QD LD   +  W+ M YS+AFLH TVQERRK+GPLGWNIPYEFNQADF A   F+QNHLD +  KK     G+ W  VRYM+ E+QYGGRVTDDFD RLL    K +F E MF P F       I    +V ++  +I  L   D+P  FGLH NADI+Y +   K  L+TILSIQPKDS  G GETRESIV+K   +ML+K+P ++I  +V  ++ KMG   PMNIFLRQEIDR+ +VI  VR+TLTDLKLAIDG ++M++ LRD+LDC++DA+IP  W+K+SWES+T+GFWF ELI+RN QF  W  DGRP  FW+TGFFNPQGFLTAMRQEVTR+H GWA DSV+L N VTRF+ +++  PP EGVY++GLFL+GA WD+R  +L+E   K+L+  +PVI+I+A+          D ++Y  PIYKKPRRT+LTYIA  +L  +++ +HWI+RGVA+LCDIK
Sbjct:    2 IDFRHDHLISTVASALGLAQDDLTEAMLDGNQIETMENFFKPDGLQKIMFYYQETDNIPEAVEHVRLGPGGAQRTTIKTKPKVFVTDGKDNQLSGACVFFIRINPSKQINTANIYQETSFGVLDTRGDGMLNAVERVLGDVFIPALGK-NSSWGELSDKQGSSVRHEFMNQLESFVAILASAQASLEDAVTLKECDTVDLSNINTPTDFIAAASSSETLEQIEAVVSAWIKQIEQVLAESEQMRKEADDVGPKAELDHWKKRMAKFNSLLDQIKGSDCKAVVGVLHAAKSKLLKTWRELDIRITDYANEAKDNVKFLYTLEKFCDPLYNSDPVGMMDGIPGLINAIRMINSYSRYYNTSERMTALFVKVTNQMITACKNYITEHGYKNVWEYTHSELIEKLGNCIRLNEEYQRCFQKTKQRLEQNPDERQFEFSEMYIFGKINTFSRRLNKIIEMMNTMQKFMTLGESRIEGLEQMWNKVQLIMTTMKKKPYDLLDYRKMEFDADFEEFKRQISELQAQLQNFMDICFEKIPSTQRALRLIRKFESLGLDSLRDTIQEKYERILIYFGRDIETIQKIYQRHKTDPPVARDLPPIAGKIAWARQMYRRIQEPMIMFQ-KYPSILQTSDARKIIKNYNKLSKVLLEFELLYHQAWVKQVEVIKSGLQASLLVRHPDNKKLFVNFDPQIMTLIRETECMVRLGLDIPFSAHALLQKQSSLKKNSDTLQLLLNERERVLGKIPQTFRPLMAPHLAKVEAAIDPGLTMLNWTSLNLDTYVDSVYESLGELELLIDRANDLVAFRIDAVLEEMSSVPLCELPTDTPKTIEQFLKTTEGLCKRGADLLETKSARVEEAANELITMLLELENEEEAKEDEKDKDEEKTGEEEKDRSRSPTRPHTGSSRPGSRASRLGSAAISPAAAAAKRKREMRDYLAEEAQELLSYFNHRNVDAIVRVTRATLDSTRRRIAASAAHHFVKPRSNVEGENSSSFVPPLFKANVTLQIPNVTMQPALDEIQQGLNKAAQCVVSVSKGVSQWDR--------TCRALRKAEKRDDSD-----NEDSRSRSASNVGSDDESRSEAAPTRRSARMP-----------TDDASTVVSMPIFPQKMNYFKNVSENKEVAKLLSMLSTVVNSQKKEVITALELFNKYSSVWQGDRDHTISAFLQNDPKLSEFEAQILHYKEMEQTIVQEPESYSVGSIALMTEKLKSSLCAETKAWCISFSRYCNQKYRMEMEEIFTFVEDMTKRLSRPIKDLDDIRLAMNALKEIRSQEIKIDMNIGPIEESYQMLARYDMPIAREESERVDTLRYSWEKLQSLATESQDHLIGIQSNFKGGLIDEVQTFILDVGSFAGDYNSTGPMVPNVPPREASDRLIIFQNRFDTLWRKYITYSGGEELFGLPVTEYPELMQIKRELNLLQKLYGLYNDVIDTVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDNTSEIVSLMEDSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPIPEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKD--DGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMREN--FDLDLPQVSEN--ENIFEFMVNDAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKK-----GVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAI----NSTGGRDNRLYQCPIYKKPRRTDLTYIACVDLKTNQNPDHWILRGVALLCDIK 4614          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 3952.13 bits (10248), Expect = 0.000e+0
Identity = 1943/3275 (59.33%), Postives = 2480/3275 (75.73%), Query Frame = 3
Query: 2973 ELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAK-PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQIN--AESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQ 12788
            EL+L+FN R  +A+++  RN L+ +++R A    V+  ++V+S  K PFF+    L IP +++ P++E++Q  +N+ A  ++ VS+ + QW ++R                DE D  G                                K  +R   SN + A             ++KN YK ++E+K+V K+  +L++ I+ST+ EV   + +FS Y  +W   K++ ++ F+  DP +S+F   I +Y TLE +I     S     G I L++E LKI L  E + W++ +G + N KY+  M++I  F  D  KRL R I+DL+D+R AM AL+++R+NEIRIDMT+ P+EE+YAML ++E+ V ++E ERVDTLRY+++KL+++   +Q +L+ IQP+F+++L+ +V+I++ +   F  +Y+  GPMV G+ P+EAS+RL + Q+R+D+L R+F+TYSGGE+LFGL VT+Y  L  IKKEL LLQKLY LYN VI+ VNGYYDILW +VDIEKI+NEL +FQNRCRKLPK LK+W AF +L+K IDDFN   PLLELM N AMK RHW+R+++LT H FDVE++ F LRNI+EAPLLK KE+IEDICISAVKEKDIEAKL  V A+W + E  F +FKNRGELLL+G  T+EI+S++EDSLM+L SLLSNRYN PFKKDIQ  V KLSN+S+IIE WM VQNLWVYLEAVFVGGDIAKQLPKEAKRF NIDKSW+KIM+RAHE +NV+ CCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDN+KTV FHEK Y+ IL+  S EGE + LE  V A+ NVEIWL  LLN A  SLHGVIR A ++IND  F ++ F+N +PAQVGLLGIQ++WTRD+ EAL +A+ D+KIM  TN++FL LLN LI  TT +L K+ERTKFETL+TIHVHQ+DIFD LVK  ++S +DF+WLKQ+RFYF ED+D CIVSITDVDF YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ KK+RK QF+F+DGD+VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGFI+N++LA+KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+P D+E TTVMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELEAAI +  ++A +I HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI+VLMKA+ +CG+PHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGE+IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CK++FE HNIDNASPATVSRNGMVYMSSS +DW P+LK WL  R   E  +  +LF   F +++ Y  Q L  KM+ LE  V+ Q  D+L+GLIP K+E     +S  H  RL++F++MW +GALLE+EDR K+E ++  +   KLDLPK+ + S +T+F+++V   GEW HWN++VEE++YP DS P+Y SILVPNVDNVRT+FL++T+A Q KAVLLIGEQGTAKTVMI  Y+S+ NPE HM KS NFSSAT P +FQRTIES+VDKR+G+TYGPPAGRKMT FIDDINMP+INEWGDQI NEIVRQ +EMKGFY+L+KPG+F  ++D+ F+AAMIHPGGGRNDIPERLKR F IFNCTLP+  SID+I+ VIG G +C ER F S V +++ +L+  TR LWQ TK KM PTP+KFHY+FNLRDLSRIW+G++N   D I S K  L LW HE +RV++DR  +E D +WFE+ I   L D+   +         +FVDFLRDAPE   E  +D+    PKIYE VPS E L E+L M+   YN+TVRG  ++LVFF DAM+H+VK+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN  N ++DLK +YR AG + +G  F+FTDNEIKDE++LE++NN+L+SG ++ LF+++E+DEI   +   MKK  P+ P TQ+NLY YF+ R R NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA + L  F +VC   +K+K+V  + V+H  V   C++YF+++RR   +T KSYLS++D YKT+Y   K  +  L  RM+ GL KL EA  ++  LSKEL +KE++L+VAS +A+ VLA VT    AAE VK  V+ VKDK   IV++I  D+ VAE KL AAKPAL+EAE AL TIK  DISTVRKL KPPHLI RIMDCVL+LF++ I   +PD +R     SW E+ KL++S+ FL +L+ F +D INEE ++LLQPY   EDY+LE A+K CGNVAGLC+WT+AM  FY VN+EV+PLK +L  Q   L  A  DL  A+  L EK+  L  V+  YD A+  KQ L  DA  C+ KM  A+ L+NGL  EK RWT QS EF++QIG LVGD+++ + F+SY GPFNQ FR  + + W+  +  N +P  + +++   L++P  IGEWNLQGLP D LS++N IIV +A+RY L IDPQ+QGK W+LN+E  + +  T+  +KYF+ HLED+L+ G P++IED+ EELDPAL+NVLEKNFIK G+  KVKVGDKE D+   F +YITTKL NP ++PEI A+T++IDF+VTMKGLE+QLLG VIN EKEELE  R +L++  ++NKRK+KELED+LL RL +T+GSLVED++L+ VL   K+T+ +VS ++A AA+TE +IN AREE+R ++ RGS+LYFLI ++S VN MYQ+ L+QFL +F  S+  SEKSP   +RIQ+II  +T  ++ +  R LY+  +  FTLLLALK+++++  V+ +E   L+KGG+ALDLK    KP KWI DMTWLNLV LSKL  FSG+++Q+  ++  WR WFDKDAPE+  IP GY+  LD F+KLLL+R WCPDRTL  AR+YI   +G+ + E V   + +   E+D KTPL+  LS+G+DPT  IE  AK+  I+   +SMGQGQEVH+RR+I ++   G WVLLQNCHL +++++EL + +  + N +  +R W+T E H QFPI+ LQ +IKFTNEPP+G++  L+R++A +TQD LD   +  WK + Y++AFLH  VQ
Sbjct:  259 ELILYFNQRTFDALLRATRNALDGIKRRRA--FYVSNALAVESYTKGPFFKAEITLAIPQVIIQPSLEDIQQALNKAAQRVLEVSRSVGQWGQKRFRTLGFY---------DEPDPRGTF---------------------------QHTKKTERAATSNEELAPS-----------KLKNYYKAISEHKDVTKLLMILTSSISSTKAEVMGCLDQFSQYHFVWEGDKESVVKVFVASDPLLSDFKTEILKYQTLEQEIENIPASFRVGHGAIELYSEPLKIALTVEIRGWKLLFGHSINNKYRVCMDEISQFLGDYSKRLGRPIQDLEDVRGAMAALEDVRQNEIRIDMTLGPVEEAYAMLNKFEVAVAREEVERVDTLRYSFEKLLAQARDIQSHLVKIQPKFKADLLGSVEIYQHNVVDFTSNYEEIGPMVGGITPQEASERLSVFQSRFDDLWRKFVTYSGGEQLFGLEVTEYPDLVRIKKELGLLQKLYGLYNAVIDGVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKGGETTEIVSLLEDSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDRILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQELTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCIVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPQDSESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGITLDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGECGQPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQEHDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQCLDILQGLIPSKEEH--GILSASHLSRLFVFALMWGVGALLELEDRAKMEEFLVDHG--KLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRVEEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQITNEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIFGVIGCGWFCPER-FNSEVSDIIKQLVVCTRILWQQTKIKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTVGDDAAGELMAEPFFVDFLRDAPEVTGEEPEDADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPCGNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTRSYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPPTQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYFLSKFEIVCSAEIKQKVVQTMGVVHDMVAEACIEYFDRFRRQTHVTPKSYLSFLDGYKTIYAENKGHIGELANRMKTGLDKLVEATMSVNQLSKELVVKEKDLAVASVKADKVLAEVTVSAQAAEKVKASVQKVKDKAQIIVDEINADKVVAEGKLAAAKPALEEAEAALQTIKAADISTVRKLAKPPHLIMRIMDCVLLLFRRSISNVVPDFDRGCPTPSWGEAQKLMSSSGFLQALMNFQKDTINEETVELLQPYLEMEDYNLETAKKVCGNVAGLCSWTQAMSFFYGVNKEVLPLKANLIVQEARLKVAMGDLNKAQGQLDEKQAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRTLLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNGIIVNKATRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEKNFIKSGSTYKVKVGDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERVKLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQNIIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACPAKPFKWITDMTWLNLVELSKLPQFSGILDQVRRNDSGWRGWFDKDAPEEHPIPDGYQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVILNLEATWEESDTKTPLICFLSMGSDPTGSIESLAKRKGIECRAVSMGQGQEVHARRLIQQSCATGGWVLLQNCHLGLNFMDELLETVTNTENAHETFRTWITCEAHPQFPISLLQSSIKFTNEPPQGVKPGLKRTYAGITQDQLDITNMPQWKPILYAVAFLHTVVQ 3479          

HSP 2 Score: 172.17 bits (435), Expect = 3.971e-42
Identity = 84/197 (42.64%), Postives = 129/197 (65.48%), Query Frame = 3
Query: 2184 GLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            GL +SL++RHP++ ELYVNFDP +  L RET+ MMK+ L++P  A  L M ++ LK+  +KL LM+  +  V  +IP  ++ LM   + ++   I PG+T  NW S+ ++ Y  +VY  L EL+LL+    D+R  RID VL+E+S I LCE+P+D P T DEF+  TQ++C +   +L  KS  VE++V+EL+++ 
Sbjct:    6 GLQASLLVRHPDSGELYVNFDPQLYQLIRETECMMKMNLQVPNNAKLLYMNRHQLKKTSSKLKLMLEEVVSVKANIPNIFQPLMAPHIERVDAAISPGITMLNWNSLNIENYCKNVYTRLRELDLLIKTVNDIRDSRIDSVLKEISEITLCEVPDDQPWTTDEFITKTQKICNRVGGILDKKSLQVEEAVHELVDIF 202          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 3599.68 bits (9333), Expect = 0.000e+0
Identity = 1783/2867 (62.19%), Postives = 2228/2867 (77.71%), Query Frame = 3
Query: 3501 QMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDD---SEVVEFRDPPNERTYFVDFLRDAPE-TVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIV 12089
            Q K+ +K V+E+K+V KV  +L++ I++ + + +  +     +  LW +  +  + EF++  P +S+FD  IK Y  LE QI     +Y  G +   TE LK  +++ETKAW+  +GKA   K  A+ME+IFTF ++L KRL+R I DLDD+R +M AL EIRE+EI+IDMTI PIEES+AM+ RY L     + ERVD L Y W+K+ ++   V  +L+ IQPEF+++L++ V  FK     F EDY   GPMVPG+PPREASDRL I Q R+D L R++ TYSGGEELFGL VT+Y  ++ I++EL LLQKLY+LYN VI++VNGYYDILW ++DIEKI+ EL +FQNR RKLPKGLK+W AF +L+KTIDDF+   PLLE+M N AMK RHW R+S +     DVES+ F LR ++ APLL  KEEIEDICI+AVKEKDIE+KLK V  EWSA    F  FKNRGELLL+G  TS+I+S+MEDSLM+L SLLSNRYN PFK +IQ  V+KL+ S+EIIE W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRFS IDKSW+KIM RAHEN NV+QCCVGD+TL QLLPHLLEQLEICQKSL+GYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL VFDN+KTV F EK+Y+ ILA  S E E + LEKPV A+ NVE+WL  LL  A  SLH VIR A+  I D  F ++EFL+ YPAQVGLLG+Q++WTRD+ +AL +A+SD+KIM Q N+ FL +LN LI+ TT +L KVER KFET ITIHVHQ+DIFD LV+  +K+PSDF+WLKQ+RFY+ E+ D+C+VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGM+MGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERKKQF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLA+CGFI NIVL+ KF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP D+E   VMRVLRDMNLSKLVD+DEPLF+SLI+DLFPG+QLDK GYP++E AI + ++EA +I+HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI++LMKA+T CG PH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKG+HIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP+CK++FE HNIDNASPATVSRNGMVYMSSSALDW P+L+ WL  R+S E  I+  LF   F D+  +    ++ +ME LE   + QA +LL GLIP +D    +  S  H E+L+IFS+MWSIGALLE+ DR K++  + +  ++K   P +    +DT+F+Y+V++ G+W HW+ +VE Y YP DS PEY  ILVPNVDNVRTDFL+N +A QEKAVLLIGEQGTAKTVM   Y    +PE H+FK++NFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMT FIDDINMP+INEWGDQI NEIVRQ +EMKGFYSLDKPG+F S++D+ F++AMI PGGGRNDIP RLKR F +FNCTLP+ ASID+++S IG G++ K R F   V+NM+S L+  TRKLWQ TK KM PTP+KFHY+FNLRDLSRIWQG++   S+++ + K LL LW HEC RV++DR  ++ D  WFE+++   +++   +EV    DP     YFVDFLRDAPE T +   +D+ F  PK+YEPV +FE L ERL  F + YNETVRG  ++LVFF DAM H+VKISR+IR  +GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR YN++N ++DLK +Y+ AG E KG  F+FTDNEIKDE++LEY+NN+LASG ++ LF+++E+DE+ + +   MK  +P+ P T ENLY YF+ RV++NLH+VLCFSP+GEKFR R+L FP L SGCT++WF +WPK+AL+ VA + L  F + C+  VKE +V+ + + H  V   C +YF ++RR   +T KSYLS+I  YK +Y    + + LL  RM  GL KL EA E++  LS+EL IKE+ L+VAS +A+ VL  VT   TAAE VK++V+ VKDK  AIV++I  D+Q+AE KL AAKPAL+EAE AL TIKP  ISTVRKL KPPHLI RIMDCVL+LF KKIDP   D +R  VK SW ESLK+++   FL +LL FP+D INEE ++LL PY   EDY +E A+K CG+VAGL +WT+AM  FY +N+EV+PLK +L  Q   L KA  +L  A+  L EK++ L  V+ +YD A++ KQ L  DA  CR+KM+ A  L++GL  EK RWT QS +F+ QI  LVGD+++ + F+SY GPFNQ+FR  + S W+  +R   +P ++ I++   L++   IGEWNLQGLPND+LS++N IIVT+ASRY L IDPQ QGK WI  KE  + +  T+  +KYF+ H+EDAL+ G PLIIED+ EELDPAL+N+LEKNFIK G   KVKVGDKEVD+   F LYITTKL NP ++PEI A+TS+IDF+VTMKGLEDQLLG VI  EK+ELE  R +L+++ + NKR++K+LED+LL RL +T+GSLVED++L+ VL+  K TS +VS ++  AA+TE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ LKQFL +F  S+  S+KSP   +RIQ+II  +T  ++ +  R  Y+  +  FTLLL LK+D++   ++ EE  VL+KGG+ALDL  ++PKP KWI+D+TWLNLV LSKL  F+ ++ Q++
Sbjct: 1062 QAKSLFKIVSEHKDVVKVVIVLNSIISTFKADAKDLLSEMDQFKELWNEDPNTKVHEFMESKPLLSDFDAQIKYYQHLETQIEDLPSFYRIGSVIYLTERLKEAVVTETKAWKQSFGKALAEKASADMEEIFTFIDNLNKRLARPITDLDDVRGSMAALGEIRESEIKIDMTIGPIEESFAMMNRYGLHFSSSDAERVDGLTYAWKKVNTQAGVVAAHLLKIQPEFKADLLDGVTKFKVLVQNFVEDYTEKGPMVPGIPPREASDRLAIFQARFDELWRKYETYSGGEELFGLEVTEYPDVQRIRRELGLLQKLYNLYNSVIDNVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKGSDTSDIVSLMEDSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQLLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDEKEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRELTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWREETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRANPEDSEDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGLQLDKAGYPDIEQAIAQCVEEAKLINHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMTICGAPHKEFRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTESEILFNLFEQLFDDVQNFLTVSVVPRMELLECNYIVQASNLLNGLIPGEDAPKQADAS--HLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLK--WPPV--SGQDTIFEYVVNDQGDWQHWSERVEAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQITNEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTKVKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEVSAMIDP---EPYFVDFLRDAPEPTGKSHPEDAEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDLISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYFLSSFDVKCKPEVKEAMVNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSYLSFISGYKQIYSQQHSDIDLLATRMNTGLAKLVEATESVAKLSEELVIKEKELAVASRKADVVLQEVTVSATAAEKVKSQVQKVKDKAQAIVDEIAEDKQIAEGKLEAAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLFMKKIDPVQQDPDRPCVKPSWGESLKVMSQGGFLTTLLNFPKDTINEETVELLAPYLEMEDYTMENAKKVCGDVAGLASWTRAMAIFYGINKEVLPLKANLVIQEARLNKATTELNVAQAQLDEKQKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFSEDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKASRYPLLIDPQGQGKAWIRTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEKNFIKSGKTYKVKVGDKEVDVMDGFRLYITTKLGNPSYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTSTQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQNIIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIKGGAALDLNAVEPKPKKWILDLTWLNLVELSKLPQFTSILGQVI 3919          

HSP 2 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 400/1041 (38.42%), Postives = 639/1041 (61.38%), Query Frame = 3
Query:  162 LTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDL----KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDIS------VKSSAKPF---FRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQW 3242
            + E+Q + K E+  ++S +D RH Y+  +++D   ++   VE+ IL  ++   +D+FF++D    L F++QE  L        R+ L+   Q+     K+FI+ G    L G C+VFMR S    I    IA++V+F+  + S G +L+G E+ +  +M+P  +  +  WG++       +  + SLE FV +L+ AR +++ RV L    + DL      ++ P D +   NN + + K+E  +  W + IEQVLAES+Q+R+EAD+IGP AEL++WKKRMAKFN LLDQ+K P  KAA+G+L AAKS++LK W E+D RITDAANEAKDNVK+LYTL++   PL + +P  MI+ +P L++++RMIHSISQYYNTSE+MTSLFVK+TNQMIT+CKAYI N     +W    E L  RL +C +LN  YQ CF +TK +L   P ERQFE SE YIFGKFD FC+RL  I  +   ++  S +    IEG+E++ V++  IVS +KKK Y+ LD R+ EF  D+++F   I++L N +  F+D  FD   ST R+++ L +FE +    L + +KY ++L  YGRD+E   K Y + K DPP+ R++P +AGKI WARQLFRRI  PM +F+ +  +LLK  EAK I+KNYNK+A  L+ FE++YH+ W R + +  +GL +SL++RHPETKEL+VNFDP I+ L +E   M +L LEIP +A  L++K+  +K   N+L+ ++     V + IP+ +  LM   + ++   ++PGLT  NWTSM + +YID++   +  LE L    +D+++ RI+ VLEE+ +  LC+LP +  +TV+EFV  T++ C+ AA++L      + +++  +         + +     E    S +    ++K++ +     P+++ A+     P+ K  +    ++ +   L++ +N R ++A+V+  R +L+++++R+        +         K S   F   F+ +  L+IP+++M P+++++Q  +N+   +++  ++ I +W
Sbjct:    1 MKERQKQAKAEKEGRKSTMDTRHAYIFTKISDTLGMDPNLVEDFILGDSRFPQIDEFFATDGIKKLMFYYQECNLR-------RVDLS--TQASNSHKKLFISTGNTEKLTGTCLVFMRMSNSKNITTANIAQEVSFMQFDASKGNILEGFEKLLGGIMIPALQK-QENWGEMSTQISQVQEFLESLERFVSILNGARGNLSGRVQL---GDHDLGPLLDSLKTPTDYVMAANNPDVVDKLEGLIAHWARDIEQVLAESEQMRKEADDIGPTAELEHWKKRMAKFNVLLDQIKSPHCKAAVGVLHAAKSRSLKQWKELDSRITDAANEAKDNVKYLYTLDKFFGPLIKCSPTEMIEYVPSLMNAIRMIHSISQYYNTSERMTSLFVKVTNQMITTCKAYI-NRGVVKIWEHPREVLSGRLNECIKLNDEYQRCFHKTKQKLRENPKERQFEFSENYIFGKFDAFCKRLEKIDDMLTTMENLSGICKVKIEGIETIIVRYTTIVSNVKKKAYDLLDHRKGEFDSDYEEFKESIEQLKNQLQMFVDSWFDKSLSTMRSLELLNKFENIAGVQLYLHDKYQRVLLQYGRDLETCRKIYQKQKTDPPILRNLPPVAGKITWARQLFRRIHEPMLIFKTK-SDLLKGEEAKRIVKNYNKMASVLVEFELLYHRGWFRAVEAAKSGLYASLLVRHPETKELFVNFDPQIVELIQEAKCMARLNLEIPNSAQVLRLKEEQIKSSSNRLVDVLKDYNHVVSGIPEVFVPLMKPFLNRVDETVKPGLTMLNWTSMNIMQYIDNIQVSIRGLERLTKEIKDIQECRIEAVLEEIGSTPLCDLPEEDAITVEEFVETTEKTCLSAAEVLSRYVTQICNAIKHVSRRSSRIPNNQQSSAYGELVETSVEVLLETLKRNLTAAEIQPLEK-ANYPCMFPESKQAKNNKCMACSYWNLIVTYNQRTIDALVRCTRLSLDTIKRRMHTANKYIGENGQGRAALFKVSHNHFLCVFQADIVLEIPSVLMKPSLDDIQQALNKAVQIMLKTTQSIPEW 1025          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1988.39 bits (5150), Expect = 0.000e+0
Identity = 1213/3586 (33.83%), Postives = 1950/3586 (54.38%), Query Frame = 3
Query: 3516 YKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTF----KNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAA-NNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK-SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKR-NSNERPIMLELFTNSFPDIYRYSIQYLI-----YKMETLEAF----VVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDL-------PKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLD----DSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMF-SHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLK-VKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI---QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNT------------------VDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINK-MGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFY-TEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTN---LTYIANAELVCSKSAEHWIMRGVAM 14087
            + +++ +  + ++ + +S  + +T   +   + R+  Y  LW   K   + +F   +P    +D  ++ Y  L  ++  +    D   + L  + L   + +  +AW    GK  N   K  +  +    E L   L R    L+D++  +  + +IR+  + +++    I+E Y  L  YE+ V  +ETE V+ +   W  L     +V   L++++ +F     + V  F  D  KF E + N GP   G       + L   Q  Y+  E+     +  E LFGL++T Y +L+ ++KEL  L++++ +Y     + + + + LW ++D+  +S+ +  +  + ++LP+ +K  P    L + + +F + +PL   + N A++ RHW+++ D+T   FD+  + F L+N+    L  F + I DI  SA KE  IE  +  V   W+A +     +    + RG +L   D   EI+ I++D+ M L S+ ++R+  PF + +      LS+  E++E WM VQ  W+YLE++F+GGDI  QLP+EA++F +IDK++ KIM+   +N  VL+ C     L QL   +    + CQKSL  YL+ KR  FPRFFF+SD  LL ILG + DP  +Q H++ +FDNI +++F E   +  LA    S EGE+++  + V AE  VE W+  +L   +R+   + + A  N  N  +   +E++  Y   V L G Q+ WT +  +     K  D+  M+    +    ++ L+ +  ++L K +R KF T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D  ++     +F Y  E++G   RLVITPLTDR Y+T+ QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MDF+ +G+IF GL+Q G+WGCFDEFNRID+ VLSV + QI  + +      K+  F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V  +VPD Q I  + L S GF+   VLA+K   LYKL   QL+KQ HYDFGLR + +VL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI DLFPG+   +  YP    A+   + +   I  P    K++Q++ET   RH  M +GP+G GKT  I+ L  A T  G   +   MN KA T  +++G LD  T DWTDG+ S ++R   K   K E  ++V DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMVY+    L + P  + W   R N+ ER  +  LF    P      ++ ++      K++T+       +V Q   +L+ L+P  +   S+ +     E ++I S++WS GA L  + R   +  I+    I  +        P     ++ T+++Y   S+   WV W   V EY++  D   +Y  ILVP VD VRT +L+  + +  + VLL+GE GT+KT     YL   + +  +  ++NFSS T     Q  +E+ V+KR   TYGPP G+++ VF+DD+NMP ++E+G Q    +++  +E  G Y   K   + +V D+ FVAAM  PGGGRN++  R    F +FN T P+  S+ RIYS I  GH    + F  ++ ++V  +   T +L+ +    + PTPSKFHY+FNLRDLSR++QGL  T  D   S  K +R+W +EC RV  DRL +E+D +     I   +D    +   +  RDP      F D+     E             P++YE V  ++  K       + YN  +  +P+NLV F DA+ H+ +I RVIRM +G+ LLVGVGGSGKQS+T+LA+F A    F+IT+TR Y+ N+F EDLK +Y   G ENK  VF+FTD  +  E +LE INNML SGM+  L+  +E + I+  V  +  K     P  +E+++QYF+++  +NLH+VL  SP+G+  R R   FP L          K P                    D  +E +VD +  +HQ V +    +  + RR    T K+YL +I  Y  + +     V     R++ GL KL  A E +  L+++L +++  ++  S   E +L  + + T  A   K      K + A   + I V++  AEE L AA PAL+EA+ AL  +  +D++ +R   KPP  +Q + +C++ L             R   + SW  +  +++  NFL SL     D I    +   +      +  +E  ++     AGL  +  A+  +  V RE+ P ++ +A        ++ +L+  EK L   EE L  +  +YD A++ K +L+ +A +  +++  A++L++GL  EK RWT    + + Q   L+GD ++ +AF+SY G F   FR  M    WE+ +    +P++K   +   L+N  ++ +W  +GLP D LS+EN I+ TQASRY L IDPQ Q  +WI  KE ++++    F +  F + LE A+  G P++ +D+ E +DP ++NVL+KN IK   G + V +GDKEVD    F LY+ TKLSNP ++P  +++  V++++VTMKGLEDQLL +++ +E++ELE  R +L+++TS NKR +K+LED+LL  LA ++G+++++  L+  L   K  + +VS ++   A T  +I++ R+ YR  +K G++L+F+++++S VN MYQ  L  +L +F  S+ +S     + +R+++I+  +T+N++N+    L++  +  F+  + +K+   +  ++QEEL+  LKG  AL+ K+   KP  W+ D  W +++ L ++   VF  L + I  +EK WR W D DAPE    P  YE  L +F++LLL+RC+  DR  +    ++   +G+ ++        S+  ++   +P++ +LS G+DP   +   A++      ++  ++MGQGQE  + +++  A+  G W++LQNCHL + ++  L +V++  +  +  +RLW+T++   +FPI  LQ ++K   EPP G++ NL+ ++  ++   L       +  + + L F H  VQERRK+G +GWNI Y+FN++DF  C   +  +L   T    +    I W  ++Y+I E+ YGGRV DDFD R    + K Y  E  +  DF  +  Q    +N                    D Y +YI  LP  + P  FGLH NA+I Y T   K +   ++ +QP+ +    G +RE  + K  +++  K+P    P    +++ K +    P  + L QE+DR + +I  +  +L +L+ A+ G V M+  L +    +F+  IP +W K++  +  +LG W      R +Q+ KW+NDG P   W++G   P  +LTA+ Q   R H GW  D   L   VT+++  +E+ E    G ++ GL+LEGASWD     L   KPK+L + LPV+ +  ++    K Q      + +P+Y   +R N   +  +  A+L  ++   HW+++GV +
Sbjct:  815 FTDISASPAIIELVTTVSKSVQNTLGTLNKYLNRWKRYRLLWKLDKSNMVMKFAAKNPTCIAYDEKLQFYSNLVLEVGTQPMSRDVEFVRLNLDPLATTIQANARAWVKELGKMLNESAKDNLMTLKGEIETLCTDLKRAPDTLEDLKFVLRVIADIRDMSLDVELRTADIKERYRTLKMYEIEVSDNETELVNGIDQLWDDLFVESRRVDYSLVSVKMKFTEITQDQVSNFTSDISKFKESFINEGPSSIGTDLDAGVELLKKFQEEYNTFEKERQELTNAERLFGLSITMYPELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVD---EILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEK-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCN--QITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQF-EGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAE--SSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDL--KYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHL---QPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDP----CLFGDYRNTLTED------------PRLYEDVVDYDATKAIFEEILEEYN--MDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANK--AGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGLND--------KIP--------------------DQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVAL-------------RGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKN-IKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALE-KSSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYL---TKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRR----VVKTYMDE--YMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKLP----PLFDVDRVRKNLSEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKH-GWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQ----NTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCL 4304          

HSP 2 Score: 166.007 bits (419), Expect = 3.161e-40
Identity = 127/571 (22.24%), Postives = 263/571 (46.06%), Query Frame = 3
Query:  927 QIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP-ALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFD---TFCRRLSSIIKIFEIIKTYSVLTD--ASIEG----LESMGVKFNVIVSTIKKKNYNFLDQRR-TEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMK----ILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPET------KELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQ 2576
            Q+++     GP AE+D+W++R A  + + +QLKLP VK  + +L    S+ L  +      +     EAKDNV+FL TLE H   L       ++++ IP +++++RM+  IS++YN  E+M  L  +I  ++       +   N  T+    P  + ++  +  +  +T++  + + + ++ +   + ++E     +F + D   + C  L  + ++ E  + Y++      ++ G    +E +  + + +V  I+   ++    R    +    D F R++  + N   +F+D  F  + S   A   L  F  +   +  I  + MK    IL  +G++                   + P +AG I+W R LF RI+  +  F+ + +++L     K   K Y  +A  +  +E   ++AW  Q+ +         ++  P T      +   V+F P++  +  ET  + +L  ++P  A N+ +++    ++ + L LM+     VT S+     QL+   + +L+R+++PG    NW S+ + +Y+      + + E L+++ Q
Sbjct:   88 QLKKTPQGSGPLAEIDFWRERNATLSAIAEQLKLPTVKKIVAVLTKVNSENLANFEYHRAELNKYYTEAKDNVRFLSTLERHFKNLAHGASFNIVLETIPSMMNALRMVWIISRHYNRDERMVPLMERIAWELSERVAKTV---NIRTILKEPPYVVKQKTSEARDTLRTWKESYFDVRAKIESSGRDARWEFDRKRLFERTDYMASICEDLQEVAQVME--EFYNIFGPELKAVTGDPKRIEDVLKRVHELVKPIENVAFDPFSLRHLASWRNVMDWFHREVNAIENEAKHFIDNSFKSLRSAEGAFDMLLNFRHIRSRE-AINSQMMKKFNDILVQFGKE-------------------NQPPVAGAISWERSLFYRIKRTILRFQ-EMEDMLNNEHGKQASKKYLSVARLMKEYEDKKYEAWREQVEANLLIYLKKNLLTKPSTSSATTHRSYVVDFAPELAEIITETKYLEQLGFQVPELARNVALQEEKYLKYVDGLKLMLERYHTVTGSLDVAETQLLDDNIKELKRVLKPGSKRLNWNSLGISDYVTRCGQAIGKFESLVNQIQ 632          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1837.77 bits (4759), Expect = 0.000e+0
Identity = 1079/3222 (33.49%), Postives = 1769/3222 (54.90%), Query Frame = 3
Query: 3525 VAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELT---EFQ-----NRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLE-LFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIH-YERL----YIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVS-ENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRD--PPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKM-FSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLK-TIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHI--QIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQ--ESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIH----WKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFF 13061
            +  ++E  K+Q+ +   +++    +++ +  +  Y  +W   KDA +  + + +P VS FD  I  Y  + +    E    +   + L    LK  LLS    W+  +          ++ ++  F +   K+LS   + LD++  ++  L++++ +   I+    P+ + +A+L +YE+ + ++    +D L   W             L   + +F++ LI + + FKK  +  ++D+ + GP    +  +EA +++  +  +  NL+ +  +   G  +F +       L++++K+L  L+++++        V   ++ LW    + K    +T   E Q      R  K+ + +KD  W   + ++  I+ F   +PL++ + N AM+ RHW ++       FD   D F L  I+E  L +F E+I +I  +A KE  IE  +  + + W    L  G +K+RG   L+   T E+   +ED+ + LS++ ++RY   F+ ++      LS   E++E  +TVQ  W+YLE +F+G DI KQLP+E+  F +++ +W  IM R +++ N L+       L  L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIKT+K         + E +   YS EGE +E    V  E  VE WL  +    + +L  +++     +  +     +++  +P Q+ +   Q+ WT D  +AL ++K   D+K ++   ++ + +LN   +     L K++R K   L+TI VH +D+ ++L+K      + F+WL Q R Y+ +D+D C+V  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS       +FVF +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + SVLR  G++KRANP  +++  ++  ++DMN++KL  QD PLF  +++DLFPGI+     Y +L  AI  ++ +      P  +LK+IQL+ET+  RH  + +G +G+GK+    VL  A+T     GEP     RE  +NPKA++  +++G  D++TN+WTDG+ S++ R+T   +K E  W++ D PVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY     L W P +  WL +R   +    L+ LF    P +  +   +    + T E   V   C L + L     E++  ++S    Y R+    ++F ++WS+ A ++ + R K++ ++R    ++   P     ++DT+++Y V  +   W  W  K+        S P Y  I++P VD VR DFL+  +   ++ VLL G  GT KT +  K L   +P+ +    +N S+ T     Q  IES V+KR    Y P  G++M  F+DD NMP  + +G Q   E++R  I+  GF+          V D+H +A+M  PGGGR  I +RL+  F + N T P  + I RI+   G     K + F   V  +   +   T +++ +   KM PTP++ HY+FNLRD+S+I+QGL+    D+  +   + RLWVHEC RV SDRLID +D + F   +   L     + F +  P  +   F +F++D                  +YE +  F+ +K  +    + YN       INLV F DA+ HV +I RVI   +GN+LLVG+GGSG+QS+TRLAS+I +Y  FQI +T+ Y    F +DLK +Y  AG +NK TVF+F D +  +E +LE +NN+L+SG +  L+  +E +E+ + +     K       T E+++ +F++RVR NLH+VLC SP+G+ FR R   +PA  +  TI+WF +WP +AL+ VA+  L +  L  E+  K  +  +   +H+ V     +   + +R   +T  +YL  +  Y+++    K  +     +++NGL K+ + +  + ++S ELE     ++    + E  L  + +Q   A+  +  V+   +K A   +K RV  + A+  L  A PALQEA  AL ++   D++ ++   +PP L++++M+ V+IL Q +               +W E+ + L   NF+  L+ + +D + + I+  +  Y  + D+  E   +       LC W +AME +  + R V P K  L      L + Q  L  A+  L E  + +  +K +YD    +K+ L + A +   K+  A +L++GL  E+ RW       E  IG LVGD ++ +AF+SY GPF   +R ++    W + +R  GV  N        L+ P  + EWN+QGLP+D  S EN ++VT+ +R+ L IDPQ Q   WI N E +  +   +     + + LE+A+  G P++++++ EELDP+L  +L K+ +K+G    +K+GDKEV+    F  YITTKLSNPH++PEI  KT++++F+V  +GLE QLLGIV+  E+ ELE  ++ L+   +  K+K++ELED +L  L   +GSL++D+ L+  LN +K TS +V+ Q+  +  TE +I+ ARE YR  ++R S+L+F++ D+  ++PMYQ  L  +++LF NSI +S++SP +  RIQ++    T  ++ +  R L++  +  F+  +  K+      +  +E N  L+GG  LD +  +D    +W+ D +W N+  L KL  F G+V       + W  W+    PE+  +P  +E   +E +++L++R   PDR    A  +I   LG  F+E     + S+  ++  +TPL+ +LS G DPT  +   A+   +  +   +S+GQGQ   + R+I + +++G WV L NCHL + ++ +L ++++  +  + +  +RLW++S  H +FPI+ LQ+ IK T EPP+G++AN++R +  +T+     F   H    +K + + L F H  + ERRKF  LGWNI Y FN +DF      +  +LD        +     W  ++Y+++ + YGG VTDDFD RLL       F +   Q  ++
Sbjct:  748 IERDEETKKIQTSIKAGMSANASHLQSYLSTWDGYREIWEIQKDAFIRRYQRLNPPVSSFDADIARYTEIANNFQKEETVLNIDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWT--------VTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLK--QTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAV-GMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVF-EGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDAL---ATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLRE---LEGQFP-----AKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFY-KIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDY-GFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIF---GTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMKD----------------DTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAK--EDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEE-TKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSE--------------PTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITE---QQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLD--------EYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYY 3896          

HSP 2 Score: 96.2857 bits (238), Expect = 4.116e-19
Identity = 55/209 (26.32%), Postives = 109/209 (52.15%), Query Frame = 3
Query:  717 LENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAY 1343
            L  F+  L++ R  +  +  L V +E         I+      N E + ++E  +  W +QI++VL+  D     A+N GP  E+++W+ R A  + + +QL  P VK     L+ +KS  +  ++++ + I D +++A+ N+KFL TL+  C  L Q  P  +   +P+++ ++RM+   S++Y + E++T +  K+    +   + Y
Sbjct:   27 LHKFMANLTDTRYKMQGKTVLYVPSE------STTINIEQASKNKEFVQRLEAAMIHWTRQIKEVLSSQDTFE-TAENSGPLEEIEFWRSRCADLSGISEQLDKPGVKRIQATLELSKSSYVTPFLKLSKLIQDGSSQAQSNLKFLSTLKGPCEELAQAQPKDVPAMLPRILHTIRMVWMNSEHYRSRERLTGILRKVCEGQMHFARMY 228          

HSP 3 Score: 77.7962 bits (190), Expect = 1.484e-13
Identity = 72/296 (24.32%), Postives = 128/296 (43.24%), Query Frame = 3
Query: 1650 IVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDL---GIEEKYMKILTHYGRDVEAVIKHYSRNKED-PPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKE--LYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEY 2519
            I+  +KK     LD + T +  DF+ F   +++L   + N +   F+ +T+    ++ L  F+ L+  +     I++K +++   +  ++  V K ++    D PP+    P  AG  +WAR L RRI   M +   +   L +      I   Y +LA+ L  F       W   ++     L    ++R    +   L +NFD  +L L  E     KL LE P     +  K+  L+     ++L+V    ++   +  E   L   R+  L + I PGLT  +W S  + +Y
Sbjct:  263 ILKAVKK---TILDVKATTWHDDFNRFRAGVKDLEVMVQNLIASAFETVTTVEEGVEILDIFQHLSTREAIRRTIDKKTVEVYQLFNEELNLVKKEFNTKTVDLPPL---YPKYAGSASWARMLKRRIDKSMNVLS-KAFFLPQIGSGDEIRTQYQQLAQALDEFVRKTFNEWTATVDKDCGRLLEIPLMRRSAERAGTLDLNFDKVLLKLFNEIHYWEKLMLETPHYVSEVYQKKEDLRILRENVLLVVRDYNRIIAVLSPEERGLFRERIRSLDKKIHPGLTKLSWASKGISDY 551          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4388.18 bits (11380), Expect = 0.000e+0
Identity = 2346/4656 (50.39%), Postives = 3098/4656 (66.54%), Query Frame = 3
Query:  183 IKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSN-GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEP-EELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXX---XXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIE-ESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVS-SEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLI-MARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPF--KVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKI-SWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            +KEER AKR++LD RH Y+L  +A    LE  +VE++IL+G QIE M++FF +D  + L F+ Q+             G TG  + +    KVF+T GK   L G CV F+R++    +    I +D++F +++ +  G+ + +E+ +S V +P  +    GWG+L+  E    +   ++  E+F  VL  A E I E+     C   D + ++ P D     NN  ++ K+E C+  W++QIE +L+ES+Q+R+  D++GPRAEL+YWKKRM++F+YLL+QLK P V+  + +L  AKSK ++   E+DRRIT A+NEAK+NVK++Y+LE    PLY+ +P  ++  +P LI+++R IH++S+YYN SEK+T+L            +AYI        W  +  +  M+++LK   +  TY +  Q++K                                                  IEGLE++  +F  I+ ++K K+Y+FLD   T F  DF+ F ++  ELH  +  FM+   ++I  T RA+  L +FERL IPDLG + KY  IL  YG+D+E V   + + K DPP  RD+P +AG+I WAR L RRI  PM  F+                                       Q+     GL ++L++R  ET EL+VNFDP++LI   ET+ M ++ L+IPP A  L+ K+  LK+ ++++                           ++   I+PGLT   WTS+ + +Y+      L +LELL++R  DL +YRID +L+EMS + LC LP D PVT +E V+ T+ELC K A+ L  KS  VE + NELINML         +   E  +IS                KT + Q+  TG S    K K+       + E A +LL HFNHRNL+A++K+ RNTLE LRK                 ++  FR +  L IP+IV+ P +E+VQ  +N+    ++SVSKG+ QWSK+R +  ++    + S E+D                      N++S +E ++ +       +   GS S        SA++   +  +N YKNV+ENKEV K+ S+LS+ I ST+K                          F + +P +S+F+  I  Y  LE +IN+E  Y + G +ALFT      L  ET  W   Y   CN KY+ E+E+I    ++  K+L+R IKDLDDIRIAM A+ +IR+++I I++ I PIE ESYAML +Y+ PVQK+E E+V+TLR  W KLM R ++VQ  L T+QP+F+  L  N+ + +++C  FY+DYD                             + + TY  G +LFG+ VT + +L  I+ EL LLQKLY LYN+VI +VNGYYDILW +++IEKI+NEL +FQ  CRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++                               EDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD TSE+I+ +EDSLM+L SL+SN YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLT YLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTD                           ET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFK L+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KK EHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+    WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T ++VI+S   LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD      E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+T +YN  N +EDLKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV  + H L  F + C   VK ++V  +      V   C+ YF                                      M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LV D+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQ                                              T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK                                     SLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR  + RGS+LYFLIT++S VN MYQ+ L QFL LF  S + S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KG S LDLKT   KP +WI+DM+WLNLV LSKL  FS +++Q +S  EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+   AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF  +V E++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K  SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A      +   +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:    3 LKEEREAKRAQLDGRHDYILNTLALCLGLEKDDVEDAILEGVQIEHMEQFFVADGLSHLMFYHQDN------------GPTGGGKKK----KVFLTDGKTVELTGMCVFFIRTNTAKPVTSENIHRDISFNMLDTTEVGLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIKEEYISLFESFASVLVGAEECIKEK-----CDTFDTQALKTPADYTAAANNNTEVKKLEACMKGWIQQIELILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIE---EIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDPVAIVKAVPSLINAIRTIHNVSRYYNDSEKITTLL------HYQQWEAYI-------FWKFDAFQSRMEKILKMFNIISTY-SVLQDSK--------------------------------------------------IEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSELHRQLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQ---------------------------------------QVTDARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKKNNSQM---------------------------QVDEAIQPGLTYLTWTSLNIDKYLRDTKKAL-DLELLMNRVNDLVEYRIDTILQEMSMVTLCVLPEDNPVTCEELVHTTRELCKKQAQNLHYKSMLVEKAANELINML-------MDEHQSEGHLIS----------------KTTLPQSGSTGPSPSLVKRKKKMDLKDVMEEEAQKLLSHFNHRNLDALLKMTRNTLEMLRKHF---------------SQAVFRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLGKMDERCMISLEQD----------------------NSESAAEDVATT------HRSLAGSIS--------SASVIQAFPFRNYYKNVSENKEVLKLVSILSSSITSTKK--------------------------FNQTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFT------LTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEQESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYD-----------------------------KVYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQT-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT-------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSN-YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEK-YDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDP-PEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLT-LYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ---------------------------------------------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKR------------------------------------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLS-LASSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGAS-LDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYG-INQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA------ENNVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4159          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4275.7 bits (11088), Expect = 0.000e+0
Identity = 2105/3533 (59.58%), Postives = 2694/3533 (76.25%), Query Frame = 3
Query: 3522 NVAENKEVAKVQSLLST---CINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            ++  N  + KVQ  L+    C+ S  K V             W+K + + +   L  +P +S+F+  I  Y  LE +IN+E  Y + G +ALFT  LK  L  ET  W   Y   CN KY+ E+E+I    ++  K+L+R IKDLDDIRIAM A+ +IR+++I I++ I PIEESYAML +Y+ PVQK+E E+V+TLR  W KLM R ++VQ  L T+QP+F+  L  N+ + +++C  FY+DYD  GPM  GL P++ SDRLI+ QN++DNL  ++ TY  G +LFG+ VT + +L  I+ EL LLQKLY LYN+VI +VNGYYDILW +++IEKI+NEL +FQ RCRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++++T H+ DVES+ F LRNI+EA  LK+KEEIEDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD TSE+I+ +EDSLM+L SL+SNRYN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTDRCYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T ++VI+S   LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD PE   E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR+YN  N +EDLKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+ H L  F + C   VK ++V  +      V   C+ YF +YRRS  +T KSYLS+I  YKT+Y   +A V      M  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQGLPND+LS+ N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK E+E  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KGG++LDLKT   KP +WI+DM+WLNLV LSKL  FS +++QI   EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+  AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF+V +++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A     +    +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:  616 DIVINPALEKVQEALNQIVECVVSVSKGVGQ-----------WSKDRLSLVR--LTTNPLLSKFESQIVYYQDLETKINSEPDYINVGALALFTASLKTSLTVETMQWMNDYQMCCNKKYQQELEQILAIIDEAGKKLNRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMK-SWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-----ENNVVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 4113          

HSP 2 Score: 482.641 bits (1241), Expect = 1.469e-135
Identity = 252/600 (42.00%), Postives = 381/600 (63.50%), Query Frame = 3
Query:  594 GVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDS--RRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNY 2387
            G+ + +E+ +S V +P  +    GWG+L+  E    +   ++  E+F  VL  A E I E+V  + C +   + +R PI        T  L  V H          Q+L+ES+Q+R+  D++GPRAEL+YWKKRM++F+YLL+QLK P V+  + +L  AKSK +++WIE+DRRIT A+NEAK+NVK++Y+LE    PLY+ +P   +  IP LI+++R IH++S+YYN SEK+T+LF+ +TNQM++SCKAYI+N+  +++W    +E+++++     LN+  +         L   P ERQF+ SE YIF KFD F  R+  I+K+F II TYSVL D+ IEGLE++  +F  I+ ++K K+Y+FLD   T F  DF+ F ++  E    +  FM+   ++I  T RA+  L +FERL IPDLG + KY  IL  YG+D+E V   + + K DPP  RD+P +AG+I WAR L RRI  PM  F+ Q   +L T EAK IIKN+N++ E L+ +E ++H  W+ ++     GL ++L++R  ET EL+VNFDP++LI   ET+ M ++ L+IPP A  L+ K+  LK+ +N  M + N+
Sbjct:   14 GLFKSMEQLLSEVFIPSLKKTNHGWGELDSPEAQAIKEEYISLFESFASVLVGAEECIKEKV--RNCLD---QGLRYPIFLFYPFKKTHDL--VYH----------QILSESNQLRKVTDDLGPRAELNYWKKRMSRFSYLLEQLKSPHVRTILRVLGLAKSKLIESWIEIDRRITVASNEAKNNVKYVYSLETFYEPLYKCDP---VRKIPSLINAIRTIHNVSRYYNDSEKITTLFLLVTNQMVSSCKAYITNNGCDSIWDQPRQEIIRKIKAAIHLNQVLKP------RELEQAPLERQFDFSEAYIFWKFDAFQSRMEKILKMFNIISTYSVLQDSKIEGLETIATRFKPILMSMKNKSYSFLDHSATNFETDFEQFCKRTSE---QLEKFMNDTIENIQDTQRALDVLHQFERLGIPDLGTDTKYQDILLKYGQDIEWVSDIFEKEKLDPPFERDLPPMAGRIMWARILSRRITDPMNFFQ-QQPGVLSTQEAKNIIKNFNRMTEILLEYEKLHHHNWMTKVTDARLGLEATLLVRLGETGELFVNFDPELLIQIMETNCMARMNLKIPPFAAVLQQKEYTLKK-NNSQMQVHNF 582          

HSP 3 Score: 54.299 bits (129), Expect = 4.787e-6
Identity = 25/59 (42.37%), Postives = 38/59 (64.41%), Query Frame = 3
Query: 3117 FRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQS 3293
            FR +  L IP+IV+ P +E+VQ  +N+    ++SVSKG+ QWSK+R +  +L    L S
Sbjct:  606 FRVDVVLSIPDIVINPALEKVQEALNQIVECVVSVSKGVGQWSKDRLSLVRLTTNPLLS 664          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3268.4 bits (8473), Expect = 0.000e+0
Identity = 1593/2691 (59.20%), Postives = 2051/2691 (76.22%), Query Frame = 3
Query: 6063 TPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKK-----LLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFR---DPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFAL---XXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            T L   CYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K     +Q    H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQ +E KGFY+L+KPG+F +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ VIG GH+C +R F   V   + +L+ LTR+LWQ TK KM PTP+KFHY+FNLRDLSRIWQG++ T      SS+      LL LW HEC RV++DR     D++WF++ +   ++     E +   D   ER YFVDFLRD PE   E  ++S F +PK+YEP+ SFE LK+RL+MF   YN+++RG+ +++VFF DAM+H++K+SR+IR   GN LLVGVGGSGKQS+TRLASFIA Y  FQIT+TR   L   +  LKS+YR AG + KG  F++TDNEIK+ES+LEY+NN+L+SG ++ LF++ EMDEILS +   MK+ FP+ P T ENLY YF+ RVR NLH+VLCFSP+GEKFR RAL FPAL SGCT++WF +WPK+ALV V+ H L  F + C   VK ++V  +      V   C+ YF +YRRS  +T KSYLS+I  YKT+Y   +A V +L  RM  GLQKLKEA E++  LSKELE+KE+ L +A+ +A+ VL  VT +  A+E VK +V+ VKDK  AIV+ I  D+ +AEEKL AA+PAL+EAE AL TIKP+DI+TVR L +PP LI + MDCVL+L +++++P   + E   + +SW ESL L+ S +FL+ L  FP+D INEE ++LLQPYF   +Y++E AR +  NVAGL +WTKAM  F+ +N+EV+PLK +LA Q   LA A  DL+ A+  L  K+  L +V+ EY+ A+  K  L  DA  CR+KM  A+ L++GL  EK RWT QS EF +Q   LVGD+++ +AF+SY GPFNQ+FR  + + W+  ++   +P    +DI E L + + + EWNLQGLPND+LS+ N IIVT+A+R+ L IDPQ+QGK WI NKE ++ +  T+  +KYF+ HLE++L+ G PL+IED+ EELDP L+NVLEKNFIK G+  KVK+GDKEVD+ K F LY+TTKL NP ++PEI A+TS+IDF+VT++GLEDQLLG VI  EK E+E  R  LL+  + NKRK+KELED+LL RL +T+GSLV+D++L++VL   KQT+ +V+ ++  A DT+ +IN AREEYR ++ RGS+LYFLIT++S VN MYQ+ L QFL LF  S+  S KS     RI+ II  MT  ++ +  R LY+  +  FTLLL LK+DM+  +V  +E   L+KGG++LDLKT   KP +WI+DM+WLNLV LSKL  FS +++Q+   EK W++WFDK+APE+E +P  Y++ LD F++LLLIRCWCPDRT+  AR+YI   +G+ + E V   +     E++ +TPL+  LS+G+DPT  I    KK  I+   +SMGQGQEVH+R+++ + M  G W LLQNCHL +++++EL   + E+  +N  +RLW+T+E H  FPI  LQ++IKFTNEPP+G++A L+R++  + QD LD      WK M Y +AFLH TVQERRKFGPLGWNIPYEFNQADFNA   FIQNHLD +  K+      + W  V+YMI EIQYGGRVTDD+D RLL   +K +F + MF+ DF       I   ++VD+Y  YI  LP  D P  FGLH NADI++ +K  K +L+TILSIQPKDS  G GETRE+ V +   +ML+K+P ++IPF+V +++ KMG  +PMNIFLRQEIDR+ +VI  VR TL DLKLAIDG ++M++ LRDALDC++DA+IP  W K SW S+TLGFWF EL++RN QF  WL  GRP CFW+TGFFNPQGFLTAM+QE+ R++ GWA D ++L N VT++  +++  PP +GVY+YGL+LEGASWD+ N RL E+KPK+L++ +PVI ++A      + KKK  +D ++Y  PIYKKP RT++  IA+  L  ++  EHW++RGVA+LCD+K
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQ----HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTN----HSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVER-YFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQL-----VSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALLCDVK 2687          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1614.74 bits (4180), Expect = 0.000e+0
Identity = 1081/3258 (33.18%), Postives = 1731/3258 (53.13%), Query Frame = 3
Query: 4614 IDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESD-GFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPV---KAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPE-LEAAINRQIDEALIISH--PPWVL--KLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE-PHREMR------MNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLK-----RNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI--PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR---SNNNIKLDLPK-IEK-----DSEDTMFDYM--VSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMI-NKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFER----------NIEF-----CLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKS-IYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFS---KEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFN-QYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAI-VEKIRVDQQVAEEKLTAAKPALQEAEDALNTIK-PNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKT--SWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYF-TREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSI--QIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKH--HIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQES--TNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIH-------WKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQ---NHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQP-DFFINPIQKIVV--FNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIP--FKVAEKINKMGAF--QPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSH----DGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRT--------NLTYIANAELVCSKSAEHWIMRGVAMLCDI 14099
            I  F   +P++ ++ NP ++ RHW++MS +    FD+  + G +LR +L+  L  F EE E I ++A KE  +E  ++ +   W     H    K+ G  +       +I  +++D ++   +++ + +  PF+ +++    +L +  E I++W+ +Q  W+YLE +F   DI +Q+P+E + F  +D++W +IM    +++ VLQ       L +L        +I  K L  YLEKKRL FP                                                  YS EGE +EL + +   +A   VE WL+ L +    S+  +I  +  +   T  N  +++  +P QV L   Q+ WT +  +AL   K  +++  Q NE   L+   L         K  RT    L+TI VH +D+   L+ +KV   +DF+WL Q R+Y++ D  R  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  +++GGAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGL+ SG+W CFDEFNRI+L VLSV AQQ+  +      + + F F +G ++ +NP   + +TMNPGYAGR ELP+NLK+ FR VAMMVP+  +I  + L S GF++   L+ K    Y+LC EQL+ Q HYD+G+R + +VL   G  K   P + E   ++R ++D+N  K +  D PLF  + +DLFPG+ L    Y   LEAA     +E   I +  P  V   KLIQ +E   VRH M+ +G S AGKT  +HVL   L+   E  H E        +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W+V DGP+D +WIE++N+VLDDNK L L +G+ I MS    +IFE +++  ASPATVSR GM+YM  S L W PL+  W+       ++ + R ++L+LF    P   +   ++    + T  +  V   C L + ++  P K   D   I R      +  S++WS+G   + + R K   +IR   S  N +  +P+ IE+     + +  ++DY     E G W+HWN  +E  I   +   +   I+VP +D VR  +LM+   SQ   +L +G  GT K+V + +K L++ + + ++   +NFS+ T     Q  I S +DKR    +GPP G++  +F+DD+NMP   ++G Q   E++RQ ++  G Y L K    IS++D+ F+AAM  PGGGRN +  R  RH  I +    +  ++  I+S I +    K+  F    + + ++++    ++++     + PTP+K HY FNLRD SR+ QG +  +   +   + L+RL+VHE  RV  DRL+D+ D  W  +          N+ F      L   + +E +D  N    F D++    E  E           ++Y  VPS E   E +    + YN+  +   +NLV F   + H+ +ISRV++   GN LLVGVGGSG+QSITRLA+ +A    FQ  I++ Y +  + +DLK  + R AG + + TVF+ TD +IKDE++LE I+++L +G +  LF+   K+E+ E +  +    KK     P T   L+ +F+ R ++NLH+V+ FSPIG+ FRKR   FP+L + CTI+WFQ WP+EAL  VA   L    +   +  +++++ +    H    +N L  F  +  R   IT  SYL  I  ++ +    + ++    +R  NGL +L  A+  +  + KEL   +  L  A  +   ++  +  ++   EA K++V  V ++ AA+   + +  +   E  L  A PAL+ A  AL+T+K P+DIS V+ ++ PP  ++ +M  V ++   K D  IPD    G K    W  S KLL   NFL  L  + +D I   ++  ++  F T  D+       +     GLC W  AME +  V + V P K  LA     LA  +  L      L E E+ L  ++  ++   + K  LE     C +K+  A +L+ GL  EK  W+  + + ++    L GD+++ +  ++Y GPF   FR      W ++ ++  +P +    + + L NP +I  WN+ GLPND  S++N +IV + SR  L IDPQ Q   W+ N E ++++     T+  + + LE+ +  G PL++E++ EELDP+L  +L K   K G    +K+G++ ++    F  Y+TT+L NPH+ PE+  K S+++F +T +GLEDQLLGIV+  E  ELE  R  L+ Q++NNKR++KE+EDS+LE L +++G+++ED++ + +L+ AK  S +++   QI  A  TE +I ++RE YR ++K  S+L+F I DL+ ++PMYQ  L  F+NL++NS I+  KS  +++R++++    T N++  + RSL++ D+  F+ LL   + +    +   +L  LL GG  L     +P P  W+ D +W  +   S+L  F GL E  + + + ++  +D   P   D+P  +   L + +K+++ RC  PD  +    +++ R LG  F++   F +     ++++  PL+ +LS GADP  L++  + K     +  +IS+GQGQ   + ++I  AMQ G+WV LQNCHL + +++ L ++ ++   T  +  +RLW+TS    +FP+  LQ  +K TNE P G+R NL +S+  LT    D             W+ + + L F H  VQER+KFGPLGWNIPY FN++D +     +Q   N  D + F           + + Y+  E  YGGRVTDD+D RLLM     ++ E + +   + ++P  K      ++ ++Y  +I NLP +  P  FGLH N DIS   + TK + +++L  Q   +  G     ++ +Y    ++ + I +  +P  F     + K      + MN  L QE++R + +   + ++L +L  A+ G+VVM+  L      +   K+P  W K S+ S   LG +  + + R      W  +G+P  FW++GFF  Q FLT + Q   R +    D   FD  +L         ++   PP++GVY+ GLFL+GA WDK  G L E  P+IL+DS+P+I +    +  KK   +   +Y+ P+YK   R         +  ++    L   K  +HWI RGVAML  +
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAG--FDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTA--LDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKI-MKGLNAYLEKKRLFFP-------------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARN--QWVKEWPGQVVLCTSQIFWTLEVHKALGLKKYYQQLQNQLNEIVELVRGELP--------KQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVR--VHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDF-EGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAA-----EECCKIHNVQPTKVFTDKLIQTYEMMIVRHFML-VGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESI-RTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIEN-INLGEINTKGQEIIVPTIDTVRYTYLMDLCISQ-GPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDL-KDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSI-VAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQN--LLFGDYMNPDLEGDE-----------RLYTEVPSIETFAEVVKSCLEEYNQMHKNR-MNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLT---LFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENE--RQEVITICKTFHTS--ANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEA-KSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPD-RIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKEP-ELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINS-IQDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNL-LARKEIEHSDLMFLLTGGIGLQNTVANPDP-SWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSY--LTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPF-----------EAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLY----DIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLP-------IDKSETPPEDGVYVNGLFLDGARWDKE-GVLTEQHPRILFDSMPIIWV----KPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQL 3680          
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1600.88 bits (4144), Expect = 0.000e+0
Identity = 1079/3524 (30.62%), Postives = 1803/3524 (51.16%), Query Frame = 3
Query: 3636 LWAKVKDAT-LEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTE---DLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFH-EKQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY-ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIK-LDLPKIEKDSED-----TMFDYMVSENGE-WVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVIS-SSKKLLRLWVHECSRVLSDRLIDESDLQWFERNI-----EFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKM-FSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHI-MTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKL--HVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKT--SGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQP----DFFINPIQKIVVFNTVDEYRNY----ISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWES-TTLGFWFIELIDRNNQFLKW-LNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLT---YIANAELVCSKSAEHWIMRGVAM 14087
            L  K+K AT +E F K +P  + +D  ++ +  L  ++  E        I        +  L      RI     C+   K   E++F   +    L++++ ++    +D++  +G + +IR+  + +++ +  I+E Y M+  Y      DE E V  +   W  L +   QV   L  ++  F    +E ++ FK+D   F E ++  GP   G    E  + +   +     +  +    +   +L  L + +Y ++  I+K L+ L ++Y++Y     +   +   LW + DI+ + + +  F     +L K ++  P    L   + +F   + LL  + N A++  HW ++ + T   FD+    F L  +    L K+  +I++I  SA+KE  IE   K  K             K   E +        I+  +++ +M L  +  +R+  PF   IQ     L+  SE IE W+ VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM       N+ +CC     LS L     +   I QK+L  +L+ KR  FPRFF +SD  LL +LG   DP  IQ H++ ++DNI++++   +   +T++ A  S EGE +E  KPV  E+ VE W+M +L   +R+   + + A        ++ ++++  Y   + L   ++ WT +   A+ N  K D+  +++  EQ    ++ L+        + +R K   ++   VH +DI D  V   +K   DF+W  Q RFY+V++ D   V   +    Y  E++G   RL ITPLT R Y+TL QAL M +GGA AGPAG GKTETVKD+ + LG + VV +C++ MD   LG+I  GL++ G WGCFDEFNRI   VLSV + QI  + +      K F F +G  + ++   GI++TMNP Y  R ELPE++K+ FR V ++ PD Q I  + L S GF+    LA+K   LYK    QL+KQ HYDFGL +  SVL+  G+ KR +   +E   +MR LRD+NL KLV +D P+F+ LI+D+FPG+   + G+P     +   + ++     P  V K++Q++E    +   M +G +  GK+  I+ L +A T  G   +   +NPKA +  +++G  D  T DWTDGIFS L+R   +    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +   C ++FEV ++ +ASPATVSR  +V++    L + P  + W+  R       +  LF    P     ++        T +  +V Q C +L+ L+  K+   S+++   ++ E LY      S+GA L    R K +  ++S + +  +D  K      +     T++D+   E  E WV W+S V EYI+  +   ++  IL P VD  RT +++  +   ++ VLL+GE GT+KT +I   L + + +  +  ++NFSS T     QR +E+ ++KR   TYGPP G+K+ VF DDINMP ++++G Q    ++R  ++  G Y   +   F ++ DL ++AAM   GGGRN++  R    F +FN   P   S+  IY+ I  GH    R F++++  +   +   T KL+ +    + PTPSKFHY F+ R+LSRI+ GL  T+ D    + ++ +R+W +EC R   DRL DE+D      +I     E+   DSE V   DP      F D+ R A E  E+          ++YE +  +++ K    +F                   DA+ H+ ++ R++R  +G+ LL+G  GS  Q++T+LA+F AD   F+I + R YN  NF  DLK++Y   G EN+ TVF+FTD  I +E +LE INNML S M+  LF+ +E + I+  +  +  +       ++E+++QYFL +  +NLH+VLC S  G+  + R   FP L S   I+W+  W  +AL  VAQ  L +  +    F    ++D + ++H  +     +   +++R    T KS+L +I  Y T+ +     V L  + ++  L +L+EA+E I     EL +K                                                DQ+V   K TA   A  E  D   TI            KPP  +Q + +C+L+L  KK             + +W+ + K+++   FL+SL+    D I+   I  ++ +       +E  +      +G+  + ++   ++ + +EV P KD +        +++ +L+  +  L   ++  + +K +Y+ A   K+    +A +  ++++ A++L+ GL  E+  WT    E + Q   L+GD ++ +AF+SY G FN  FR  M +  W   ++  G+P+++   I   L+N  +I  W  +GLP D+ SV+N I+ T+ SR+ L IDPQ Q  +WI NKE ++++   ++  +  F + LE ++  G+P +++D+ E++DP + NVLE+N +       + +GDKEV+    F L++ T L+NP +SP ++ K  VI++S T++GLEDQLL +     ++  +     L+++ S NK  +K L DSLL  L  + G+++++  L+  L K K  + +   +++ A     E    RE YR ++KRG++L+F ++D++ VN MYQ  L  +L+LF  S+ ES   P +Q+R+++II+ +T N+ N+    L+   +  F++ + +K++     V Q+EL+ L+K  S    K    KP +WI D  W ++  L++L    FS L   I  +   W++W+D  APE    P  Y   L  F+KLLL+RC   DR       Y+  T+G+  +        ++   + A +P++ ++S G+DPT  +   A+K   +   I++GQGQE    +++ KA+  G+W++LQNCHL + ++ +L + +++ TN N  +R+W+T+   D FPI  LQ + K   EPPE I+ N++ +++ ++Q  L S     +  + Y LAF H  VQER K+G  GW++P  FN +DF+A    +  +L      K H+   S I W+ ++Y+I E+ YGGR  D FD R+L V    YF + +F P     FF N   K V +      R +    I  +P    P   GL +  +I Y T+  + +   +  +QP ++  G G   +  +     ++  ++P       V E++       P ++ L QE+ R +K++  ++ ++ +L  A+ G V M+    D      +  +P MW++++ E+  +L  W   L  R  Q+  W + +G P   W++G   P+ +L A+ Q   R   GW  D       VTR+ TE+  +   +  Y+ GLFLEGA WD  NG L  +KPK+L   LP++ +  +Q+ + + +        +P+Y    R N +    +  A+L  +    HW++ GV +
Sbjct:  837 LLLKMKVATEIERFAKKNPSCAMYDNKLQYFENLNQEVKQEV-LCKTEHIIHVNMMPLVSSLRNIAESRI--STLCSFLNKPAKEELFILRDKFMQLQEKMHQRPDTFEDLKSILGTISDIRDMSLDVEIRVADIKERYRMMAMY------DELELVANIGQIWSNLFAESRQVDQSLKDVRETFSKIKMEEMEAFKQDLSIFAESFNTHGPGTVG-NDLEKLNIIGKFEKELSKIMAKQEHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMTWKRTKFNMQPQ------LKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERI-QKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEA-------VYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQF-EGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCIDVTLNSETIVPRT-DVNMVSQLCLMLDVLLESKN--SSAEVLECYFLEALYC-----SLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIH--NPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH---TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAV-LADP----ILFGDY-RAAREECEQ----------RVYEDIGDYDVSKAIFQLFE------------------DAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQ--EGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHF--GAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHV-LQCKCLEGSLNRLREAREQI----DELNLK----------------------------------------------LADQKVVLAKKTATCTAFLEEIDKNQTI---------SFAKPPKQVQVVCECILVLRGKK-------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKV--QKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYL-----TKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRN---KDVGYKIPPPGRKHVYTEIEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQP-ETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGT--DLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKK-GWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLR----NTLRTPVYTTSLRRNASGAGLVFEADLFTTMHTSHWVLSGVCL 4171          

HSP 2 Score: 85.1149 bits (209), Expect = 2.583e-15
Identity = 87/425 (20.47%), Postives = 197/425 (46.35%), Query Frame = 3
Query:  684 DEDSRRAMMNSLENFVLVLSNARESINERVALKV-CTEIDLKRIRLPIDCMNI-------VNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQN-NPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEII-KTYSVLTD--ASIEGLESMGVKFNVIVSTIKKKNYN-FLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPD---LGIEEKYMKILTHYGRDV 1910
            DE   R + +S+  F   L    +  + + A+ + C   D   I+L I  +++       + + + +  +E CV +W  QI  VL E  Q  ++ +  GP  EL  W++R      L +QLK P V+  + +L  A +   +T+      +T+   E+  N ++L T+E H   L +  + +L ++ IP L+  ++ +   S++YN++E+M  L  +I  Q+   C+      + +T++  + +E+  ++    ++ + ++  + E +  +       ++E     +F   D        I  +F+++ + Y++ +     ++G+  +  + + +V   ++ ++N F    +  +    +DF   ++++     + +D  F +  S+  A   L RF++    D   L +  K+  +LT Y ++V
Sbjct:   92 DEYPERFLQSSVFYFSRNLRAVVQPRDMKEAVNIMCKLFDFDEIQLHIPDLDLEPEVDALITSPDMVENLEQCVMIWQTQITIVLQE--QQSKQPEGPGPLPELTLWERRATVLGALTEQLKQPAVEKILKVLGMANAGIAQTFEGTIIELTNYHLESNSNSRYLKTMERHFLNLQRGAHFSLHLETIPTLMERLQTMWLSSRHYNSNERMVPLMERIAWQL---CENVAQEIHVQTLFE-KQKEVKSQVFLAKQVLEKWKLSYFENRAEIEKLGRSSRWEFDREKLFKMSDYMASVCQDIHNVFQVLEELYNIFSPELKGMKGINEVISRVDGLVLPFQRVSFNPFRISNKKTWKTIMEDFSVTVKDIEEEAAHIIDMFFTNTLSSAHAFDILMRFKQNRSRDAISLHLLGKFEDVLTQYCKEV 510          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 7641.19 bits (19825), Expect = 0.000e+0
Identity = 3793/4665 (81.31%), Postives = 4164/4665 (89.26%), Query Frame = 3
Query:  129 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDS---EVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXD--TKMYISPIYKKPRRTNLTYIANAELVC--SKSAEHWIMRGVAMLCDIK 14102
            NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVE CVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP+LMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFE QHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQ+YIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAM+RFSAYSHLWAKVKD TLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E+KGFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ +SID+I+S+IG GHYCKER F   V  +V  LI +TR+LW  TK KM PTP+KFHYVFNLRDLSRIWQG+INTQ DVI+++K LL LW HEC RV+SDR +   D+ WF + ++ CL +    ++V          +F+DF+RDA E   E  DD+ F +PK+YEP+ SF+ LK+RL MF   YNE++RG+ +++VFF DAM H++KISR+IR  +GN LLVGVGGSGKQ++T+LAS+IA Y  FQIT+TR YN++N LEDLK +YR AG++ KG  F+FTD EIKDE +LEY+NN+L+SG+++ LF+++EMDEI   +   MKK +P+ P T +NL +YFL R + NLH+VLCFSPIGEKFR RAL FP L SGCT++WFQ+WPK+AL+ VA H L  F +VC   VK++++  + V+H  V  NC+ YF ++RR   +T KSYLS++  YK++Y+      S L +RM +GLQKL EAQE++  L + L  KE+ L++A+ EAE VL  VT Q  AA  VKNKV+ VKDK  +IVE+I  D+++AE KL AA+PAL+EAEDALNTIKP DI+TVRKL +PPHLI RIMDCVLI FQ+++D    D ER   K SW ES+KL+++  FLN+L+ FP+D INEE ++L+ PY   EDY ++ AR+ CGNVAGL +WT+AM  F+ +N+EV+PLKD+L  Q +   K+ +DL +A+ VL EK++ L  V+  YD A+++KQ L  DA  CR+KM+ A +L+ GL  EK RWT QS EF++QI  LVGD++  +AF+SYCGPFNQ+FR  + + W+  +R   +P + +++I++ L++P  +GEW+LQGLPND+LSV+N IIVT+ASRY L IDPQ QGK WI N+E +  +  T+  +KYF+QHLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG+VI  EK+ELE  R QL++    NK+K+KELED+LL RL +T+GSLV+D++L+ VL   K TS +VS ++  A+DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL LF  S+  S+KSP  Q+RIQ+II CMT  +W + VR LY+ D+ TFTLL+ALK+DM    ++ EE +  +KGG++LD+  + PKP  WI DMTWLNLV LS LH FS +++Q+  +EKQWR WFDK+APE+E IP GY   LD F++LLL+RCWCPDRTL  A++YI  +LG+ F E        +  E+  +TP++GLLS+G+DPTP IE  AKKH ++   ISMGQGQE+HSRR++A  +  G WVLLQNCHL +DY+ EL   + E+  ++  +RLW+T+E H +FPI+FLQ++IKFTNEPP+GI+A ++R++    QD+LD   ++ W+ M Y++A+LH  VQERRKFGPLGWNIPYE+N AD NA   F+QNHLD +  KK     G+ WK + YM+ EIQYGGRVTDD+D RLL    + +F + MF P F       I   + ++EY + I+ LP  D+P  FGLH+NADI+Y +KT + IL+ IL+IQPKD+  G GETRES+VY+ C +ML K+PS+++ F+V E++  MG  QPMNIFLRQE+DR+ KVI  VR TL DLKLAIDG ++MN+ LRDALD ++DA+IP  W K+SWES+TLGFWF ELI+RN+QF  WL  GRP CFW+TGFFN QGFLTAMRQEVTR+H GWA D+V+L N VT+   +E+ +PP EGVY+YGL+LEGA WD+RN +LIE+K K+L++ LPVI I A+    + +   D    MY  P+YKKPRRT+LT+IA+  L C  +K A+HW +R VA+LCDIK
Sbjct:   15 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4674          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 7639.26 bits (19820), Expect = 0.000e+0
Identity = 3797/4663 (81.43%), Postives = 4162/4663 (89.26%), Query Frame = 3
Query:  129 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGXXXXXXXXXXXXXXVISTQEERXXXXXXXXXXXXTPMDQNAHTGVXXXXXXXXXXXXXXXXAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERN-IEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXD--TKMYISPIYKKPRRTNLTYIANAELVC--SKSAEHWIMRGVAMLCDIK 14102
            NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVE CVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNP+LMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFE QHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQ+YIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAM+RFSAYSHLWAKVKD TLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQ +E+KGFY+L+KPGDF +++D+ F+AAMIHPGGGRNDIP+RLKR F IFNCTLP+ +SID+I+S+IG GHYCKER F   V  +V  LI +TR+LW  TK KM PTP+KFHYVFNLRDLSRIWQG+INTQ DVI+++K LL LW HEC RV+SDR     D+ WF +  +    +D   V      +ER YFVDFLRDA E   E  DD+ F +PK+YEP+ SF+ LK+RL MF   YNE++RG+ +++VFF DAM H++KISR+IR  +GN LLVGVGGSGKQ++T+LAS+IA Y  FQIT+TR YN++N LEDLK +YR AG++ KG  F+FTD EIKDE +LEY+NN+L+SG+++ LF+++EMDEI   +   MKK +P+ P T +NL +YFL R + NLH+VLCFSPIGEKFR RAL FP L SGCT++WFQ+WPK+AL+ VA H L  F +VC   VK++++  + V+H  V  NC+ YF ++RR   +T KSYLS++  YK++Y+      S L +RM +GLQKL EAQE++  L + L  KE+ L++A+ EAE VL  VT Q  AA  VKNKV+ VKDK  +IVE+I  D+++AE KL AA+PAL+EAEDALNTIKP DI+TVRKL +PPHLI RIMDCVLI FQ+++D    D ER   K SW ES+KL+++  FLN+L+ FP+D INEE ++L+ PY   EDY ++ AR+ CGNVAGL +WT+AM  F+ +N+EV+PLKD+L  Q +   K+ +DL +A+ VL EK++ L  V+  YD A+++KQ L  DA  CR+KM+ A +L+ GL  EK RWT QS EF++QI  LVGD++  +AF+SYCGPFNQ+FR  + + W+  +R   +P + +++I++ L++P  +GEW+LQGLPND+LSV+N IIVT+ASRY L IDPQ QGK WI N+E +  +  T+  +KYF+QHLED+L+ G PL+IEDI EELDPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LYITTKL NP ++PEI+A+TS+IDF+VTMKGLEDQLLG+VI  EK+ELE  R QL++    NK+K+KELED+LL RL +T+GSLV+D++L+ VL   K TS +VS ++  A+DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ L+QFL LF  S+  S+KSP  Q+RIQ+II CMT  +W + VR LY+ D+ TFTLL+ALK+DM    ++ EE +  +KGG++LD+  + PKP  WI DMTWLNLV LS LH FS +++Q+  +EKQWR WFDK+APE+E IP GY   LD F++LLL+RCWCPDRTL  A++YI  +LG+ F E        +  E+  +TP++GLLS+G+DPTP IE  AKKH ++   ISMGQGQE+HSRR++A  +  G WVLLQNCHL +DY+ EL   + E+  ++  +RLW+T+E H +FPI+FLQ++IKFTNEPP+GI+A ++R++    QD+LD   ++ W+ M Y++A+LH  VQERRKFGPLGWNIPYE+N AD NA   F+QNHLD +  KK     G+ WK + YM+ EIQYGGRVTDD+D RLL    + +F + MF P F       I   + ++EY + I+ LP  D+P  FGLH+NADI+Y +KT + IL+ IL+IQPKD+  G GETRES+VY+ C +ML K+PS+++ F+V E++  MG  QPMNIFLRQE+DR+ KVI  VR TL DLKLAIDG ++MN+ LRDALD ++DA+IP  W K+SWES+TLGFWF ELI+RN+QF  WL  GRP CFW+TGFFN QGFLTAMRQEVTR+H GWA D+V+L N VT+   +E+ +PP EGVY+YGL+LEGA WD+RN +LIE+K K+L++ LPVI I A+    + +   D    MY  P+YKKPRRT+LT+IA+  L C  +K A+HW +R VA+LCDIK
Sbjct:   15 NRVPGLLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEQCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPSLMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFETQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETKELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQQYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINMLCGEEEDFEIDEAFEEDVISTQEERISIKKSPSQISKTPMDQNAHTGVSHPKKKIKEIKHSISEAAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMLRFSAYSHLWAKVKDTTLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIVNEDLGEVHVGSLQDER-YFVDFLRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4671          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4373.93 bits (11343), Expect = 0.000e+0
Identity = 2190/3745 (58.48%), Postives = 2777/3745 (74.15%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--PTMVAYDISVKSSAK-------PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVM-------IDENVINRRQSNVSNAQSISEGLS---DSGTGRKPGKRTIGSNSQFADEDGLS--ANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRK----------EVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYI-SNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A+++LL   + + ++A+VK +R  L++L   +A    T    D S     K       P  +C   +    + + P++E++Q+ + +    I +  K +++WSK  +    L       NE  ++  I V         DE    ++ +  +    +S  ++   +S   ++   R+ G +++  +   LS    L+   Q +NCY +V  ++EV ++QS L + +N+ RK          E+++       YS+LW       + EF K+ P + EF    KE  +++ Q+  E  +Y  GP+ + T   K+  L+  K ++  Y   C  ++   +E I T  +++E+ LS+ I +LDDI   M  L  IR+ +I++D  I   E +   + ++++P  K   ++V+ +R  + ++     Q  D+++ IQ  ++  L+ N+   K D + F  DY+  GPM PGLPP EA D+ I+ +NR+DNL R+  +Y+ GE LFGL  + Y     I KEL LLQ+LY LYN+V  +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD+    FA ++                                   +W+  +L   +FKNRGELLL+GD  SE+IS++EDSLM+LSSL+SNRYN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQT+EMKGFYSL++PG+F +++D+ F++AMIHPGGGRNDIPERLKRHF IFNCTLP+  SID+                  S++ +V  +I   RK   S K  +    +KFHYVFNLRDLSRIWQG+INT SDVI++ + LL LW HEC RV+SDR +   D QWF + I+  + +    +  +   + +YFVDFLRDAPE   E  +D  F+ PKIYEP+   + LK RL MF   YNE++RG+ ++LVFF DAM H+VK+SR+IR   GN LLVGVGGSGKQS+TRLA+ IA Y          YN++N LEDLK++YR AG+E KGT F+FTDN+IKDE +LEY+NN+L+SG+++GLF K+E+DE+ + +   MKK FPK P T ENL +YF  RVR NLH+VLCFSP+G+KFR RALYFP L SGC  +WFQKWPK+AL+ VA+H L +F +VC+   K  I+  ++ IH DV + C +YF++YRR   +T KSYLS++  Y+ +Y   K  +  L  RM +GLQKL EAQ++I  LS EL  KE+ L VA+ EAE VL  VT+QT AA+ VK+KV+ VKD+C  IV  I  D+ +AE KL AAKPAL EAE+ALNTIKP DISTVRKL KPPHLI RIMDCVL+LFQ+ +D  + D ER   K SW ESLKL+A++ FLN+LL F RD INEE++DL+ PY   EDY+LE A+K CGNVAGL  WT+AMEKFYWVNREV+PLKD+LA Q I L  A  DL  AE +L EKEE+LA+V+ +Y+ A+KRKQ L  DA  CR++M+TA QL++GL  EK RWT QS  F+ Q   L                    FR+K+ + W   +    +P    +D+++ L++   I EWNLQGLPND+LS++N IIVT A+RY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G P++IEDI EELDPAL+ VLEKNFIK+GTGLKVKVGDKEVD+ K F LYITTKL NPH++PEIYAKTS+IDF+VT+KGLEDQLLG VI  EKEELE SR +L++  +NNKR+++ELEDSLLERLANT+GSLV+DQ+LL VL+  K TS +VS+Q++QA +TE+EIN AREEYR ++ RGS+LYFL T++S VN MYQ GLKQFL LF  S+ +S+KSP   RRI  II  MT ++W F VR +YK DR T TL+LALK+D+++ ++RQEE +VL+KGGS LDLKT+ PKP KWI D+TWLNL ALS L+ FS ++EQ+V +EK W+ W+DK+ PE+E IPCGYE+ LD F++LL++R WCPDRTL  A++YI  +LG+ F E+V   +  L  ++D ++ L+ LLS+G+D TPLIE  AKK HI    +SMGQGQE+HSR++I+K MQEG WVLLQNCHLC+DY+ ELF  I E+ NV+  YRLW+T+E+H +F IN LQI+IKFTNEPPEGI+ANL R++ D+TQD+LD+ V  HWK+M + LAFLHCTVQERRKFGPLGWNIPYE+NQ+DFNA   FIQNHLDGI FKK+ K SGIDWKCVRYMISEIQYGGRVTDD+D +  +                                +RN I + LP  D P +FGLH NADI+YSTKTTK+IL+TILSIQPKD+  G GETRES+V +QC +ML K+PSN+IP++V EK+ KMGA  PMNIFLRQE+DR++KVI  VR TL DL+LAI G ++MN+ LRDALD ++DAKIP +W KISW+S TLGFWF ELIDRNNQF  WLNDGRPV FW+TGFFN QGFLTAMRQEVTRSHDGWA DSV+L ++VT+   +ELREPPKEGVY+YGLF+EGA+WDKRN RL E KPK LYD+LPVINIFA+QE TK K +  +K+Y +PIYKKPRRT+LTY+A+ ELVCSK+ +HW+MRGVA+LCDIK
Sbjct:  937 ASNDLLRIMDQKTVDAVVKSVRTALDNLWNYMACKDATFAIKDASFGQVVKAEKVKPNPLIKCFVRIMGNKLAIRPSLEDIQNIIKKAIVAIQNSMKAVTKWSKRGRRKAFLNDLKESENEVSQNPNIVVKDFQDDANTDEKTNGKKTAKETLPVMVSTSVTSDVESQNSQQEKSRSKGLSTKPEESQRLSLIVQLDIEEQAENCYYDVKHDREVYRLQSFLQSWMNNMRKILFLPNGELKEIKSLTQTLQCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDMMLKTFACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK------------------SLVLLVWDII--VRKE-VSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYSS--------YNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKKKCL--------------------------------HRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDT-SKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4557          

HSP 2 Score: 481.485 bits (1238), Expect = 2.430e-135
Identity = 273/880 (31.02%), Postives = 477/880 (54.20%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK--ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-NDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            L+  E L E Q K+KEE   +++ LDERH YL++ + +F+ ++   +E+ I D NQ+E +  F + ++T+ LF +  +  L K    +     +G K  +     +        P     ++F+++     I E  +  D+  I + G   +L    E +++V LP     +   G+LE     ++  +N +++F   L  A   + E+V L +  E     +       N  N+ E L K E     W+KQI++ + E + +R E+  IGP  EL +WKK+M +FN L++QLK   V   + IL+ A SK L  WI++D+++T A  E+K+N KFL  +E++C PLY  N   MI+ +PKL+ S+ MI+  S YY T   MT LFVKITNQMI +CK++I++ N  T+W  EPE  +KR+  C  LN  YQ C+Q+ +  +  +   R F+ SE+ IFG F+ F  RL  +I I + +K YS+L D  +EG +++  +++ I  +I  K Y+FL+QR   F +D+++F  QI++LH+ ++  +   F         ++   + E+++IP+L    +Y+++   +  +   +   +  ++++PP+ RDMP  AG+IAWAR L+  ++  M +F +    +    E + I+  YN   E L+ +EI  +  W R I S   G+ SS+ I   +    E  +N DPD+L L RE   + +L   +      +  K + LK    K+       +++   +P EYE+L++    K+ R I  G+T ++W  + ++EYI+ +   + E ELLL+RA D+R +RI+ +L  ++  +L   P N  P  +++F+  T E C+K ++ +   S ++ ++ N+ +++L
Sbjct:   10 LVNEEELKEMQ-KLKEEFEMRKANLDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKK-----SGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKLGGEKSLLGSYVESIAKVFLPFIEGQETELGELE--HSGKKNYVNFIQDFNNSLETASICVEEKVILNM--EGSTVIVTGVEGLANAANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPYGECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4369.3 bits (11331), Expect = 0.000e+0
Identity = 2190/3745 (58.48%), Postives = 2776/3745 (74.13%), Query Frame = 3
Query: 2964 AAHELLLHFNHRNLEAIVKVIRNTLESLRKRIAA--PTMVAYDISVKSSAK-------PFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVM-------IDENVINRRQSNVSNAQSISEGLS---DSGTGRKPGKRTIGSNSQFADEDGLS--ANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRK----------EVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYI-SNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXXXXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            A+++LL   + + ++A+VK +R  L++L   +A    T    D S     K       P  +C   +    + + P++E++Q+ + +    I +  K +++WSK  +    L       NE  ++  I V         DE    ++ +  +    +S  ++   +S   ++   R+ G +++  +   LS    L+   Q +NCY +V  ++EV ++QS L + +N+ RK          E+++       YS+LW       + EF K+ P + EF    KE  +++ Q+  E  +Y  GP+ + T   K+  L+  K ++  Y   C  ++   +E I T  +++E+ LS+ I +LDDI   M  L  IR+ +I++D  I   E +   + ++++P  K   ++V+ +R  + ++     Q  D+++ IQ  ++  L+ N+   K D + F  DY+  GPM PGLPP EA D+ I+ +NR+DNL R+  +Y+ GE LFGL  + Y     I KEL LLQ+LY LYN+V  +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD     FA ++                                   +W+  +L   +FKNRGELLL+GD  SE+IS++EDSLM+LSSL+SNRYN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQT+EMKGFYSL++PG+F +++D+ F++AMIHPGGGRNDIPERLKRHF IFNCTLP+  SID+                  S++ +V  +I   RK   S K  +    +KFHYVFNLRDLSRIWQG+INT SDVI++ + LL LW HEC RV+SDR +   D QWF + I+  + +    +  +   + +YFVDFLRDAPE   E  +D  F+ PKIYEP+   + LK RL MF   YNE++RG+ ++LVFF DAM H+VK+SR+IR   GN LLVGVGGSGKQS+TRLA+ IA Y          YN++N LEDLK++YR AG+E KGT F+FTDN+IKDE +LEY+NN+L+SG+++GLF K+E+DE+ + +   MKK FPK P T ENL +YF  RVR NLH+VLCFSP+G+KFR RALYFP L SGC  +WFQKWPK+AL+ VA+H L +F +VC+   K  I+  ++ IH DV + C +YF++YRR   +T KSYLS++  Y+ +Y   K  +  L  RM +GLQKL EAQ++I  LS EL  KE+ L VA+ EAE VL  VT+QT AA+ VK+KV+ VKD+C  IV  I  D+ +AE KL AAKPAL EAE+ALNTIKP DISTVRKL KPPHLI RIMDCVL+LFQ+ +D  + D ER   K SW ESLKL+A++ FLN+LL F RD INEE++DL+ PY   EDY+LE A+K CGNVAGL  WT+AMEKFYWVNREV+PLKD+LA Q I L  A  DL  AE +L EKEE+LA+V+ +Y+ A+KRKQ L  DA  CR++M+TA QL++GL  EK RWT QS  F+ Q   L                    FR+K+ + W   +    +P    +D+++ L++   I EWNLQGLPND+LS++N IIVT A+RY L IDPQ QGK WI N+E    +  T+  +KYF+QHLEDAL+ G P++IEDI EELDPAL+ VLEKNFIK+GTGLKVKVGDKEVD+ K F LYITTKL NPH++PEIYAKTS+IDF+VT+KGLEDQLLG VI  EKEELE SR +L++  +NNKR+++ELEDSLLERLANT+GSLV+DQ+LL VL+  K TS +VS+Q++QA +TE+EIN AREEYR ++ RGS+LYFL T++S VN MYQ GLKQFL LF  S+ +S+KSP   RRI  II  MT ++W F VR +YK DR T TL+LALK+D+++ ++RQEE +VL+KGGS LDLKT+ PKP KWI D+TWLNL ALS L+ FS ++EQ+V +EK W+ W+DK+ PE+E IPCGYE+ LD F++LL++R WCPDRTL  A++YI  +LG+ F E+V   +  L  ++D ++ L+ LLS+G+D TPLIE  AKK HI    +SMGQGQE+HSR++I+K MQEG WVLLQNCHLC+DY+ ELF  I E+ NV+  YRLW+T+E+H +F IN LQI+IKFTNEPPEGI+ANL R++ D+TQD+LD+ V  HWK+M + LAFLHCTVQERRKFGPLGWNIPYE+NQ+DFNA   FIQNHLDGI FKK+ K SGIDWKCVRYMISEIQYGGRVTDD+D +  +                                +RN I + LP  D P +FGLH NADI+YSTKTTK+IL+TILSIQPKD+  G GETRES+V +QC +ML K+PSN+IP++V EK+ KMGA  PMNIFLRQE+DR++KVI  VR TL DL+LAI G ++MN+ LRDALD ++DAKIP +W KISW+S TLGFWF ELIDRNNQF  WLNDGRPV FW+TGFFN QGFLTAMRQEVTRSHDGWA DSV+L ++VT+   +ELREPPKEGVY+YGLF+EGA+WDKRN RL E KPK LYD+LPVINIFA+QE TK K +  +K+Y +PIYKKPRRT+LTY+A+ ELVCSK+ +HW+MRGVA+LCDIK
Sbjct:  937 ASNDLLRIMDQKTVDAVVKSVRTALDNLWNYMACKDATFAIKDASFGQVVKAEKVKPNPLIKCFVRIMGNKLAIRPSLEDIQNIIKKAIVAIQNSMKAVTKWSKRGRRKAFLNDLKESENEVSQNPNIVVKDFQDDANTDEKTNGKKTAKETLPVMVSTSVTSDVESQNSQQEKSRSKGLSTKPEESQRLSLIVQLDIEEQAENCYYDVKHDREVYRLQSFLQSWMNNMRKILFLPNGELKEIKSLTQTLQCYSNLWLSNPIEEIAEFKKNKPSMYEFQSKFKELDSVQEQLENEVPFYIIGPLYIDTTEFKLAALANLKQFKQVYVTGCTERFVGRIEAIQTQLDEIERNLSKNITNLDDIAFIMDTLAYIRQIDIKMDYDIMTAEYASQTMSKFDIPYPKSTGDQVEAVRCNYNRMKENEFQAIDHILAIQGSYKEGLLNNINQLKIDIEDFINDYNERGPMKPGLPPVEALDKQILFKNRFDNLLRKLESYAKGEILFGLPTSSYPSFLQIGKELELLQRLYGLYNEVNKTVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDT----FACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDRVSEVISLLEDSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK------------------SLVLLVWDII--VRKE-VSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDLAESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYSS--------YNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKKKCL--------------------------------HRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDT-SKLYTTPIYKKPRRTDLTYVASVELVCSKTPDHWVMRGVALLCDIK 4553          

HSP 2 Score: 481.485 bits (1238), Expect = 2.407e-135
Identity = 273/880 (31.02%), Postives = 477/880 (54.20%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNGVLQGLEEYMSRVMLPHFRNLKGGWGQLEKDEDSRRAMMNSLENFVLVLSNARESINERVALKVCTEIDLKRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK--ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELP-NDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            L+  E L E Q K+KEE   +++ LDERH YL++ + +F+ ++   +E+ I D NQ+E +  F + ++T+ LF +  +  L K    +     +G K  +     +        P     ++F+++     I E  +  D+  I + G   +L    E +++V LP     +   G+LE     ++  +N +++F   L  A   + E+V L +  E     +       N  N+ E L K E     W+KQI++ + E + +R E+  IGP  EL +WKK+M +FN L++QLK   V   + IL+ A SK L  WI++D+++T A  E+K+N KFL  +E++C PLY  N   MI+ +PKL+ S+ MI+  S YY T   MT LFVKITNQMI +CK++I++ N  T+W  EPE  +KR+  C  LN  YQ C+Q+ +  +  +   R F+ SE+ IFG F+ F  RL  +I I + +K YS+L D  +EG +++  +++ I  +I  K Y+FL+QR   F +D+++F  QI++LH+ ++  +   F         ++   + E+++IP+L    +Y+++   +  +   +   +  ++++PP+ RDMP  AG+IAWAR L+  ++  M +F +    +    E + I+  YN   E L+ +EI  +  W R I S   G+ SS+ I   +    E  +N DPD+L L RE   + +L   +      +  K + LK    K+       +++   +P EYE+L++    K+ R I  G+T ++W  + ++EYI+ +   + E ELLL+RA D+R +RI+ +L  ++  +L   P N  P  +++F+  T E C+K ++ +   S ++ ++ N+ +++L
Sbjct:   10 LVNEEELKEMQ-KLKEEFEMRKANLDERHHYLIKFMEEFFKIKHDIIEDYICDSNQLEAVQSFLAPNETDKLFVYRIKNSLYKRITKK-----SGNKFMKKTDDDILCFHIGSLPFTKGGIIFVKTDVTQPITERNMTTDIFLIKLGGEKSLLGSYVESIAKVFLPFIEGQETELGELE--HSGKKNYVNFIQDFNNSLETASICVEEKVILNM--EGSTVIVTGVEGLANAANDPETLSKAEELASKWMKQIQKEITEIELLRVESGIIGPHEELKFWKKQMTRFNCLVNQLKQKPVINVLLILKIAHSKALDKWIQLDQKVTRAFIESKENTKFLNVIEKYCVPLYHRNIEKMIEIVPKLLQSLSMIYVYSTYYRTFTNMTQLFVKITNQMIFTCKSFITDKNKHTLWDDEPETFVKRMEICINLNHVYQKCYQKVRKEMKYENENRYFDFSEVQIFGNFNLFESRLIKLIAILKSMKNYSILKDVVLEGKDAIMNRYDRITQSITTKKYDFLNQRNLAFDKDYEEFQNQIEDLHSALIGVITSYFHRSKGVAAGLRMQSKIEKISIPELDHFARYVELFKSFRSENLTIKNIFIEHQDNPPLDRDMPYFAGRIAWARNLYLHLEENMNLFVLTCPEVFTIAEGRRIVHTYNTTTEMLVHYEITVYHTWKRLITSKLNGMKSSIFILTNDEPYGECILNIDPDVLGLLREISCLDRLGCALTSVPREIYAKNDFLKRRSEKIRYFCQEHKRIMAKVPAEYEKLLLPITTKIYREIGKGMTLYDWCCLGVEEYIEGLLKLIYEFELLLNRAFDIRDFRINNILTSIAETELFAQPENGEPWEINKFLEITVEKCLKGSQSMHYFSLSIYEASNDYVDIL 879          
BLAST of Dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 4369.3 bits (11331), Expect = 0.000e+0
Identity = 2148/3716 (57.80%), Postives = 2766/3716 (74.43%), Query Frame = 3
Query: 2970 HELLLHFNHRNLEAIVKVIRNTLESLRKRI-AAPTMVAYDISVKSSAKPFFRCNAHLQIPNIVMIPNMEEVQHTVNRTAYMIISVSKGISQWSKERKTAKQLAAEALQSNEKDEDDEIGVMIDENVINRRQSNVSNAQSISEGLSDSGTGRKPGKRTIGSNSQFADEDGLSANLNFNYQMKNCYKNVAENKEVAKVQSLLSTCINSTRKEVETAMMRFSAYSHLWAKVKDATLEEFLKDDPKVSEFDFIIKEYLTLEHQINAESQYYDCGPIALFTEFLKIGLLSETKAWRICYGKACNVKYKAEMEKIFTFTEDLEKRLSRQIKDLDDIRIAMGALKEIRENEIRIDMTITPIEESYAMLLRYELPVQKDETERVDTLRYTWQKLMSRGSQVQDYLITIQPEFRSNLIENVQIFKKDCDKFYEDYDNSGPMVPGLPPREASDRLIIHQNRYDNLERRFITYSGGEELFGLAVTDYAKLKDIKKELNLLQKLYSLYNDVINSVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDHTSEIISIMEDSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQTIEMKGFYSLDKPGDFISVLDLHFVAAMIHPGGGRNDIPERLKRHFRIFNCTLPTFASIDRIYSVIGLGHYCKERHFRSSVINMVSKLIGLTRKLWQSTKNKMKPTPSKFHYVFNLRDLSRIWQGLINTQSDVISSSKKLLRLWVHECSRVLSDRLIDESDLQWFERNIEFCLDDSEVVEFRDPPNERTYFVDFLRDAPETVEEGADDSAFAVPKIYEPVPSFELLKERLSMFNKSYNETVRGSPINLVFFIDAMLHVVKISRVIRMQKGNILLVGVGGSGKQSITRLASFIADYVCFQITITRIYNLNNFLEDLKSIYRFAGKENKGTVFMFTDNEIKDESYLEYINNMLASGMIAGLFSKEEMDEILSFVGYDMKKFFPKHPQTQENLYQYFLDRVRDNLHLVLCFSPIGEKFRKRALYFPALTSGCTINWFQKWPKEALVTVAQHKLHDFPLVCEDFVKEKIVDLLAVIHQDVFSNCLKYFNQYRRSVQITQKSYLSYIDLYKTMYQTTKASVSLLNERMQNGLQKLKEAQEAIILLSKELEIKERXXXXXXXXXXXXXXXVTKQTTAAEAVKNKVRTVKDKCAAIVEKIRVDQQVAEEKLTAAKPALQEAEDALNTIKPNDISTVRKLQKPPHLIQRIMDCVLILFQKKIDPYIPDHERKGVKTSWVESLKLLASTNFLNSLLTFPRDLINEEIIDLLQPYFTREDYHLEAARKSCGNVAGLCAWTKAMEKFYWVNREVIPLKDHLASQNIILAKAQDDLQSXXXXXXXXXXXXXXXXXXYDTAIKRKQALESDAAMCRKKMSTANQLMNGLKDEKARWTLQSIEFESQIGLLVGDMVVLSAFVSYCGPFNQQFRLKMFSHWESVIRNNGVPINKTIDIVEKLSNPNQIGEWNLQGLPNDKLSVENAIIVTQASRYSLFIDPQSQGKHWILNKETEHHIMTTNFTNKYFQQHLEDALTNGHPLIIEDITEELDPALNNVLEKNFIKIGTGLKVKVGDKEVDIHKKFNLYITTKLSNPHFSPEIYAKTSVIDFSVTMKGLEDQLLGIVINIEKEELENSRNQLLKQTSNNKRKVKELEDSLLERLANTEGSLVEDQNLLMVLNKAKQTSYDVSIQIAQAADTEREINQAREEYRSISKRGSLLYFLITDLSGVNPMYQSGLKQFLNLFVNSIIESEKSPFIQRRIQHIISCMTVNIWNFIVRSLYKIDRTTFTLLLALKVDMENNSVRQEELNVLLKGGSALDLKTIDPKPIKWIVDMTWLNLVALSKLHVFSGLVEQIVSSEKQWRAWFDKDAPEDEDIPCGYEAILDEFKKLLLIRCWCPDRTLIMARRYICRTLGDHFIEDVPFKIGSLSREADAKTPLLGLLSLGADPTPLIEHHAKKHHIQIGTISMGQGQEVHSRRVIAKAMQEGTWVLLQNCHLCIDYINELFQVIQESTNVNALYRLWMTSEQHDQFPINFLQIAIKFTNEPPEGIRANLQRSFADLTQDYLDSFVVIHWKVMFYSLAFLHCTVQERRKFGPLGWNIPYEFNQADFNACNMFIQNHLDGITFKKSHKTSGIDWKCVRYMISEIQYGGRVTDDFDLRLLMVITKWYFQEPMFQPDFFINPIQKIVVFNTVDEYRNYISNLPTTDNPGSFGLHNNADISYSTKTTKRILETILSIQPKDSHQGEGETRESIVYKQCTEMLDKIPSNHIPFKVAEKINKMGAFQPMNIFLRQEIDRIDKVIHNVRMTLTDLKLAIDGVVVMNDGLRDALDCIFDAKIPGMWEKISWESTTLGFWFIELIDRNNQFLKWLNDGRPVCFWITGFFNPQGFLTAMRQEVTRSHDGWAFDSVILGNRVTRFYTEELREPPKEGVYIYGLFLEGASWDKRNGRLIEAKPKILYDSLPVINIFALXXX--XXXXXXXDTKMYISPIYKKPRRTNLTYIANAELVCSKSAEHWIMRGVAMLCDIK 14102
            + +L +F  RN E ++K  R TL+++++R+ ++    + D   +      F+ +  L IPNI+  PN++E+Q  +N+    I+ +S+ I QW+      KQ+      + E ++D+++                                  PG  ++                      K+  K ++++K+VAK  S LS  +N+ + +V+T +  FS YS LW +     ++EF++  P +SE +  IK +  +E +I++    Y  G +  ++E LK GL+SE  +W+  Y +  N K   EM+ I    + L KRLSR +KDLDD+R  M AL E+RE+EI+I+MTI PIEE+Y ML +YE+      +ERVD+L Y + KL ++   VQD+L+ IQP+F+  LIE V+ FK++   F  DYD+ GPM  G+ PREASDRL I+Q ++D L R++ TYSGGEELFGL VTDY  ++ I+KELNLLQKLY LYN+V+++VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD T EI+S+MEDSLM L +LLSNRYN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ +EM G YSL+KPGDF +++D+  +AAMIHPGGGRNDIP+RLKR F IFNCTLP+ ASID+I+ ++G G++C ER F+  V + V+ L+  TRKLWQ TK KM PTP+KFHYVFNLRDLSRIWQG++   SDVI+S  KL+ LW HEC RV++DR  +++D  WFE+ ++   ++    E         YFVDFL+DAPE   E  +++    PKIYEP+ S+E L +RL  +   YNETVRG  ++LVFF DAM H+VKISRVIR  KG+ LLVGVGGSGKQS+TRLASFI+ Y  FQIT+TR YN++N +EDLK +YR +G+  KG  F+FTDNEIKDES+LE++NNML+SG IA LF+++EMDEIL  +   MKK +P+ P + ENL +Y++ RV   LH+VLCFSP+GEKFR R+L FP L SGCTI+WFQ+WPK+AL+ V+ + L  F +V    VK+ +V+ + +    V  NC+ YF ++RR   +T KSYLS+I  YK +Y   +  +  L  RM  GL+KL EA E++  LSKEL +KE+ L VA  +A  VLA V  + +AA+ VK +V+ VKD+  A+V  I  D+ +AEEKL AAKPALQEAE+AL TIKP  I+TV+KL +PPHLI RIMDCVLILF+K++D    D ER   K +W E++KL++ +NFL SLL FP+D IN+E++DL++PYF  ED++L +A+   G+VAGLC+WTKAM  F+ +N+EV+PLK +LA Q   L  A  +L +A+++L  K++ L +V+ EY+ A+  KQALE DA  CR+KM+ A  L+ GL  E+ RWT  S  F+ QI  LVGD+++++AF+SYCGPFNQ FR  +   W+  +  NG+P    +  +  L++   I EWN+QGLPND+LSV+N +IVT+A RY L IDPQ QGK WI NKE  H +  T   +KYF+ HLEDAL+ G PL+IED+ EE+DPAL+NVLEKNFIK G+  KVKVGDKEVD+ K F LY+TTKL NP ++PE++AKTS+IDF+VT+KGLEDQLLG+VI  EK+ELE  R +L+++ + NKRK KELED+LL RL +TEGSLVED++L+ VL   K+T+ DV  ++    DTE +IN AREEYR ++ RGS+LYFLI ++S VN MYQ+ LKQFL LF  S+  S+KSP   +RI +II  +T  ++ +  R  Y+ D+ TFT+LL +K+ M++  ++ EE  + +KGG+ALDL  ++PKP KWI D+TWLNLV LSKL  F  + EQ+  ++K W+ WFD DAPE+  IP GY+  L+ FKKLLLIR WCPDRT+ MA++YI  T+G  F E V   +  +  E D  TP++  LS+G+DPT  IE  AKK +++ G+ISMGQGQEVH+R++++ +MQEG W+LLQNCHL +++++E  ++I  + N++  +R W+T+E H +FPIN LQ+ IKFT +PP GIRA L+R++A LTQD LD      WK M + +AFLH TVQERRKFGP+GWNIPYEFNQ+DF +   F+QNHLD +  K+     G+ WK V YMI E+QYGGRVTDD+D RLL    K +F   MF P F       I    ++DEYR +I  LP  D+P  FGLH NADI Y T    ++L TI++IQPKDS  G GETRES+VY+   +ML ++P ++ PF+V EK+ KMG+ +P+NIFL+QE+DR+ KVI  VR TL DLKLAIDG ++M++ L+DALD IFDA+IP  W K+SWES TLGFWF +L+DRN QF  WL +GRPVCFW+TGFFNPQGFLTAMRQE+TR+H GWA D+V+L N VT+F  E++   P EGVY++GL+L+GA W+ R+ +L E  PK+LY  LPV++++A+        K + + + Y  P+YKKPRRT+L YI    L  +++ +HWI+RGVA+LCDIK
Sbjct:  968 YAMLNYFTQRNTETLIKCTRLTLDTIKRRLQSSSNKFSIDPMNEDKRPALFKADLVLHIPNILTKPNLDEIQVILNKAVQAILKMSENIEQWTHMHLHHKQIQELEKLAEENNDDNKL----------------------------------PGPGSV----------------------KSLNKLISDHKDVAKAVSQLSGIMNTFKSQVQTLLSEFSGYSTLWKEEPQTKVKEFMQTKPILSEINAQIKYFSDMEAEIHSFPPTYKVGAVVFYSEPLKQGLISECHSWKTAYAQELNNKCAQEMDSILELFDSLSKRLSRPVKDLDDVRSHMAALSELRESEIKIEMTIQPIEEAYVMLHKYEIYFNDGNSERVDSLIYGYSKLRTQAQTVQDHLLEIQPKFKGELIEGVKAFKENVISFVGDYDSRGPMAQGIVPREASDRLTIYQTKFDELWRKYTTYSGGEELFGLEVTDYPDIQRIRKELNLLQKLYQLYNNVLDTVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGDATGEIVSLMEDSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQTEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTRSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYDN-LETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKR-----GVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKTNEAPDHWILRGVALLCDIK 4614          

HSP 2 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 347/886 (39.16%), Postives = 559/886 (63.09%), Query Frame = 3
Query:  144 LLMRENLTEKQLKIKEERLAKRSRLDERHQYLLRQVADFYDLECTEVEESILDGNQIELMDKFFSSDDTNTLFFHFQEPELEKETGDQIRIGLTGIKQSRVMKPKVFITQGKEAPLKGQCVVFMRSSQGTQINENTIAKDVNFIVINGSNG-VLQGLEEYMSRVMLPHFRNLKGGWGQLE-KDEDSRR--AMMNSLENFVLVLSNARESINERVALKVCTEIDL-KRIRLPIDCMNIVNNTEQLMKVEHCVGLWLKQIEQVLAESDQIRREADNIGPRAELDYWKKRMAKFNYLLDQLKLPEVKAAIGILQAAKSKTLKTWIEMDRRITDAANEAKDNVKFLYTLEEHCAPLYQNNPALMIDNIPKLISSVRMIHSISQYYNTSEKMTSLFVKITNQMITSCKAYISNDNTETVWTLEPEELMKRLLKCCELNKTYQACFQETKLRLANQPHERQFELSEMYIFGKFDTFCRRLSSIIKIFEIIKTYSVLTDASIEGLESMGVKFNVIVSTIKKKNYNFLDQRRTEFTQDFDDFIRQIQELHNNILNFMDGGFDHITSTTRAIQSLRRFERLNIPDLGIEEKYMKILTHYGRDVEAVIKHYSRNKEDPPVARDMPLIAGKIAWARQLFRRIQAPMEMFEIQHQNLLKTPEAKVIIKNYNKLAETLISFEIIYHQAWVRQINSTHTGLNSSLIIRHPETK----ELYVNFDPDILILARETDIMMKLKLEIPPAAINLKMKQNALKEFHNKLMLMVNYIQKVTNSIPQEYEQLMVLRMAKLRRIIEPGLTTHNWTSMKLQEYIDSVYGGLAELELLLDRAQDLRKYRIDLVLEEMSTIQLCELPNDVPVTVDEFVNNTQELCIKAAKLLQSKSQNVEDSVNELINML 2774
            ++  E+  E+Q  +K+ +  +R  +D RH ++ + +AD  DL+ T+VE+++L   +    ++FFS + +  L F++Q+  +E    D  R   T I      K K+FI  G   PLKG C +F+RS+    +  N IA D+ F +++ S G +L  LE ++S++M P  +NL+  WG +  KD  + +       L+ F+  L  A+++++ ++ L+   + DL  +I +P   +  VN++E + K+E+ +  W+KQIEQVL+ES+QIRREAD++GP AEL YWK RM++FN LL+Q+K  +V   I IL  AKS++L+ W E+D RITDAANEAKDNVK+LYTL++   PL + NP  MI++IP LI+++RMIHSISQYYN+SE+MTSLFVK+TNQMIT+CK ++  +    +W L  EEL KR+  C  LN+ Y+ CF +TK +L     E+QFE SE YIFGKF+ FC+RL  I  +  I+++YS+L    IEG++S+ V++  I   IKKK Y+ LD R++EF  D+ DF+ Q + L   I  F+D  F+      + +  L++FE+++   L  ++K+ K+L ++ + ++ V K Y + K DPP+ R++P IAGKI+W+R LF++I+ PM +F+     +LK PEA  ++KNYNK+A+ L+ FE+IY+  W + I +   GL SSL+IR+P+ +    +  VNFD  IL L +E   +  L L+IP  A  L   +N +K+ +  +  ++    ++ +S+P     +M   + ++     PGL    WTSMK+ +Y++ V   L    LL+ +  D+   RI+ VL++M+   LC+LP D P+T++EF++ T++   +A++ L  +S+ VE +VN++I++L
Sbjct:   52 IITGESRKEQQKLLKQRKDERRLLVDPRHTFIFQTIADVSDLDLTQVEDALLGDEKWGAFEEFFSPNRSKKLMFYYQDVMVE----DYSRTDSTSIGPVSAHK-KLFIATGSSEPLKGLCFLFIRSTDKA-LTSNNIAADITFQMLDASGGRLLDALERHISKIMFPVLQNLEE-WGSMSTKDGHNSKISEFFEILDRFLNALITAQKNMDSQMQLENDDDEDLMAKIEIPSYRLVAVNSSETMEKLENLLHRWIKQIEQVLSESEQIRREADDVGPSAELSYWKSRMSRFNNLLEQMKTKKVTDVITILHFAKSRSLRKWRELDSRITDAANEAKDNVKYLYTLDKFFGPLSKCNPVDMIEHIPSLINAIRMIHSISQYYNSSERMTSLFVKVTNQMITTCKHFMY-EGVSKIWDLGREELAKRISHCKRLNEEYEFCFHKTKKKLQEDSTEKQFEFSENYIFGKFEAFCKRLDKINNLQNILESYSLLQTFKIEGIDSIVVRYKSINDIIKKKTYDILDHRKSEFDNDYQDFMVQFETLEGQIQAFLDTWFEKSMPIDKQLNLLKKFEQIDCLKLDCQDKHAKVLQNFSKTLDNVRKLYQKYKSDPPLMRNLPPIAGKISWSRHLFKKIEGPMILFKETRPEILKMPEAIKLVKNYNKMAKVLLEFELIYYNNWFKTIENFKLGLASSLLIRNPDKEKDGAKFLVNFDTMILELIQEAKYIRSLNLDIPEIASRLIHNENIIKDTYRGMKEILLEYSEIIDSVPPVVFPMMRPHIHRIDETFTPGLVALTWTSMKIPDYMEKVRESLQSFRLLIKKVSDILDVRIEAVLDDMAVTALCDLPEDEPITIEEFLSMTEQTVEEASEYLAKESKLVEIAVNDIIDIL 929          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH50.000e+058.04dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH80.000e+053.94dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+054.48dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH80.000e+053.62dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH26.081e-1833.12dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-10.000e+026.69Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.69Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+026.69Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-30.000e+026.42Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-39.921e-2325.41Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94921.971e-11154.91gene:FBgn0037726 transcript:FBtr0309028[more]
CG94922.007e-11154.88gene:FBgn0037726 transcript:FBtr0309029[more]
CG94921.946e-11154.58gene:FBgn0037726 transcript:FBtr0309027[more]
CG94921.718e-11154.56gene:FBgn0037726 transcript:FBtr0344344[more]
kl-34.017e-7551.54gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah50.000e+060.31dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l4.790e-15456.45dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah5l0.000e+058.34dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah21.515e-4033.38dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah27.368e-2233.38dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.10.000e+062.00dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000035049.12.824e-15661.79dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021565.12.204e-15963.37dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021598.16.310e-16463.30dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk1.533e-6059.59nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah50.000e+057.77dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah80.000e+054.06dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+054.06dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah80.000e+054.06dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah23.360e-1733.37dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE73|DYH5_HUMAN0.000e+058.04Dynein heavy chain 5, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE0.000e+057.77Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q91XQ0|DYH8_MOUSE0.000e+054.06Dynein heavy chain 8, axonemal OS=Mus musculus OX=... [more]
sp|Q96JB1|DYH8_HUMAN0.000e+054.48Dynein heavy chain 8, axonemal OS=Homo sapiens OX=... [more]
sp|M0R8U1|DYH5_RAT0.000e+058.10Dynein heavy chain 5, axonemal (Fragment) OS=Rattu... [more]
back to top
BLAST of Dynein heavy chain 5, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5