Calcium-activated potassium channel subunit alpha-1

Overview
NameCalcium-activated potassium channel subunit alpha-1
Smed IDSMED30034881
Length (bp)3245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-activated potassium channel subunit alpha-1 (SMED30034881) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-activated potassium channel subunit alpha-1 (SMED30034881) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-activated potassium channel subunit alpha-1 (SMED30034881) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-activated potassium channel subunit alpha-1 (SMED30034881) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034881

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034881SMESG000040071.1 SmedASXL_015794SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034881SMESG000040071.1 dd_Smed_v4_17366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 340.887 bits (873), Expect = 9.000e-100
Identity = 273/1011 (27.00%), Postives = 471/1011 (46.59%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIK----NVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    N ++     + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   10 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 983          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 343.199 bits (879), Expect = 9.963e-100
Identity = 274/1007 (27.21%), Postives = 472/1007 (46.87%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+     QPST +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  149 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1118          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 343.199 bits (879), Expect = 1.064e-99
Identity = 272/1007 (27.01%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  149 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1118          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 342.813 bits (878), Expect = 1.202e-99
Identity = 272/1007 (27.01%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  149 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1118          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 342.813 bits (878), Expect = 1.664e-99
Identity = 272/1007 (27.01%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  193 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1162          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 298.13 bits (762), Expect = 1.228e-84
Identity = 268/1029 (26.04%), Postives = 458/1029 (44.51%), Query Frame = 1
Query:  328 AMGECDSDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYI---GFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNC-------------------------QMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI---------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG---NDDVNETSDKQSLICATLIRSMLADHRPEF-----------SLITEIREDEVACHFSSVEAF--DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLN-----FGKRRYVYTHPKKSTEILMTDKVY 3141
            A  E D    +  E  +G MT +K      W   + S +S  GR   L + IL++ S  IY     F  +Q  T     D  S +      ID G N+FF ++F  R  AA D + F +   + ID   IP  F++ +L     G  FLR   +  + D++ ++N  ++K +S  ++  L    V+V + G+G +H+ EN+GD +         ++  S YF+L T+STVGYGD    T+ G++ +  +I++ + +FA+ +PEI   I +  KY  +Y    G+KH++V G     ++  FL+ F+++       +++++ ++    D  L    K+  + + +  G++    D+ RV +  A    +L+  Y+     +D+ NIM  IS+K     IR IVQL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +      LW  +Y  G    +Y    S  F  MS  + A +L+    + LLAI  K+ +N   N + INP   ++ I   +  G  +A+     +R  ++C +C       +    C C                         Q QP       +  +  +++ + ++Q   SS       S P        +++          D T  F W  +  L++  ++  QA     + H+++CL    +   I L NF+MPLR  +  +  L+ +VI+G+ +Y    +W  + N PK  I++GSP+   D+RA  +  C  C +++    N +    +DK++++ +  I++M  D    F            L + I   +    F +      ++ N   VQ                ++PFA G  F  S+L   + + Y N    + +  L+ G     +E +   G GL      P+ + + +   +A +  Q  P  D + HN         TY  +F  AL++   LC+GLYRL+        +RYV T+P     I  TD VY
Sbjct:  101 APSETDPFLKQQEEKHLGWMTEAK-----DWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQ------IDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLN--ILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDV--DVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECN-IAINP-GPHIVIQPQTQ-GFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAG-PMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLR-KEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTEDTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPY-DGVVHNT--------TYGAMFTIALRRYGQLCIGLYRLHDQDNPDSMKRYVITNPPAELRIKNTDYVY 1100          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 293.893 bits (751), Expect = 3.731e-83
Identity = 267/1029 (25.95%), Postives = 458/1029 (44.51%), Query Frame = 1
Query:  328 AMGECDSDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYI---GFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNC-------------------------QMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI---------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG---NDDVNETSDKQSLICATLIRSMLADHRPEF-----------SLITEIREDEVACHFSSVEAF--DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLN-----FGKRRYVYTHPKKSTEILMTDKVY 3141
            A  E D    +  E  +G MT +K      W   + S +S  GR   L + IL++ S  IY     F  +Q  T     D  S +      ID G N+FF ++F  R  AA D + F +   + ID   IP  F++ +L     G  FLR   +  + D++ ++N  ++K +S  ++  L    V+V + G+G +H+ EN+GD +         ++  S YF+L T+STVGYGD    T+ G++ +  +I++ + +FA+ +PEI   I +  KY  +Y    G+KH++V G     ++  FL+ F+++       +++++ ++    D  L    K+  + + +  G++    D+ RV +  A    +L+  Y+     +D+ NIM  IS+K     IR IVQL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +  +T   W   Y  G    +Y    S  F GM+  +   +L+    + LLAI  K+ +N   N + INP   ++ I   +  G  +A+     +R  ++C +C       +    C C                         Q QP       +  +  +++ + ++Q   SS       S P        +++          D T  F W  +  L++  ++  QA     + H+++CL    +   I L NF+MPLR  +  +  L+ +VI+G+ +Y    +W  + N PK  I++GSP+   D+RA  +  C  C +++    N +    +DK++++ +  I++M  D    F            L + I   +    F +      ++ N   VQ                ++PFA G  F  S+L   + + Y N    + +  L+ G     +E +   G GL      P+ + + +   +A +  Q  P  D + HN         TY  +F  AL++   LC+GLYRL+        +RYV T+P     I  TD VY
Sbjct:  101 APSETDPFLKQQEEKHLGWMTEAK-----DWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQ------IDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLN--ILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDV--DVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECN-IAINP-GPHIVIQPQTQ-GFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAG-PMGHLGQQVQLRMINQQRPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLR-KEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTEDTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPY-DGVVHNT--------TYGAMFTIALRRYGQLCIGLYRLHDQDNPDSMKRYVITNPPAELRIKNTDYVY 1100          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 292.738 bits (748), Expect = 1.250e-82
Identity = 271/1051 (25.78%), Postives = 466/1051 (44.34%), Query Frame = 1
Query:  328 AMGECDSDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYI---GFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNC-------------------------QMQPSTK--------NNFDLKKVHNRMKSKRLSQISKSSYLFS-----LMDSNPYKIDSGTLTEN---IDETETF---------------FWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG---NDDVNETSDKQSLICATLIRSMLADHRPEF-----------SLITEIREDEVACHFSSVEAF--DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLN-----FGKRRYVYTHPKKSTEILMTDKVY 3141
            A  E D    +  E  +G MT +K      W   + S +S  GR   L + IL++ S  IY     F  +Q  T     D  S +      ID G N+FF ++F  R  AA D + F +   + ID   IP  F++ +L     G  FLR   +  + D++ ++N  ++K +S  ++  L    V+V + G+G +H+ EN+GD +         ++  S YF+L T+STVGYGD    T+ G++ +  +I++ + +FA+ +PEI   I +  KY  +Y    G+KH++V G     ++  FL+ F+++       +++++ ++    D  L    K+  + + +  G++    D+ RV +  A    +L+  Y+     +D+ NIM  IS+K     IR IVQL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +      LW  +Y  G    +Y    S  F  MS  + A +L+    + LLAI  K+ +N   N + INP   ++ I   +  G  +A+     +R  ++C +C       +    C C                         Q QP               L+ + N+  S   + ++  S  F+     LM S+  + +S ++  +   +D ++ F                W  +  L++  ++  QA     + H+++CL    +   I L NF+MPLR  +  +  L+ +VI+G+ +Y    +W  + N PK  I++GSP+   D+RA  +  C  C +++    N +    +DK++++ +  I++M  D    F            L + I   +    F +      ++ N   VQ                ++PFA G  F  S+L   + + Y N    + +  L+ G     +E +   G GL      P+ + + +   +A +  Q  P  D + HN         TY  +F  AL++   LC+GLYRL+        +RYV T+P     I  TD VY
Sbjct:  101 APSETDPFLKQQEEKHLGWMTEAK-----DWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQ------IDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLN--ILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDV--DVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECN-IAINP-GPHIVIQPQTQ-GFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMI-NQQSSTSDTHLNTKSLRFAYEIKKLMPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLR-KEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTEDTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPY-DGVVHNT--------TYGAMFTIALRRYGQLCIGLYRLHDQDNPDSMKRYVITNPPAELRIKNTDYVY 1122          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 288.115 bits (736), Expect = 4.435e-81
Identity = 270/1051 (25.69%), Postives = 466/1051 (44.34%), Query Frame = 1
Query:  328 AMGECDSDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYI---GFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNC-------------------------QMQPSTK--------NNFDLKKVHNRMKSKRLSQISKSSYLFS-----LMDSNPYKIDSGTLTEN---IDETETF---------------FWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG---NDDVNETSDKQSLICATLIRSMLADHRPEF-----------SLITEIREDEVACHFSSVEAF--DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLN-----FGKRRYVYTHPKKSTEILMTDKVY 3141
            A  E D    +  E  +G MT +K      W   + S +S  GR   L + IL++ S  IY     F  +Q  T     D  S +      ID G N+FF ++F  R  AA D + F +   + ID   IP  F++ +L     G  FLR   +  + D++ ++N  ++K +S  ++  L    V+V + G+G +H+ EN+GD +         ++  S YF+L T+STVGYGD    T+ G++ +  +I++ + +FA+ +PEI   I +  KY  +Y    G+KH++V G     ++  FL+ F+++       +++++ ++    D  L    K+  + + +  G++    D+ RV +  A    +L+  Y+     +D+ NIM  IS+K     IR IVQL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +  +T   W   Y  G    +Y    S  F GM+  +   +L+    + LLAI  K+ +N   N + INP   ++ I   +  G  +A+     +R  ++C +C       +    C C                         Q QP               L+ + N+  S   + ++  S  F+     LM S+  + +S ++  +   +D ++ F                W  +  L++  ++  QA     + H+++CL    +   I L NF+MPLR  +  +  L+ +VI+G+ +Y    +W  + N PK  I++GSP+   D+RA  +  C  C +++    N +    +DK++++ +  I++M  D    F            L + I   +    F +      ++ N   VQ                ++PFA G  F  S+L   + + Y N    + +  L+ G     +E +   G GL      P+ + + +   +A +  Q  P  D + HN         TY  +F  AL++   LC+GLYRL+        +RYV T+P     I  TD VY
Sbjct:  101 APSETDPFLKQQEEKHLGWMTEAK-----DWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQ------IDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLN--ILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDV--DVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELKDEENKECN-IAINP-GPHIVIQPQTQ-GFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMI-NQQSSTSDTHLNTKSLRFAYEIKKLMPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLR-KEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTEDTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPY-DGVVHNT--------TYGAMFTIALRRYGQLCIGLYRLHDQDNPDSMKRYVITNPPAELRIKNTDYVY 1122          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 214.542 bits (545), Expect = 1.056e-56
Identity = 165/564 (29.26%), Postives = 277/564 (49.11%), Query Frame = 1
Query:  328 AMGECDSDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYI---GFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC 1989
            A  E D    +  E  +G MT +K      W   + S +S  GR   L + IL++ S  IY     F  +Q  T     D  S +      ID G N+FF ++F  R  AA D + F +   + ID   IP  F++ +L     G  FLR   +  + D++ ++N  ++K +S  ++  L    V+V + G+G +H+ EN+GD +         ++  S YF+L T+STVGYGD    T+ G++ +  +I++ + +FA+ +PEI   I +  KY  +Y    G+KH++V G     ++  FL+ F+++       +++++ ++    D  L    K+  + + +  G++    D+ RV +  A    +L+  Y+     +D+ NIM  IS+K     IR IVQL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +      LW  +Y  G    +Y    S  F  MS  + A +L+    + LLAI  K+ +N   N + INP   ++ I   +  G  +A+     +R  ++C +C
Sbjct:  101 APSETDPFLKQQEEKHLGWMTEAK-----DWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDASFQNFQVETCIPWQDSPSQQ------IDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLN--ILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDV--DVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELKDEENKECN-IAINP-GPHIVIQPQTQ-GFFIAQSADEVKRAFFWCKQC 646          

HSP 2 Score: 112.079 bits (279), Expect = 9.821e-25
Identity = 93/363 (25.62%), Postives = 159/363 (43.80%), Query Frame = 1
Query: 2182 DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG---NDDVNETSDKQSLICATLIRSMLADHRPEF-----------SLITEIREDEVACHFSSVEAF--DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLN-----FGKRRYVYTHPKKSTEILMTDKVY 3141
            D T  F W  +  L++  ++  QA     + H+++CL    +   I L NF+MPLR  +  +  L+ +VI+G+ +Y    +W  + N PK  I++GSP+   D+RA  +  C  C +++    N +    +DK++++ +  I++M  D    F            L + I   +    F +      ++ N   VQ                ++PFA G  F  S+L   + + Y N    + +  L+ G     +E +   G GL      P+ + + +   +A +  Q  P  D + HN         TY  +F  AL++   LC+GLYRL+        +RYV T+P     I  TD VY
Sbjct:  768 DSTGMFHWCPSRNLEDCVLERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLR-KEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPNTEDTTLADKEAILASLNIKAMQFDDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPY-DGVVHNT--------TYGAMFTIALRRYGQLCIGLYRLHDQDNPDSMKRYVITNPPAELRIKNTDYVY 1120          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100636)

HSP 1 Score: 333.183 bits (853), Expect = 1.488e-96
Identity = 264/1037 (25.46%), Postives = 465/1037 (44.84%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-KDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLA--IKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSY----TNSFTICNCQ---MQPSTK--------------------------NNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSN---------PYKIDSGTLTEN---------------------------IDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG----NDDVNETSDKQSLICATLIRSM--------LADHRPEFS------------------------LITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIP--KKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLT-------YEILFEWALQKKHILCLGLYRL-------NFGKRRYVYTHPKKSTEILMTDKVY 3141
            W   + S +++ GRI  + + IL++ S  IY    +   ++  +E         I + ID   N+FF ++F  R  AA D + F +   + +D   IP  F+S +L     G+ FLR   +  + D++ ++N  ++K +S  ++  L    +SVW+  +G IH+ EN+GD  LD N     S+W   YFL+ T+STVGYGD   +TV G+  +  +++  + +FA+++PEI   +   +KY  +     G++H++V G     ++  FLK F+++   ++  +++++ ++ +P D  L    K+  + + +  G+I    D++RV +H+A    +L+  Y      +D+ NIM  IS+K   + IR I+QL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +       W+ +Y +G    +Y    S  F GM+    + + +    + LLA  IK  +    + ++INP    ++ +T    G  +A+     +R  ++C  C            C C+   +QP +K                          NN            K+++++  +  +   ++           P    SGT T+N                            D T  F W+    L++  +D  QA     + H+++CL    +   I L N +MPLR  +  +  L+ +VI+G+  Y    +W  ++N PK  +++GSP+   D+RA  +  C  C +L+     NDD    +DK++++ +  I++M        L+   PEF                         +ITE+  D         +  D D ++ +  ++PFA G  F  S+L   + + Y N +  + + +LI G     +E +   G GL      V SL N     V Q+            +L++G L        Y  LF  AL+   +LC+GLYR        +   +RYV T+P     +L TD+V+
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIY----FVDASSEEVE-RCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLN--VLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDP-LDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHED--REDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQ---GFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIR-REWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPT-LADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYL--TQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQI------------SLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVF 1121          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100637)

HSP 1 Score: 332.798 bits (852), Expect = 1.979e-96
Identity = 265/1037 (25.55%), Postives = 462/1037 (44.55%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLA--IKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSY----TNSFTICNCQ---MQPSTK--------------------------NNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSN---------PYKIDSGTLTEN---------------------------IDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG----NDDVNETSDKQSLICATLIRSM--------LADHRPEFS------------------------LITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIP--KKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLT-------YEILFEWALQKKHILCLGLYRL-------NFGKRRYVYTHPKKSTEILMTDKVY 3141
            W   + S +++ GRI  + + IL++ S  IY    +   ++  +E         I + ID   N+FF ++F  R  AA D + F +   + +D   IP  F+S +L     G+ FLR   +  + D++ ++N  ++K +S  ++  L    +SVW+  +G IH+ EN+GD  LD N     S+W   YFL+ T+STVGYGD   +TV G+  +  +++  + +FA+ +PEI   I   +KY        G +H++V G     ++  FLK F+++   ++  +++++ ++ +P D  L    K+  + + +  G+I    D++RV +H+A    +L+  Y      +D+ NIM  IS+K   + IR I+QL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +       W+ +Y +G    +Y    S  F GM+    + + +    + LLA  IK  +    + ++INP    ++ +T    G  +A+     +R  ++C  C            C C+   +QP +K                          NN            K+++++  +  +   ++           P    SGT T+N                            D T  F W+    L++  +D  QA     + H+++CL    +   I L N +MPLR  +  +  L+ +VI+G+  Y    +W  ++N PK  +++GSP+   D+RA  +  C  C +L+     NDD    +DK++++ +  I++M        L+   PEF                         +ITE+  D         +  D D ++ +  ++PFA G  F  S+L   + + Y N +  + + +LI G     +E +   G GL      V SL N     V Q+            +L++G L        Y  LF  AL+   +LC+GLYR        +   +RYV T+P     +L TD+V+
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIY----FVDASSEEVE-RCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLN--VLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDP-LDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAIFASCIPEIIDLIGTRAKYGGTLKNEKGRRHIVVCGHITYESVSHFLKDFLHED--REDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQ---GFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIR-REWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPT-LADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYL--TQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQI------------SLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVF 1121          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0334294)

HSP 1 Score: 328.561 bits (841), Expect = 3.656e-95
Identity = 261/1025 (25.46%), Postives = 465/1025 (45.37%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-KDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLA--IKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSY----TNSFTICNCQ-------MQPSTK----------NNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSN---------PYKIDSGTLTENI------------DETETF---------------FWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG----NDDVNETSDKQSLICATLIRSM--------LADHRPEFS------------------------LITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIP--KKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLT-------YEILFEWALQKKHILCLGLYRL-------NFGKRRYVYTHPKKSTEILMTDKVY 3141
            W   + S +++ GRI  + + IL++ S  IY    +   ++  +E         I + ID   N+FF ++F  R  AA D + F +   + +D   IP  F+S +L     G+ FLR   +  + D++ ++N  ++K +S  ++  L    +SVW+  +G IH+ EN+GD  LD N     S+W   YFL+ T+STVGYGD   +TV G+  +  +++  + +FA+++PEI   +   +KY  +     G++H++V G     ++  FLK F+++   ++  +++++ ++ +P D  L    K+  + + +  G+I    D++RV +H+A    +L+  Y      +D+ NIM  IS+K   + IR I+QL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +       W+ +Y +G    +Y    S  F GM+    + + +    + LLA  IK  +    + ++INP    ++ +T    G  +A+     +R  ++C  C            C C+        +P+            NN            K+++++  +  +   ++           P    SGT T+N             D+++ F                W+    L++  +D  QA     + H+++CL    +   I L N +MPLR  +  +  L+ +VI+G+  Y    +W  ++N PK  +++GSP+   D+RA  +  C  C +L+     NDD    +DK++++ +  I++M        L+   PEF                         +ITE+  D         +  D D ++ +  ++PFA G  F  S+L   + + Y N +  + + +LI G     +E +   G GL      V SL N     V Q+            +L++G L        Y  LF  AL+   +LC+GLYR        +   +RYV T+P     +L TD+V+
Sbjct:   97 WAGELISGQTTTGRILVVLVFILSIASLIIY----FVDASSEEVE-RCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLN--VLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDP-LDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHED--REDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQ---GFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIR-REWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPT-LADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYL--TQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQI------------SLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVF 1092          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100632)

HSP 1 Score: 328.176 bits (840), Expect = 9.107e-95
Identity = 262/1037 (25.27%), Postives = 462/1037 (44.55%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-KDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNL--WRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLA--IKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSY----TNSFTICNCQ---MQPSTK--------------------------NNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSN---------PYKIDSGTLTEN---------------------------IDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG----NDDVNETSDKQSLICATLIRSM--------LADHRPEFS------------------------LITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIP--KKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLT-------YEILFEWALQKKHILCLGLYRL-------NFGKRRYVYTHPKKSTEILMTDKVY 3141
            W   + S +++ GRI  + + IL++ S  IY    +   ++  +E         I + ID   N+FF ++F  R  AA D + F +   + +D   IP  F+S +L     G+ FLR   +  + D++ ++N  ++K +S  ++  L    +SVW+  +G IH+ EN+GD  LD N     S+W   YFL+ T+STVGYGD   +TV G+  +  +++  + +FA+++PEI   +   +KY  +     G++H++V G     ++  FLK F+++   ++  +++++ ++ +P D  L    K+  + + +  G+I    D++RV +H+A    +L+  Y      +D+ NIM  IS+K   + IR I+QL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL        + ++  W  +Y  G    +Y    S  F G+       + +    + LLA  IK  +    + ++INP    ++ +T    G  +A+     +R  ++C  C            C C+   +QP +K                          NN            K+++++  +  +   ++           P    SGT T+N                            D T  F W+    L++  +D  QA     + H+++CL    +   I L N +MPLR  +  +  L+ +VI+G+  Y    +W  ++N PK  +++GSP+   D+RA  +  C  C +L+     NDD    +DK++++ +  I++M        L+   PEF                         +ITE+  D         +  D D ++ +  ++PFA G  F  S+L   + + Y N +  + + +LI G     +E +   G GL      V SL N     V Q+            +L++G L        Y  LF  AL+   +LC+GLYR        +   +RYV T+P     +L TD+V+
Sbjct:  114 WAGELISGQTTTGRILVVLVFILSIASLIIY----FVDASSEEVE-RCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLN--VLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDP-LDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHED--REDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQ---GFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMKYDSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIR-REWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPT-LADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYL--TQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQI------------SLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVF 1121          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0084685)

HSP 1 Score: 250.751 bits (639), Expect = 3.457e-68
Identity = 160/565 (28.32%), Postives = 287/565 (50.80%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-KDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNL--MTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLA--IKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSY----TNSFTICNCQ---MQPSTKNNFDLKKVH 2070
            W   + S +++ GRI  + + IL++ S  IY    +   ++  +E         I + ID   N+FF ++F  R  AA D + F +   + +D   IP  F+S +L     G+ FLR   +  + D++ ++N  ++K +S  ++  L    +SVW+  +G IH+ EN+GD  LD N     S+W   YFL+ T+STVGYGD   +TV G+  +  +++  + +FA+++PEI   +   +KY  +     G++H++V G     ++  FLK F+++   ++  +++++ ++ +P D  L    K+  + + +  G+I    D++RV +H+A    +L+  Y      +D+ NIM  IS+K   + IR I+QL  Y NK  L   P W+  + D V+CL EL+LG +A +CL PG +T++ NL  M   +       W+ +Y +G    +Y    S  F GM+    + + +    + LLA  IK  +    + ++INP    ++ +T    G  +A+     +R  ++C  C            C C+   +QP +K + DL + H
Sbjct:   97 WAGELISGQTTTGRILVVLVFILSIASLIIY----FVDASSEEVE-RCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLN--VLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDP-LDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHED--REDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIKGAEEGADSKISINPRGAKIQANTQ---GFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFD-DLDEHH 647          

HSP 2 Score: 112.849 bits (281), Expect = 8.226e-25
Identity = 98/373 (26.27%), Postives = 164/373 (43.97%), Query Frame = 1
Query: 2182 DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNG----NDDVNETSDKQSLICATLIRSM--------LADHRPEFS------------------------LITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIP--KKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLT-------YEILFEWALQKKHILCLGLYRL-------NFGKRRYVYTHPKKSTEILMTDKVY 3141
            D T  F W+    L++  +D  QA     + H+++CL    +   I L N +MPLR  +  +  L+ +VI+G+  Y    +W  ++N PK  +++GSP+   D+RA  +  C  C +L+     NDD    +DK++++ +  I++M        L+   PEF                         +ITE+  D         +  D D ++ +  ++PFA G  F  S+L   + + Y N +  + + +LI G     +E +   G GL      V SL N     V Q+            +L++G L        Y  LF  AL+   +LC+GLYR        +   +RYV T+P     +L TD+V+
Sbjct:  784 DSTGMFHWSPAKSLEDCILDRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIR-REWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSNDDPT-LADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYL--TQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQI------------SLYDGPLAQFGECGKYGDLFVAALKSYGMLCIGLYRFRDTSSSCDASSKRYVITNPPDDFSLLPTDQVF 1140          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 337.806 bits (865), Expect = 6.421e-98
Identity = 260/986 (26.37%), Postives = 456/986 (46.25%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---NFGK-----RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+       +S+ INP   +VK+     +G  +A D    +R  ++C  C    +       C C+      PST        +  + K +     +  +    +M  +P  I      E++       D T  F W  + +++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SM  D                      P+ S +   +R+  V    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL   + G      +RYV T+P    E++ TD ++C +
Sbjct:  119 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPST--------LSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLM 1072          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 330.872 bits (847), Expect = 2.159e-95
Identity = 261/991 (26.34%), Postives = 458/991 (46.22%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNS-----VTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---NFGK-----RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+  K++   S     + INP   +VK+     +G  +A D    +R  ++C  C    +       C C+      PST        +  + K +     +  +    +M  +P  I      E++       D T  F W  + +++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SM  D                      P+ S +   +R+  V    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL   + G      +RYV T+P    E++ TD ++C +
Sbjct:  136 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIE-YKSEQRESRSRKRILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPST--------LSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFEMVPTDLIFCLM 1093          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 315.079 bits (806), Expect = 9.512e-90
Identity = 212/757 (28.01%), Postives = 372/757 (49.14%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD 2613
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+       +S+ INP   +VK+     +G  +A D    +R  ++C  C    +       C C+      PST        +  + K +     +  +    +M  +P  I      E++       D T  F W  + +++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SM  D
Sbjct:  136 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRIEDEHPST--------LSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMQFD 869          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Match: CABZ01092907.1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1b [Source:NCBI gene;Acc:798583])

HSP 1 Score: 233.032 bits (593), Expect = 1.339e-66
Identity = 146/460 (31.74%), Postives = 242/460 (52.61%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMS 1785
            W   + S ++  GR+    LV+L + + SI     Y+  ++  +E   +  K    + ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S
Sbjct:    7 WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSDPIESCEHFDKNFTLQ-IDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSYIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLS 456          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Match: kcnt1 (potassium channel, subfamily T, member 1 [Source:ZFIN;Acc:ZDB-GENE-091231-1])

HSP 1 Score: 97.0561 bits (240), Expect = 8.247e-20
Identity = 89/363 (24.52%), Postives = 167/363 (46.01%), Query Frame = 1
Query:  928 LDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITR---SGEKHMIVTGQFINSTMK-TFLKVFINK-RTRKQFRNMKIIIMNNQPCD------RVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCT---EPMKTHNLWRKEYEEGLENRLYNVEFSD-----DFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHA 1959
            L+   K++ S + + YF + T STVG+GD  PQ    Q++V + I  A+ +      E+ Y   + + +    +R     E+H+++      ST+K   L  F+N+       ++  ++I+   PC+      R+L + L  +S  ++YL GS  +  D+ R  +  A+  FILS          D + I+ A ++K         VQ+    NK  +K          D VVC +E +  ++A NCL P  +TL+T L+  +   E  ++   W++ Y     N +Y++   D     +++  S    A   +K + VC++ +K   N    S+ +NP   ++   + +   I + ++E+ A
Sbjct:  203 LERAGKKSLSLFNALYFCIVTFSTVGFGDVTPQIWPSQLLVVVMICVALVVLPLQFEELIYLWMERQKSGGNYSRHRAQTERHVVLCV----STLKIDLLMDFLNEFYAHPHTQDYYVVILC--PCEVDVQVRRILQIPL--WSQRVIYLQGSALKNQDLLRAKMDDAEACFILSSRNEADRMAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKF--------ADHVVCEEEFKYAMLALNCLCPATSTLITLLVHTSRGQEGQQSPEQWQRMYGRCSGNEVYHIRLGDSMFFREYNSKSFTYAAFHAHKKYGVCMIGVKREDN---KSILLNPGPRHIMSASDTCYYINITKEENSA 546          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 340.117 bits (871), Expect = 1.067e-98
Identity = 261/980 (26.63%), Postives = 458/980 (46.73%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFS---LMDSNPY--KIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITEI-REDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+     +++ + + SI     Y+  +++ +E   +FY    +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+       + + INP   +VKI     +G  +A D    +R  ++C  C    +       C C+     + +    K   R    R S  S  + +     LM  N     +DS ++ +  D T  F W    +LD++ +   +A     S H+++C+ G      I + N +MPLR  +  +  L+ IV +G+  Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +  + R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  L+  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  116 WAGVMISAQTLTGRV-----LVVTVFALSIGALMIYFIDSSNPIETCQNFYKDFTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINP-GNHVKIKE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSV-KRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1070          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 335.109 bits (858), Expect = 3.175e-97
Identity = 262/987 (26.55%), Postives = 455/987 (46.10%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYF---CSKCSYTN-------------SFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITEI-REDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+     +++ + + SI     Y+  +++ +E   +FY    +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+       + + INP   +VKI     +G  +A D    +R   F   C  C+Y+                 + N Q  P++  N      H+ +      QI         MDS+  K          D T  F W    +LD++ +   +A     S H+++C+ G      I + N +MPLR  +  +  L+ IV +G+  Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +  + R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  L+  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   99 WAGVMISAQTLTGRV-----LVVTVFALSIGALMIYFIDSSNPIETCQNFYKDFTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINP-GNHVKIKE-GTLGFFIASDAKEVKRYVCFPVCCPVCTYSTLPVFHTLPTLCCLCLKMSNHQQSPNSSPNM---MRHDPLLMTGNDQIDN-------MDSSSVK--------RYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1043          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 335.88 bits (860), Expect = 4.709e-97
Identity = 260/999 (26.03%), Postives = 461/999 (46.15%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLF------------------SLMDSNPYKIDSGTLTENI--------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITEI-REDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+     +++ + + SI     Y+  +++ +E   +FY    +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+       + + INP   +VKI     +G  +A D    +R  ++C  C    T+   I  C  +   ++ F    + N+ K     +  + S L                   ++M  +P  +      +N+        D T  F W    +LD++ +   +A     S H+++C+ G      I + N +MPLR  +  +  L+ IV +G+  Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +  + R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  L+  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  162 WAGVMISAQTLTGRV-----LVVTVFALSIGALMIYFIDSSNPIETCQNFYKDFTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINP-GNHVKIKE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACK--RRSQFHKSPLQNKKKGNGPFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSVKRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1134          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 334.724 bits (857), Expect = 1.439e-96
Identity = 259/980 (26.43%), Postives = 456/980 (46.53%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFS---LMDSNPY--KIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITEI-REDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+     +++ + + SI     Y+  +++ +E   +FY    +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA  +PEI   I +  KY   +    G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+       + + INP   +VKI     +G  +A D    +R  ++C  C    +       C C+     + +    K   R    R S  S  + +     LM  N     +DS ++ +  D T  F W    +LD++ +   +A     S H+++C+ G      I + N +MPLR  +  +  L+ IV +G+  Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +  + R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  L+  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  162 WAGVMISAQTLTGRV-----LVVTVFALSIGALMIYFIDSSNPIETCQNFYKDFTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTFNATRGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRIIINP-GNHVKIKE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSV-KRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1116          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 332.028 bits (850), Expect = 9.751e-96
Identity = 263/1004 (26.20%), Postives = 461/1004 (45.92%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKND----------------------YLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFS---LMDSNPY--KIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITEI-REDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+     +++ + + SI     Y+  +++ +E   +FY    +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI  K+ K +                      +   + INP   +VKI     +G  +A D    +R  ++C  C    +       C C+     + +    K   R    R S  S  + +     LM  N     +DS ++ +  D T  F W    +LD++ +   +A     S H+++C+ G      I + N +MPLR  +  +  L+ IV +G+  Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +  + R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  L+  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   99 WAGVMISAQTLTGRV-----LVVTVFALSIGALMIYFIDSSNPIETCQNFYKDFTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRGSKLEAVDILARFCVITFRVFFTRIIINP-GNHVKIKE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNMDSSSV-KRYDSTGMFHWCPAKELDKVLLTRSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLYCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1077          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 341.658 bits (875), Expect = 9.931e-100
Identity = 268/1003 (26.72%), Postives = 471/1003 (46.96%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+ +P    +     +  + K +     +  +    LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   24 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCR-RPVYVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 996          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 340.887 bits (873), Expect = 1.509e-99
Identity = 273/1007 (27.11%), Postives = 471/1007 (46.77%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+     QP T +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   84 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1053          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 340.887 bits (873), Expect = 1.796e-99
Identity = 273/1007 (27.11%), Postives = 471/1007 (46.77%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+     QP T +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   84 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1053          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 341.658 bits (875), Expect = 2.214e-99
Identity = 273/1007 (27.11%), Postives = 471/1007 (46.77%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+     QP T +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   84 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1053          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 340.502 bits (872), Expect = 5.551e-99
Identity = 273/1007 (27.11%), Postives = 471/1007 (46.77%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    T+   I  C C+     QP T +     K   R    R S  +       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  149 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLEDEQPPTLS----PKKKQRNGGMRNSPNTSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1118          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Match: sp|Q8AYS8|KCMA1_CHICK (Calcium-activated potassium channel subunit alpha-1 OS=Gallus gallus OX=9031 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 348.591 bits (893), Expect = 3.301e-101
Identity = 278/1018 (27.31%), Postives = 474/1018 (46.56%), Query Frame = 1
Query:  328 AMGECD--SDFDEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            A G C    + +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL PG++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  +++    + ++AI+       +S+ INP   +VKI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  S       LM  +P  I      +N+       D T  F W     ++++ +   +A     S H+++C+ G  +   I L N +MPLR  +  +  L+ IV +G+ +Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   97 ADGACKPTDEKEENVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNNQQLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYKSEKRESSILINP-GNHVKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNSSP----KLMRHDPLLIPGNEQIDNMDANVKKYDSTGMFHWCPAKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELKHIVFVGSLEYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1077          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Match: sp|O18866|KCMA1_PIG (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 2.105e-99
Identity = 273/1007 (27.11%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  S       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  123 EEVVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPSSSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1092          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Match: sp|Q28204|KCMA1_BOVIN (Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 343.969 bits (881), Expect = 2.281e-99
Identity = 273/1007 (27.11%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  S       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  137 EETVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPSSSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1106          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Match: sp|Q9BG98|KCMA1_RABIT (Calcium-activated potassium channel subunit alpha-1 OS=Oryctolagus cuniculus OX=9986 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 2.288e-99
Identity = 273/1007 (27.11%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  S       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  150 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNSSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1119          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Match: sp|O18867|KCMA1_MACMU (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Macaca mulatta OX=9544 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 2.432e-99
Identity = 273/1007 (27.11%), Postives = 470/1007 (46.67%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            +E +  ++G MTS K      W   + S ++  GR+    LV+L + + SI     Y+  +++ +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   SG KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + +    + ++AI+    +  + + INP   ++KI     +G  +A D    +R  ++C  C    +       C C+     QPST +     K   R    R S  S       LM  +P  I      +N+       D T  F W    +++++ +   +A     S H+++C+ G      I L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++TS  DK+ ++ +  I+SM  D                      P+ S +   +R+  +    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  122 EEAVAAEVGWMTSVKD-----WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSNPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINP-GNHLKIQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPSTLS----PKKKQRNGGMRNSPNSSP----KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLM 1091          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Match: A0A5K4EWW8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 3.222e-154
Identity = 312/994 (31.39%), Postives = 505/994 (50.80%), Query Frame = 1
Query:  376 IGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYN--EKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTC--TEP-MKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNN-----FDL-------KKVHNRMKSKRLSQISKSSYLFS----------LMDS-----------------------------------NPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCG-SGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET-------SDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLH-EGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +GM++ + +   L+CER T+     G+I     ++L+ +SW  Y+         S + G  ++ +  I  WI+FG+N+F   ++I +  AA D ++F +  ++LIDI +IP    S F   R   ++FLR     Y  D +    G++      +   +   L ++WM+GSG +H+ E+ GD WL+ N +  WS++ S YFLL T+STVGYGDY   +  G++ +CI+I  A+ + A+ +PE+F    ++  N  ++Y   SGE+H+IV G F N +++ F+K F+     K    + ++++   P D  L   L  + +++ Y +G+     D+ R  L +A+  FIL+ P T    D+DS NIM AI++KA+++ +R I+QLH + NK L+  FPRW    ND+VVC++EL+LGLMAYNCL PG +TL+ NL+    ++P +  +  WR EYE G   +L++V  S +F  +   D+AI +Y+ W++ LLA++ +     +S+ INP+  N  ++  SM  IV++ D S A  + Y+C  C        C C      K        DL       K   N +K++  S  ++S++ F           L D+                                   N   I + + +  +D T +F W     L    +   QA    FS H L+C+ G S  G ++L NF+MPLRF    W+ +R IVILG+       +W  +KN P+  IV G P    D+ +  L  C +C VL  + +   +        D+ +L+CA  IRS+L   +    L TE+  ++ A  FSS +  + D K+PV  SEPFA G++F+N++LY C+ S ++N + F F+  LI+G   + +E  F  G GL  ++       +A V   L       F  +  +     LT++ ++   +    ILCLGLYR      RYV  +P   T+I   D  YC
Sbjct:  212 LGMSARQQLNMKLYCERFTTVSYPAGKIMLTIYIVLSTVSWLFYVVENRNNPPVS-IRGICHTLRSKILSWINFGINLFCLGYYILKLCAATDRVRFVLSFSSLIDIISIPPALCSVFETHRHIDLNFLRSMCFLYYVDTL-TYLGVITSNQGIQSARIVFTLFTIWMVGSGIMHVIEHLGDFWLNENHRGTWSYFESCYFLLVTLSTVGYGDYVTHSTLGRLFICIFIPVAMGVSASFVPELFRNFNNNYTNSSDRYEPISGERHVIVCGNFDNESIRAFIKGFLYGCQAKGRMRINMVLLRPIPLDYALKAILSPYHAWVRYFLGTPNNPHDLARTKLKEARAAFILATPNTKFRDDEDSANIMQAIAIKARKKNLRVILQLHYFRNKCLMNNFPRWTYLANDMVVCMEELKLGLMAYNCLAPGFSTLIVNLLNAHGSKPRVFEYERWRIEYEYGFRMQLHDVGISHEFSNLFIRDLAIFVYEKWNLILLAVR-INGLEKSSILINPIEVNCPVNNNSMRAIVISSDYSSALNLQYYCVTCEGHLIGQPCRCSRPVLEKRRKITIARDLALYEQIGKARENAVKAETWSYDTRSTHFFRHSFTATSPNLLHDTRNLLFDQPRGRSETRKMDINSRNLGLPNNIPVRCMNCSPIRTPSHSSQVDRTGSFHWVPDIPLTRATLSPNQAASLNFSRHFLVCVAGKSTNGPLNLENFIMPLRFH---WQRVRDIVILGDSHLIGPLEWVKLKNLPRIFIVDGDPCSFNDLHSVHLCQCNACVVLGYSAEEPHSQCVDPSLQDRVTLLCAMNIRSLLQKEQHLVHLTTELHYEKNAYLFSSGDIHENDYKLPVWFSEPFARGIIFSNTLLYSCLSSFFYNDNIFRFLRVLISGQSTDELEASFSVGAGL-QQQATPQSTRMAGVKVSLRGFRHAPFKFLTRISLRKPLTFKDVYIRCITCWQILCLGLYRWQENGFRYVIANPMPDTQIYENDMFYC 1198          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Match: A0A5K4EUY1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 4.909e-154
Identity = 312/994 (31.39%), Postives = 505/994 (50.80%), Query Frame = 1
Query:  376 IGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYN--EKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTC--TEP-MKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNN-----FDL-------KKVHNRMKSKRLSQISKSSYLFS----------LMDS-----------------------------------NPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCG-SGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET-------SDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLH-EGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +GM++ + +   L+CER T+     G+I     ++L+ +SW  Y+         S + G  ++ +  I  WI+FG+N+F   ++I +  AA D ++F +  ++LIDI +IP    S F   R   ++FLR     Y  D +    G++      +   +   L ++WM+GSG +H+ E+ GD WL+ N +  WS++ S YFLL T+STVGYGDY   +  G++ +CI+I  A+ + A+ +PE+F    ++  N  ++Y   SGE+H+IV G F N +++ F+K F+     K    + ++++   P D  L   L  + +++ Y +G+     D+ R  L +A+  FIL+ P T    D+DS NIM AI++KA+++ +R I+QLH + NK L+  FPRW    ND+VVC++EL+LGLMAYNCL PG +TL+ NL+    ++P +  +  WR EYE G   +L++V  S +F  +   D+AI +Y+ W++ LLA++ +     +S+ INP+  N  ++  SM  IV++ D S A  + Y+C  C        C C      K        DL       K   N +K++  S  ++S++ F           L D+                                   N   I + + +  +D T +F W     L    +   QA    FS H L+C+ G S  G ++L NF+MPLRF    W+ +R IVILG+       +W  +KN P+  IV G P    D+ +  L  C +C VL  + +   +        D+ +L+CA  IRS+L   +    L TE+  ++ A  FSS +  + D K+PV  SEPFA G++F+N++LY C+ S ++N + F F+  LI+G   + +E  F  G GL  ++       +A V   L       F  +  +     LT++ ++   +    ILCLGLYR      RYV  +P   T+I   D  YC
Sbjct:  247 LGMSARQQLNMKLYCERFTTVSYPAGKIMLTIYIVLSTVSWLFYVVENRNNPPVS-IRGICHTLRSKILSWINFGINLFCLGYYILKLCAATDRVRFVLSFSSLIDIISIPPALCSVFETHRHIDLNFLRSMCFLYYVDTL-TYLGVITSNQGIQSARIVFTLFTIWMVGSGIMHVIEHLGDFWLNENHRGTWSYFESCYFLLVTLSTVGYGDYVTHSTLGRLFICIFIPVAMGVSASFVPELFRNFNNNYTNSSDRYEPISGERHVIVCGNFDNESIRAFIKGFLYGCQAKGRMRINMVLLRPIPLDYALKAILSPYHAWVRYFLGTPNNPHDLARTKLKEARAAFILATPNTKFRDDEDSANIMQAIAIKARKKNLRVILQLHYFRNKCLMNNFPRWTYLANDMVVCMEELKLGLMAYNCLAPGFSTLIVNLLNAHGSKPRVFEYERWRIEYEYGFRMQLHDVGISHEFSNLFIRDLAIFVYEKWNLILLAVR-INGLEKSSILINPIEVNCPVNNNSMRAIVISSDYSSALNLQYYCVTCEGHLIGQPCRCSRPVLEKRRKITIARDLALYEQIGKARENAVKAETWSYDTRSTHFFRHSFTATSPNLLHDTRNLLFDQPRGRSETRKMDINSRNLGLPNNIPVRCMNCSPIRTPSHSSQVDRTGSFHWVPDIPLTRATLSPNQAASLNFSRHFLVCVAGKSTNGPLNLENFIMPLRFH---WQRVRDIVILGDSHLIGPLEWVKLKNLPRIFIVDGDPCSFNDLHSVHLCQCNACVVLGYSAEEPHSQCVDPSLQDRVTLLCAMNIRSLLQKEQHLVHLTTELHYEKNAYLFSSGDIHENDYKLPVWFSEPFARGIIFSNTLLYSCLSSFFYNDNIFRFLRVLISGQSTDELEASFSVGAGL-QQQATPQSTRMAGVKVSLRGFRHAPFKFLTRISLRKPLTFKDVYIRCITCWQILCLGLYRWQENGFRYVIANPMPDTQIYENDMFYC 1233          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Match: A0A5K4EUN8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 9.119e-154
Identity = 312/994 (31.39%), Postives = 505/994 (50.80%), Query Frame = 1
Query:  376 IGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYN--EKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTC--TEP-MKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNN-----FDL-------KKVHNRMKSKRLSQISKSSYLFS----------LMDS-----------------------------------NPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCG-SGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET-------SDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLH-EGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +GM++ + +   L+CER T+     G+I     ++L+ +SW  Y+         S + G  ++ +  I  WI+FG+N+F   ++I +  AA D ++F +  ++LIDI +IP    S F   R   ++FLR     Y  D +    G++      +   +   L ++WM+GSG +H+ E+ GD WL+ N +  WS++ S YFLL T+STVGYGDY   +  G++ +CI+I  A+ + A+ +PE+F    ++  N  ++Y   SGE+H+IV G F N +++ F+K F+     K    + ++++   P D  L   L  + +++ Y +G+     D+ R  L +A+  FIL+ P T    D+DS NIM AI++KA+++ +R I+QLH + NK L+  FPRW    ND+VVC++EL+LGLMAYNCL PG +TL+ NL+    ++P +  +  WR EYE G   +L++V  S +F  +   D+AI +Y+ W++ LLA++ +     +S+ INP+  N  ++  SM  IV++ D S A  + Y+C  C        C C      K        DL       K   N +K++  S  ++S++ F           L D+                                   N   I + + +  +D T +F W     L    +   QA    FS H L+C+ G S  G ++L NF+MPLRF    W+ +R IVILG+       +W  +KN P+  IV G P    D+ +  L  C +C VL  + +   +        D+ +L+CA  IRS+L   +    L TE+  ++ A  FSS +  + D K+PV  SEPFA G++F+N++LY C+ S ++N + F F+  LI+G   + +E  F  G GL  ++       +A V   L       F  +  +     LT++ ++   +    ILCLGLYR      RYV  +P   T+I   D  YC
Sbjct:  247 LGMSARQQLNMKLYCERFTTVSYPAGKIMLTIYIVLSTVSWLFYVVENRNNPPVS-IRGICHTLRSKILSWINFGINLFCLGYYILKLCAATDRVRFVLSFSSLIDIISIPPALCSVFETHRHIDLNFLRSMCFLYYVDTL-TYLGVITSNQGIQSARIVFTLFTIWMVGSGIMHVIEHLGDFWLNENHRGTWSYFESCYFLLVTLSTVGYGDYVTHSTLGRLFICIFIPVAMGVSASFVPELFRNFNNNYTNSSDRYEPISGERHVIVCGNFDNESIRAFIKGFLYGCQAKGRMRINMVLLRPIPLDYALKAILSPYHAWVRYFLGTPNNPHDLARTKLKEARAAFILATPNTKFRDDEDSANIMQAIAIKARKKNLRVILQLHYFRNKCLMNNFPRWTYLANDMVVCMEELKLGLMAYNCLAPGFSTLIVNLLNAHGSKPRVFEYERWRIEYEYGFRMQLHDVGISHEFSNLFIRDLAIFVYEKWNLILLAVR-INGLEKSSILINPIEVNCPVNNNSMRAIVISSDYSSALNLQYYCVTCEGHLIGQPCRCSRPVLEKRRKITIARDLALYEQIGKARENAVKAETWSYDTRSTHFFRHSFTATSPNLLHDTRNLLFDQPRGRSETRKMDINSRNLGLPNNIPVRCMNCSPIRTPSHSSQVDRTGSFHWVPDIPLTRATLSPNQAASLNFSRHFLVCVAGKSTNGPLNLENFIMPLRFH---WQRVRDIVILGDSHLIGPLEWVKLKNLPRIFIVDGDPCSFNDLHSVHLCQCNACVVLGYSAEEPHSQCVDPSLQDRVTLLCAMNIRSLLQKEQHLVHLTTELHYEKNAYLFSSGDIHENDYKLPVWFSEPFARGIIFSNTLLYSCLSSFFYNDNIFRFLRVLISGQSTDELEASFSVGAGL-QQQATPQSTRMAGVKVSLRGFRHAPFKFLTRISLRKPLTFKDVYIRCITCWQILCLGLYRWQENGFRYVIANPMPDTQIYENDMFYC 1233          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Match: A0A095ARG8 (Calcium-activated potassium channel subunit alpha-1 OS=Schistosoma haematobium OX=6185 GN=MS3_05276 PE=4 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 1.665e-153
Identity = 311/994 (31.29%), Postives = 508/994 (51.11%), Query Frame = 1
Query:  376 IGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYN--EKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTC--TEP-MKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNN-----FDL-------KKVHNRMKSKRLSQISKSSYLF---------------------------------------SLMDSNPYK------IDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCG-SGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET-------SDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLH-EGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +GM++ + +   L+CER T+     G+I     ++L+ +SW  Y+         S + G  ++ +  I  WI+FG+N+F   ++I +  AA D ++F +  ++LIDI +IP    S F   R   ++FLR     Y  D +    G++      +   +   L ++WM+GSG +H+ E+ GD WL+ N +  WS++ S YFLL T+STVGYGDY   +  G++ +CI+I  A+ + A+ +PE+F    ++  N  ++Y   SGE+H+IV G F N +++ F+K F+     K    + ++++   P D  L   L  + +++ Y +G+     D+ R  L +A+  FIL+ P T    D+DS NIM AI++KA+++ +R I+QLH + NK L+  FPRW    ND+VVC++EL+LGLMAYNCL PG +TL+ NL+    ++P +  +  WR EYE G   +L++V  S +F  +   D+AI +Y+ W++ LLAI+ +     +S+ INP+  N  ++  SM  IV++ D S A  + Y+C  C        C C      K        DL       K   N +K++  S  ++S++ F                                       +L ++ P +      + + + +  +D T +F W     L    +   QA    F+ H L+C+ G S  G ++L NF+MPLRF    W+ +R IVILG+       +W  +KN P+  IV G P    D+ +  L  C +C VL  + +   +        D+ +L+CA  IRS+L   +    L TE+  ++ A  FSS +  + D K+PV  SEPFA G++F+N++LY C+ S ++N + F F+  LI+G   + +E  F  G GL  ++  S    +A V   L       F  +  +     LT++ ++   +    ILCLGLYR      RYV  +P   T+I   D  YC
Sbjct:  218 LGMSARQQLNMKLYCERFTTVSYPAGKIMLTIYIVLSTVSWLFYVVENRNNPPVS-IRGICHTLRSKILSWINFGINLFCLGYYILKLCAATDRVRFVLSFSSLIDIISIPPALCSVFETHRHIDLNFLRSMCFLYYVDTL-TYLGVITSNQGIQSARIVFTLFTIWMVGSGIMHVIEHLGDFWLNENHRGTWSYFESCYFLLVTLSTVGYGDYVTHSTLGRLFICIFIPVAMGVSASFVPELFRNFNNNYTNSSDRYEPISGERHVIVCGNFDNESIRAFIKGFLYGCQAKGRMRINMVLLRPIPLDYALKAILSPYHAWVRYFVGTPNNPHDLARTKLKEARAAFILATPNTKFRDDEDSANIMQAIAIKARKKNLRVILQLHYFRNKCLMNNFPRWTYLANDMVVCMEELKLGLMAYNCLAPGFSTLIVNLLNAHGSKPRIFEYERWRIEYEYGFRMQLHDVGISHEFSNLFIRDLAIFVYEKWNLILLAIR-INGLEKSSMLINPIDVNCPVNNNSMRAIVISSDYSSALNLQYYCITCEGHLIGQPCRCSRPVLEKRRKITIARDLALYEQIGKARENAVKAETWSYDTRSTHFFRHSFTATSPNLLHDTRNLLFDQPRGRSETRKMDINSRNLALPNNIPTRCMNYSPVRAPSHSSQVDRTGSFHWVPDIPLTRATLSPNQAASLNFNRHFLVCVAGKSTNGPLNLENFIMPLRFH---WQRVRDIVILGDSHLIGPLEWVKLKNLPRIFIVDGDPCSFNDLHSVHLCQCNACVVLGYSAEEPHSQCVDPSLQDRVTLLCAMNIRSLLQKEQHLVHLTTELHYEKNAYLFSSGDIHENDYKLPVWFSEPFARGIIFSNTLLYSCLSSFFYNDNIFRFLRVLISGQSTDELEASFSVGAGL-QQQATSQSARMAGVKVSLRGFRHAPFKFLTRISLRKPLTFKDVYIRCITCWQILCLGLYRWQENGFRYVIANPMPDTQIYENDMFYC 1204          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Match: A0A4Z2CYR9 (Calcium-activated potassium channel subunit alpha-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006294 PE=4 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 8.862e-150
Identity = 312/1005 (31.04%), Postives = 503/1005 (50.05%), Query Frame = 1
Query:  376 IGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYN--EKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTC--TEP-MKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNN-----FDL-------KKVHNRMKSKRLSQISKSSYLF---------------------------------------SLMDSNPYK------IDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCG-SGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET-------SDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL----------IPKKVVSLEN--HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +GM++   +   L+CER T+     G+I     ++L+ LSW  YI         S + G  ++ +  I  WI+F +N+F   ++I +  AA D ++F +  ++LIDI AIP    S F   R   ++FLR     Y  D++    G++      +   +   L ++WM+GSG +H+ E+ GD WL+ N +  WS++ + YFLL T+STVGYGDY   +  G++ +CI+I  ++ + A+ +PE+F    ++  N  ++Y   SGE+H+IV G F N +++ F+K F+     K    + ++++   P D  L   L  + +++ Y +G+     D+ R  L +A+  F+L+ P T    D+DS NIM AI++KA+++ +R I+QLH + NK L+  FPRW    ND+VVC++EL+LGLMAYNCL PG +TL+ NL+    ++P +  +  WR EYE G   +L++V  S +F  +   D+AI +Y+ W++ LLA++ V     +S+ INP+  N  ++  SM  IV++ D S A  + Y+C  C        C C      K        DL       +   N +K++  S  ++S++ F                                       +L D+ P +        + +    +D T +F W     L    +   QA    F  H L+C+ G S  G ++L NF+MPLRF    W+ +R IVILG+       +W  +KN P+  IV G P    D+ +  L  C +C VL  + +   +        D+ +L+CA  IRS+L   +    L TE+  ++ A  FSS +  + D K+PV  SEPFA G++F+N++LY C+ S ++N + F F+  LI+G   + +E  F  G GL          +P   VSL    H        VP+               LT++ ++   +    ILCLGLYR      RYV  +P   T+I   D  YC
Sbjct:  237 LGMSARHQLNMKLYCERFTTVSYPAGKIMLTVYILLSTLSWLFYIVENRNNPPVS-IRGICHTLRSKILSWINFCINLFCLGYYILKLCAATDRVRFVLSFSSLIDIVAIPPALCSIFETHRHIDLNFLRSICFLYYVDLL-TYMGVIMSNQGIQSARIVFTLFTIWMVGSGIMHVIEHLGDFWLNENHRGTWSYFEACYFLLVTLSTVGYGDYVTHSTLGRLFICIFIPVSMGVSASFVPELFRNFNNNYTNSSDRYEPISGERHVIVCGNFDNESIRAFIKGFLYGCQTKGRMRINMVLLRPIPLDYALKAILSPYHAWVRYFVGTPNNPHDLARTKLKEARAAFVLATPNTKFRDDEDSANIMQAIAIKARKKNLRVILQLHNFRNKCLMNNFPRWTYLTNDMVVCMEELKLGLMAYNCLAPGFSTLIVNLLNAHGSKPKIFEYEQWRIEYEYGFRMQLHDVGISHEFSNLFMRDLAIFVYEKWNLILLAVR-VNGLEKSSMLINPIEVNCPVNNNSMRAIVISSDYSSALNLQYYCVTCEGHLIGRPCRCSRPVLEKRRKITIARDLALYEQIGQARENAVKAETWSNENRSTHFFRHSFTATSPDLLSDKRNLLFNQPRGRSATRKICENSINLALPDNIPSRYLNYSPTRASSHLSQVDRTGSFHWVPDIPLTRATLSPNQAATLNFRRHFLVCVAGKSTNGPLNLENFIMPLRFH---WQRVRDIVILGDSHVIGPLEWVKLKNLPRIFIVDGDPCSFNDLHSVHLCQCNACVVLGYSAEEPHSQCVDASLQDRVTLLCAMNIRSLLQKEQHLVHLTTELHYEKNAYLFSSGDIHENDYKLPVWFSEPFARGIIFSNTLLYSCLSSFFYNDNVFRFLRVLISGQSTDELEASFSVGAGLQQGITLQSARMPGVKVSLRGFRHAPFKFLTRVPL------------RKPLTFKDVYIRCITCWQILCLGLYRWQENGFRYVIANPMPETQIYENDMFYC 1223          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 323.168 bits (827), Expect = 6.487e-94
Identity = 262/997 (26.28%), Postives = 455/997 (45.64%), Query Frame = 1
Query:  355 DEWIEDDIG-MTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVR-QAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGL-----IPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            DE    ++G MTS K      W   + S ++  GR+  + +  L++ +  IY     +  ++  +E   +FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+       +S+ INP   +VK+     +G  +A D    +R  ++C  C    +       C C+                R + +  S +S              K  +G +  + +         +PK+  + ++ R +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SM  D                      P+ S +   +R+  V    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G     +E +      L      P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:   25 DEAPASEVGWMTSVKD-----WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQNFYKDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESSILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCK----------------RFEDEHPSTLSPKK-----------KQRNGGMRNSPN--------CSPKMMSMFLNTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKHIVFVGSLDYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLTAPSPCTKRYVITNPPYEFELVPTDLIFCLM 957          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Match: ENSAMXT00000044980.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000044980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 322.398 bits (825), Expect = 1.360e-92
Identity = 218/758 (28.76%), Postives = 380/758 (50.13%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQMQPSTKNNF--DLKKVHNRMKSKRLSQIS---KSSYLFSL--MDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD 2613
            W   + S ++  GR+  + +  L++ +  IY    +  ++        +   + +   ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+   +   +S  INP   +VK+     +G  +A D    +R  Y+C  C    T+   I  C C+   S  N +   +++VH    S +  Q +   ++S   S   +  +P  I S    E +       D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ GSP+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SML D
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIY----FIDSSDPIESCQIFDEDITLQ--IDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINP-GNHVKMQE-GTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLK-REWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMLFD 859          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Match: ENSAMXT00000050440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:48528:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 319.701 bits (818), Expect = 8.682e-92
Identity = 218/758 (28.76%), Postives = 379/758 (50.00%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQMQPSTKNNF--DLKKVHNRMKSKRLSQIS---KSSYLFSL--MDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD 2613
            W   + S ++  GR+  + +  L++ +  IY    +  ++        +   + +   ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA  +PEI   I +  KY   Y +  G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+   +   +S  INP   +VK+     +G  +A D    +R  Y+C  C    T+   I  C C+   S  N +   +++VH    S +  Q +   ++S   S   +  +P  I S    E +       D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ GSP+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SML D
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIY----FIDSSDPIESCQIFDEDITLQ--IDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTYNSTRGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINP-GNHVKMQE-GTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLK-REWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMLFD 859          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Match: ENSAMXT00000050702.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.161 bits (814), Expect = 2.912e-91
Identity = 213/751 (28.36%), Postives = 367/751 (48.87%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD 2613
            W   + S ++  GR+  + +  L++ +  IY    +  ++        +   + +   ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+   +   +S  INP   +VK+     +G  +A D    +R  Y+C  C    +       C C+       +    K   R    R S       L      +P  I S    E +       D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ GSP+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SML D
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIY----FIDSSDPIESCQIFDEDITLQ--IDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINP-GNHVKMQE-GTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRFEEVHQSTLSPKKKQRNGGMRTSPNCSPKNL----RHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLK-REWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMLFD 848          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Match: ENSAMXT00000051878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000051878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 254.218 bits (648), Expect = 2.919e-69
Identity = 163/548 (29.74%), Postives = 276/548 (50.36%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTICNCQMQPSTK 2043
            W   + S ++  GR+  + +  L++ +  IY    +  ++        +   + +   ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V  + Y    + L+AI+   +   +S  INP   +VK+     +G  +A D    +R  Y+C  C    T+   I  C  + S K
Sbjct:  115 WAGVMISAQTLTGRVLVVLVFALSIGALVIY----FIDSSDPIESCQIFDEDITLQ--IDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRESSTLINP-GNHVKMQE-GTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKK 650          

HSP 2 Score: 105.916 bits (263), Expect = 1.105e-22
Identity = 94/377 (24.93%), Postives = 165/377 (43.77%), Query Frame = 1
Query: 2182 DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGS-----RGELVEKMFGCGVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ GSP+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SML D                      PE S +   +R+  V    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G       G L E+    G    P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P    E++ TD ++C +
Sbjct:  768 DSTGMFHWCPSKDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLK-REWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLSAPSQCTKRYVITNPPYEFELVPTDLIFCLM 1134          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006399.1 (pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 3.444e-53
Identity = 118/384 (30.73%), Postives = 200/384 (52.08%), Query Frame = 1
Query:  907 ENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDS-KYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNN-QPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIK-NVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQP 2034
            EN+GD W D   +QN ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA  +PEI   I +  KY  +Y+   G KH++V G     ++  FLK F++K   +   N++I+ +++  P   + +L+ + F+    Y  GS+    D+ RV +  A    I++  Y      +D+ NIM  IS+K    RIR I Q+  Y NK  L   P W+  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V+ + +    + L+AI+   ++ Y +S+ +NP   +V+I     +   +A D    +R  Y+C  C    +       C+C+  P
Sbjct:    1 ENSGDPWRDFQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKD--RDDVNVEILFLHSISPNLELEALFRRHFTQVEFY-QGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEEDTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNP-GSHVRIQD-GTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSCRQCP 379          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006404.1 (pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.504 bits (480), Expect = 8.385e-53
Identity = 115/365 (31.51%), Postives = 194/365 (53.15%), Query Frame = 1
Query:  907 ENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDS-KYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNN-QPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIK-NVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC 1989
            EN+GD W D   +QN ++W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA  +PEI   I +  KY  +Y+   G KH++V G     ++  FLK F++K   +   N++I+ +++  P   + +L+ + F+    Y  GS+    D+ RV +  A    I++  Y      +D+ NIM  IS+K    RIR I Q+  Y NK  L   P W+  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   V+ + +    + L+AI+   ++ Y +S+ +NP   +V+I     +   +A D    +R  Y+C  C
Sbjct:   23 ENSGDPWRDFQNQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKD--RDDVNVEILFLHSISPNLELEALFRRHFTQVEFY-QGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEEDTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEHSYGSSILLNP-GSHVRIQD-GTLAFFIANDSKEVKRAFYYCKAC 382          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007042.1 (pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 gene:ENSPMAG00000006371.1 transcript:ENSPMAT00000007042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 8.263e-31
Identity = 68/216 (31.48%), Postives = 111/216 (51.39%), Query Frame = 1
Query: 1162 KHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK--------THNLWRKEYEEGLENRLYNVEFSDDFHGMS 1785
            +H++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    RIR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL PG++T++ NL +    +K          + W+K Y EG+ N +Y    S+ F G+S
Sbjct:    1 RHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIEAADACLILANKYCGDPDAEDASNIMRVISIKNYHPRIRVITQMQQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKRVPLPHQIEEDTWQKYYLEGVSNEMYTEYLSNAFTGLS 214          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Match: KCNT1 (potassium sodium-activated channel subfamily T member 1 [Source:HGNC Symbol;Acc:HGNC:18865])

HSP 1 Score: 57.3806 bits (137), Expect = 9.529e-9
Identity = 65/284 (22.89%), Postives = 122/284 (42.96%), Query Frame = 1
Query:  775 IRYLYDVIFVNFGLVKIT--------------SKTKIFNLSLYLVS-----VWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITR---SGEKHMIVTGQFINSTMKTFLKVFINK-RTRKQFRNMKIIIMNNQPCDRVLS--LYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLK 1551
            +R ++  +F+N  L KI               +++ +FN  L L+      ++    GF H+E             +N S + S YF + T STVG+GD  P+    Q++V I I  A+ +      E+ Y   + + +    +R     EKH+++    ++S     L  F+N+     + ++   +I+     D  +   L++  ++  ++YL GS  +  D+ RV +  A+  FIL+          D + I+ A ++K         VQ+    NK  +K
Sbjct:  154 LRNIFIPVFLNCWLAKIALQNLINDLHRAIQRTQSAMFNQVLILICTLFCLMFTFICGFQHLERAA----------ENISLFRSLYFCIVTFSTVGFGDVLPKIWPSQLLVVIMICVALMVLPVQFEELVYLYMERQKSGGNYSRYRAQTEKHVVLC---VSSLKLDLLMDFLNEFYAHPRLQDFYTVILCPTDMDSQVRRMLHVPLWAQRVIYLQGSALKDQDLVRVKIDDAEACFILTSRNEVDRTAADHQTILRAWAVKDFAPSCPLYVQILKPENKFHVK 424          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 5.381e-6
Identity = 55/204 (26.96%), Postives = 90/204 (44.12%), Query Frame = 1
Query:  607 VFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMS-------------FLRIYYIRYL--YDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIH-MEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEI------FYAIKDSKYNEKYITR 1152
             +F + ++ R  +A +  KF+     +ID+ AI   +I+ FL    +G+S              +RI  I  L  +     + G     S  ++  L L+L    MI S  +   E++  D    + P    SFW +T     T++TVGYGD  P T+ G++I  +  I  + + A  +P I      FY  K+ K  EK + R
Sbjct:  207 AWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVSQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDTKFHSIPA---SFWWATI----TMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFY--KEQKRQEKAVKR 401          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Nematostella
Match: EDO32743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU69])

HSP 1 Score: 64.3142 bits (155), Expect = 2.432e-10
Identity = 75/328 (22.87%), Postives = 140/328 (42.68%), Query Frame = 1
Query:  949 NWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-----KDSKYNEKYITRSGEKHMIVTGQFINS-TMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKK--FSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCT--EPMKTHNLWRKEYEEGLENRLYNVEFSDD-----FHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINP 1887
             WS   + +F++ T STVGYGD  P   + Q  V I I  A+ L    L  + + +     +   YN  ++    ++H+++    + + T+  FL  F       +  ++ ++++     D  L + L+   ++  + YL GS     D+ R     A   FIL+  Y       D   I+   +++         VQ+    NK  +           + VVC DE++  L+A NC+ PG++TLVT L+     + ++    W + Y +   N +Y++   D      +   S    A   +K + V L+ +K  ++     + +NP
Sbjct:  249 QWSMMKTLWFVIVTFSTVGYGDTVPTHWTTQTFVMIMIGIALVLLPIELERLAFLLFSRQKEGGAYN--HLLAGTDRHVVLCATTLRTGTLIDFLNEFYAD---SRLHDVHVVLLCPSDLDSTLRILLQVPVWAQRVTYLKGSALIDEDLVRAR-RNAAGCFILADRYAADREAADQHTILRTWAIQDFAPATPLFVQILKPENKFHVSF--------AEHVVCEDEIKHALLAVNCVCPGISTLVTLLLHTLHEQYVRGSEKWHEIYGKCAGNEIYDIRLGDSMIFRPYAYKSFTHAAFHAHKKYGVTLIGVK--RHGKGGRLMLNP 560          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Nematostella
Match: EDO28098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F3])

HSP 1 Score: 52.7582 bits (125), Expect = 1.092e-7
Identity = 40/114 (35.09%), Postives = 60/114 (52.63%), Query Frame = 1
Query: 2266 FSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRA--AGLFDCY----SCAVLNGNDDVNETSDKQSLICA 2586
            F++HIL+C+    E   + L   +MPLR  +L   +L++IV LG+K Y +  +W  I NF +  I+ GSP    D+RA  A L D        AV    D     +DKQS++ +
Sbjct:   69 FTHHILVCVFNKKEDPLVGLRKMVMPLRASNLHRSDLKKIVFLGDKDYMK-LEWEEICNFHEVYILPGSPFCRADLRAVNANLADMVVFLSGTAVDQAGDP--RLADKQSILAS 179          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Nematostella
Match: SHAKR6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.354e-6
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  613 FALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQ-GMSFLRIYYIRYLYDVIFVN--FGLVKI---TSKTKIFNLSLYLVSVWMI----GSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKY 1131
            F   ++ R   A D  KF I P  L+D+ AI   FI   +   R   ++ LRI  +  ++ V+ ++   G +++   T ++ +  L + ++ V MI     S   + +         + P   W  W +T     TV+TVGYGD  P T SG+ + CI  +  +  F  +LP + +A   + Y
Sbjct:  205 FLFEYVIRFATAPDRSKFVISPLNLVDLLAICPFFILLLIRSERVVSLAVLRIIRVLRVFRVLKLSRYSGGLRVLCYTLRSSLKELEMAMLFVCMIVVLSSSAVYYTDLGHPKSQFSSIPDAFW--WCAT-----TVTTVGYGDQIPVTASGRFVGCICAVLGVLAF--SLPVMAFATNFNAY 378          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Nematostella
Match: EDO48059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJY3])

HSP 1 Score: 49.6766 bits (117), Expect = 4.757e-6
Identity = 51/197 (25.89%), Postives = 90/197 (45.69%), Query Frame = 1
Query:  532 TTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTF--------LPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALP 1098
            T   L  D ++ K++   W+DF  +++F + F+ R        +F   P   +D+ AI   +   F        L V R  +   RI+ +   + ++F +     I+SK ++F + + ++   ++ S  I+  E       D N K   S   S ++ + TV+TVGYGD  P T  G+VI  +  I  + +   ALP
Sbjct:  211 TVPSLREDSFTMKVLY--WLDFSTSIWFTVEFVLRLVFCPSTKEFAKNPMNWVDLTAILPFYFRLFKLQDQISWLVVMRT-LRIFRIFSLSLSFQILFRSL----ISSKNELFLVFVSVMVPIILFSSMIYFAEK------DANDKNFQSIPESFWWAIITVTTVGYGDVCPVTKLGKVIGAVCAICGVVI--VALP 392          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Match: ENSORLT00000011055.2 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:101155390])

HSP 1 Score: 350.517 bits (898), Expect = 5.927e-103
Identity = 270/982 (27.49%), Postives = 462/982 (47.05%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLE--GDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDE-------TETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGN-DDVNETS--DKQSLICATLIRSMLAD--------------------HRPEFSLITE-IREDEVACHFSSVEAFDIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGS-----RGELVEKMFGCGVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGK--------RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+    LV+L + + SI     Y+  ++  +E    FYS   +    ID   N+FF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q  S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+LG +A +CL  G++T++ NL +    +K   + W+K Y EG+ N +Y    S  F G+S   +  + Y    + L+AI+   +   +S  INP   +VK+     +G  +A D    +R  ++C  C    S       C C+     +++    K   R    R S  S       +M  +P  I      E++DE       T  F W  +  ++++ +   +A     S H+++C+ G  +   I L NF+MPLR  +  +  L+ IV +G+ +Y +  +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +++++ S  DK+ ++ +  I+SML D                      PE S +   +R+  V    +     ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G       G L E+    G    P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL            +RYV T+P  + E++ +D ++C +
Sbjct:  111 WAGVMISAQTLTGRV----LVVL-VFALSIGALVIYFIDSSDPIEFCKHFYSNYTL---QIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKD--RDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYKSDQRESSTLINP-GNHVKMQE-GTLGFFIASDAKEVKRALFYCKACHDDISDPKRIKKCGCKKFEEDRHSALSPKKKQRNGGMRNSPNSSP----KIMRHDPLFIPGSEQIESMDENVKKYDSTGMFHWCPSRDIEKVILTRSEAAMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELKHIVFVGSLEYLK-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDASLQDKECILASLNIKSMLFDDSIRVLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALKGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLNAQSQCTKRYVITNPPYAFELVPSDLIFCLM 1064          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 337.035 bits (863), Expect = 1.191e-97
Identity = 261/979 (26.66%), Postives = 449/979 (45.86%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETS---DKQSLICATLIRSMLADH-----RPEFSLITEIREDEVACHFSSVEAF----------------DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGS-----RGELVEKMFGCGVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---NFGK-----RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E    FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    ++   + W+K Y EG+ N +Y    S  F G+S   +  + Y    + L+AI+       +S+ INP   +VK+     +G  +A D    +R  Y+C  C    +       C C+      PST +    ++      S   S    S +   L+  N    +     +  D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +  E +   DK+ ++ +  I+SM  D      +      T    D  +   S V  F                ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G       G L E+    G    P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL   + G      +RYV T+P    E++ +D ++C +
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQSFYDDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHK--DRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESSILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLM 1095          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 324.709 bits (831), Expect = 3.485e-93
Identity = 266/1011 (26.31%), Postives = 454/1011 (44.91%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNS-----VTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNC---------------QMQPSTKNNFDLKKVHNR-------MKSKRLSQISKSSYLFSLMDS--NPYKIDSGTLTENI-------DETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETS---DKQSLICATLIRSMLADH-----RPEFSLITEIREDEVACHFSSVEAF----------------DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGS-----RGELVEKMFGCGVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---NFGK-----RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E    FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    ++   + W+K Y EG+ N +Y    S  F G+S   +  + Y    + L+AI+  K++   S     + INP   +VK+     +G  +A D    +R  Y+C  C    +       C C               Q +   +   D   V +         K +R   +  S      M S  +P  I      EN+       D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +  E +   DK+ ++ +  I+SM  D      +      T    D  +   S V  F                ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G       G L E+    G    P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL   + G      +RYV T+P    E++ +D ++C +
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQSFYDDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHK--DRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIE-YKSEQRESRSRKRILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRPAEGATTPGNTGSQKEAGVRFKADCNIVEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLM 1126          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 307.76 bits (787), Expect = 2.578e-87
Identity = 212/755 (28.08%), Postives = 368/755 (48.74%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNS-----VTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC----SYTNSFTICNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETS---DKQSLICATLIRSMLAD 2613
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E    FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA+ +PEI   I +  KY   Y   +G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM  IS+K    +IR I Q+  Y NK  L   P WN  + D  +CL EL+ G +A +CL  G++T++ NL +    ++   + W+K Y EG+ N +Y    S  F G+S   +  + Y    + L+AI+  K++   S     + INP   +VK+     +G  +A D    +R  Y+C  C    +       C C+      PST +    ++      S   S    S +   L+  N    +     +  D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +  E +   DK+ ++ +  I+SM  D
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQSFYDDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHK--DRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIE-YKSEQRESRSRKRILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIEDASLQDKECILASLNIKSMQFD 879          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 301.597 bits (771), Expect = 1.864e-85
Identity = 251/979 (25.64%), Postives = 437/979 (44.64%), Query Frame = 1
Query:  415 WCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEG--DFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMK-THNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKC--SYTNSFTI--CNCQM----QPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGS-GEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETS---DKQSLICATLIRSMLADH-----RPEFSLITEIREDEVACHFSSVEAF----------------DIDNKMPVQH---------------SEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGS-----RGELVEKMFGCGVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---NFGK-----RRYVYTHPKKSTEILMTDKVYCTL 3150
            W   + S ++  GR+  + +  L++ +  IY     +  ++  +E    FY    +    ID   NVFF L+F  R  AA D + FW+   +++D   +P VF+S +L     G+ FLR   +    +++ F+N  ++K ++  K+ NL    +S W+  +GFIH+ EN+GD W +    Q+ S+W   Y L+ T+STVGYGD   +T  G++ +  +I+  + +FA  +PEI   I +  KY   Y +  G KH++V G     ++  FLK F++K   +   N++I+ ++N   +  L    K+  + + +  GS+    D+ RV +  A    IL+  Y      +D+ NIM                            ++  WN  + D  +CL EL+ G +A +CL  G++T++ NL +    ++   + W+K Y EG+ N +Y    S  F G+S   +  + Y    + L+AI+       +S+ INP   +VK+     +G  +A D    +R  Y+C  C    T+   I  C C+      PST +    ++      S   S    S +   L+  N    +     +  D T  F W  +  ++++ +   +A     S H+++C+ G      + L N +MPLR  +  +  L+ IV +G+  Y    +W  + NFPK  I+ G+P+   D+RA  +  C  C +L+ N +  E +   DK+ ++ +  I+SM  D      +      T    D  +   S V  F                ++ N   VQ                ++PFA G  F  S+L   + + Y N +  + +  L+ G       G L E+    G    P+ + + +   VA +     P  D        L +G   Y  LF  AL+  ++LC G+YRL   + G      +RYV T+P    E++ +D ++C +
Sbjct:  141 WAGVMISAQTLTGRVLVVLVFALSIGALGIY-----FIDSSDPIESCQSFYDDFTL---QIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLN--ILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGSYNSTRGRKHIVVCGHITLESVSNFLKDFLHK--DRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMR-------------------------YTLYHIWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEEDTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESSILINP-GNHVKMQE-GTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILTRSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLR-REWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFAD--------LGDGG-CYGDLFCKALKTYNMLCFGIYRLRDAHLGAPSQCTKRYVITNPPYEFELVPSDLIFCLM 1070          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Match: SMESG000040071.1 (SMESG000040071.1)

HSP 1 Score: 2032.3 bits (5264), Expect = 0.000e+0
Identity = 1014/1017 (99.71%), Postives = 1016/1017 (99.90%), Query Frame = 1
Query:  127 MNXXXXXXXXXXXXYPWWLTYTXXXXXXXXXXXXXXXXXXXVKMNRHTKPNLKINMLRRKSRLLMNTAMGECDSDFDEWIEDDIGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETSDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYCTLVNNSIRTQI 3177
            MNTSLVSLGTLSTSYPWWLTYTISLGIFGLGFIIIGIMQIGVKMNRHTKP+LKINMLRRKSRLLMNTAMGECDSDFDEWIEDDIGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGM CLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYT+SFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETSDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYCTLVNNSIRTQI
Sbjct:    1 MNTSLVSLGTLSTSYPWWLTYTISLGIFGLGFIIIGIMQIGVKMNRHTKPSLKINMLRRKSRLLMNTAMGECDSDFDEWIEDDIGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMPCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTDSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETSDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYCTLVNNSIRTQI 1017          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Match: SMESG000040067.1 (SMESG000040067.1)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 463/924 (50.11%), Postives = 647/924 (70.02%), Query Frame = 1
Query:  400 IEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETSDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILMTDKVYCTLVNNSIRT 3171
            + F  +CE I S+ + +GR      +I  L SW I++ FT+ Q   +YL GD +  +    +WIDF LN+F   HF  RAFAA DI+KFWI P T+I+I  IPN+ +++FLPVRRQG SFLRIYY+R L + I V+FG+ K+ SK ++  +  Y++S+W+I +G  HM E  G+ W      Q  SFW   YF+L T+STVG+G  NP T+ G+++V +YIIY IT+F T LP +   I++ KY  +YI++  E+H+IV G+F + T+  FLK F  +R +   RN+KI+ MN    D  L +Y+K+FS+ I YL+G++    D++RV++ KAK   ILS P+TNKI +DD +NIMTA+ LK+Q + +RTIVQLHLYSNK+LLKM P WN+ ++D+++C+DEL+LGLMAYNCL PG+ATLV NL+T T+      LWRK+YE GL+  LYNV+FSD FHGMSCL+VA+I+YKLWDVCLLAIK V     + V INPM EN+KIDT SMI IVMARDE+ + ++ ++CSKCS  N   IC C ++ +  +     + + + +++R+++  +S+Y F  +DS   +ID  + T  +D T +F+WA  P  +++C+D+  AE R  S+HIL+CLCG G GTIDLCNFMMPLRF++L    LR IVILGNK YFE  KW+NIKNFP F+I+ GSPIQ+RD+RAAGL  C++C ++NGND     SDK ++ICATLIRSM   ++ +  ++ EIR+DE+A HFSS+ + + D+K+ VQHSEPFA G+LFTNS +Y CIY++Y NPDTFSF+  L+NG   + +E MFG GVGL+P+   S     ++ + +L  +     + +  +++G L Y  LFEWAL +K ILCLGLYRLNFG+ RYV+THP+KSTEI  TD+VYC + ++   T
Sbjct:   91 LNFLSFCEIIISKSTIVGRFLNFVKLISQLTSWGIFVVFTFNQVNANYLIGDCFDVEGANLQWIDFALNIFCLFHFTLRAFAANDILKFWIQPTTMIEITVIPNILLTSFLPVRRQGFSFLRIYYLRELCNTIAVSFGIFKVNSKFEMTKVIFYIISLWLISAGLFHMFEGIGNFWEIPLFNQQLSFWRCCYFMLVTISTVGFGSVNPLTIFGRIVVLVYIIYGITMFVTVLPNVIRTIQNLKYKNRYISKGNERHIIVCGKFESLTIIAFLKAFKRERFKGSVRNVKIVTMNKDLYDENLLMYMKRFSNPIKYLIGNLSNRKDLKRVNIQKAKLSVILSTPFTNKISEDDIDNIMTAMILKSQRKNMRTIVQLHLYSNKVLLKMSPMWNQNRSDIILCIDELKLGLMAYNCLTPGIATLVINLVTFTKSKSFSELWRKDYENGLKVLLYNVQFSDCFHGMSCLEVALIVYKLWDVCLLAIKCVNKSTDDYVLINPMIENIKIDTDSMIAIVMARDEASSNKLVFYCSKCSPQNLSEICQCYLEATKNSPRGHYESNVQFENQRINESFRSAYEFPTIDSKSEEIDMNSYT-GLDRTGSFYWAPEPNFEDVCLDIETAESRSLSDHILVCLCGIGHGTIDLCNFMMPLRFQNLQNSELRTIVILGNKSYFEADKWTNIKNFPMFLIIDGSPIQSRDLRAAGLLKCHTCVIINGNDKTVGFSDKSAIICATLIRSMRKLNKLKIPIMIEIRKDEIAHHFSSIHSHNNDSKVSVQHSEPFARGILFTNSTVYSCIYTVYKNPDTFSFIKTLLNGRYSDEIESMFGSGVGLLPQNSSSENRENSNSIIKLFSVIQPPLNEISRVYDGILDYACLFEWALMEKRILCLGLYRLNFGRNRYVFTHPEKSTEIFSTDQVYCCVSSDFFNT 1013          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Match: SMESG000050831.1 (SMESG000050831.1)

HSP 1 Score: 335.109 bits (858), Expect = 1.221e-97
Identity = 281/1026 (27.39%), Postives = 492/1026 (47.95%), Query Frame = 1
Query:  343 DSDFDEWIEDDIGMT-SSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVI-FVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNL--WRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAI--KNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTI---CNCQMQPSTKNNFD-------LKKVHNRMKSKRLSQISK-----SSYLFSLMDSNPYKIDSG----------TLTENIDETETFFWAVTPKLDEICI-DVRQAEKRKFSNHILLCL-CGSGEGTIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLN--GNDDVNET--SDKQSLICATLIRSMLAD-------HRPE-------------FSLITEIREDEVACHF------------SSVEAFDIDNKMPVQ----HSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMF--GCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL---------NFG-------KRRYVYTHPKKSTEILMTDKVYC 3144
            D+ FD+   D + +  S+ F +   W   I S ++  G+     + IL++ S +IY+   Y  +    L          + + +D   N+ F ++F  R  A+ D + FW+   + +D+  IP  F+  +L     G+ F+R   +  L DV+ F+N  ++K +S  ++ +L    VS+ +  SGFIH+ E++G   + +N  QN +F   TYF++ T+STVGYGD   +T +G++++  +I+  + LFA ++PE+   I   ++Y   +  +  ++H+I+ G     ++  FL  F++K   ++  ++KI+I+NN P +  L   LK++   + +  GS    +D+ R+ L  A    +L+  Y+     +D+ NIM  IS+K    RI+ IVQL  Y NK  L   P W+  + D  VCL EL+LG +A +CL PG +TL+ NL T        NL  W   Y EG    +Y+  FS  FHG +  +   + +K   + L+AI  K+  N+  NS+ INP   ++KI+   M G  +A+    ++R  +FC KC     +     C+C      +N           K  H++++SK+  + SK     +  +       P+ I +            ++   D T  F W     ++++ + D  Q +   FSNHI++C+   S    I LCNF+MPLR  +  +  L  IV +GN +Y +  +W ++ NFP   I+ GS +   ++RA  +     C +L+   N+ +++    DK++++C+  +++M  D       + PE             F +  ++ +D+++               S+V+  D D++   +     ++PFA G  F  S+L   + + Y N +  + +  LI G     +E++   GCG+        +L N     V  ++ +  N    +     G   Y  LF  AL++  ILC+GLYRL         N G       K+RYV T+P    +I  +D VYC
Sbjct:   74 DTKFDD---DQVHVEISNCFSDLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYL---YELSVYDGLTEVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYLGRYWIGLRFVRAMRLMTLSDVLGFLN--VIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADN-GQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKD--REDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKSTVNEE-NSIAINP-KNDIKIEP-GMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKLRKFETTKSRHSKLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQISRRFDTTGMFHWCPERPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLK-REWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMSFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRV-TIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVYC 1083          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Match: SMESG000014623.1 (SMESG000014623.1)

HSP 1 Score: 307.76 bits (787), Expect = 1.301e-88
Identity = 258/954 (27.04%), Postives = 448/954 (46.96%), Query Frame = 1
Query:  412 LWCERITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWL--DNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAI-KDSKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMT------CTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYTNSFTI-------CNCQMQPSTKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDEICIDVRQAEKRKFSNHILLCLCGSGEG-TIDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNETS-------DKQSLICATLIRSML-----------ADHRPEFSLITEIR-EDEVACHFSSVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSI-YHNPDTFSFVSALINGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYR--------LNFGKRRYVYTHPKKSTEILMTDKV 3138
            +W  +  S +++ G+I      +   ++   YI    Y        G +Y    ++   ID     FF  ++I R  AA + I+FW    +L+D+  IP+ F+  +L     G+ FLR  ++  + D++    G++K  +K ++  LS   + +W++GSG  HM ENTGD WL  + N K   +F  S YF + T+STVGYGD +P +  G++ V I+I+ +  +FA+ +PEI   +   SKY   Y+ +   KH++V G F  S++++F+  F N+   +    + ++ +N +  D  L   LK       ++ G++    D++R  + +A   FIL+        D+D+ NIM  ISLK     +R ++QL  Y NK  L   P WNK K D VVC  E+ L ++A +CL+PG +T ++NL +      C E  K+ N W  +Y  G+   LY    S    GM+  D+ +  Y+  ++ L+A++ VK     +V INP +++    T   +G  +      ++R++ +C+ C   N  T        C C  + ++ N    +K+  R  S RL   S+  + ++++D    +ID             F         E  I     E  KFSNHI+LC+    +  +I L NF++PLR + L   +LR I+I  N+++    +W ++  FP    +  + I  + +    + +C+ C +++        +       DK+ ++    ++S+            +   P   LIT++  E+ V   F   E  D  N  PV  SE FA G  FT  +L  C+ SI Y NPD    ++ LI G           C   +  ++  ++ N+      ++  + D+ F +    +     Y+ LF +A +  H+L LGLY+        L+  K++ + T+P     +   D V
Sbjct:   80 VWTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLA--IDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLL-QYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNED--RPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGNSWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVE-VKMRNGKTVFINPASQSYT--TKETVGYFICNSFKESQRVALYCNVCHGANEGTPLRVDKFKCVCINKVASLN----EKI--RQTSFRL---SRQQFQYAILDKAEKEID-------------FLKCDYKDFKESLIK-NPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKLDTADLRPIIIASNEEFLH-REWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVKSIFKKKLQKKFIGKSGEIPNRFLITKLLVENNV--QFLDQEDEDEPN-CPVFLSEIFACGSAFTTKML-DCLLSIAYFNPDVNKVITHLIAGE--------IHCFENINDEESTNMANNNVKCQIRIFNLFDDKFQSCF-ANTNRCLYKNLFTYAFKHYHLLLLGLYKVVETTQNILSSSKKKVILTNPDGEFSVSCYDSV 988          
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Match: SMESG000076792.1 (SMESG000076792.1)

HSP 1 Score: 288.5 bits (737), Expect = 2.033e-81
Identity = 268/1032 (25.97%), Postives = 447/1032 (43.31%), Query Frame = 1
Query:  298 RRKSRLLMNTAMGECDSDFDEWIEDDIGMTSSKFIEFSLWCERITSQRSSIGRISCLFLVILNLLSWSIY-IGFTYYQTTTSYLEGDFYSAKMMIPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFISTFLPVRRQGMSFLRIYYIRYLYDV-IFVNFGLVKITSKTKIFNLSLYLVSVWMIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQTVSGQVIVCIYIIYAITLFATALPEIFYAIKD-SKYNEKYITRSGEKHMIVTGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFSSFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAISLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMAYNCLVPGMATLVTNLMTCTEPMKTHNL--WRKEYEEGLENRLYNVEFSDDFHGMSCLDVAIILYKLWDVCLLAIK---NVKNDYLNSVTINPMAENVKIDTLSMIGIVMARDESHARRISYFCSKCSYT-NSFTICNCQMQPS------------------------TKNNFDLKKVHNRMKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLDE-ICIDVRQAEKRKFSNHILLCLCGSGEGT-IDLCNFMMPLRFRSLTWENLRQIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCAVLNGNDDVNET----SDKQSLICATLIRSM---------------------LADHRPE-FSLITEIREDEVACHFSSVEAFDIDNK----MPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSALINGSRGELVEKMFGC-----GVGLIPKKVVSLEN-HVADVVFQLVPINDNLFHNVPNLHEGNLTYEILFEWALQKKHILCLGLYRL------------NFGKRRYVYTHPKKSTEILMTDKVYC 3144
            +R S L  N+     DS F  + + +        IE   W   I S ++  GR+    +  L+L S  IY I  +  Q  T  L   +  +     +  D   N+ F + F  R  AA D   FWI   +L+D+  +P  F++  L     G+ F R   +    DV +F+N  ++K +SK ++ +L     S+ +  +GFIH+ E TGDI    N KQN +++  TYF++ T+STVGYGD   +T  G++++  +I+  + +FA ++PEI   I + ++Y   +    G++H+I+ G                            I      CD           S    +   +++     RV L  A    IL   Y+     +D+ NIM  IS+K     I+ IVQL  Y NK  L   P W+  + D VVC+ EL+LG +A +CL PG +TL+ NL       K H+L  W  +Y EG    +Y    S  FHG++  +   + +   ++ L+A++   N + ++ +S+ INP  + + I+  +  G  +A     A+R  Y+C  C  +  S   CNCQ                             +N+F   +   R + KR    S      +L D+  +   +       D T  F W    + +  I  +        FSNHI++C+        I L +F+MPLR  +  +  LRQI+ +G + Y    +W ++ NFPK  +++GSP+    +R   +  C    +L+ N          +DK++++C+  I++M                      A H+     +ITE+  D      SSV+  D D++      +  ++PFA G  F  S+L   + + Y N +  + +  ++ G     +E++        G  L P+ V + +   V  +  +  P ++ LF N         TY  LF    ++  ILC GLYRL            +  K R+V T+P   T ++  D V+C
Sbjct:   87 KRGSDLRFNSNAVMTDSVFTSYTKTN-SHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSES---YTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLN--ILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQTN-KQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGH---------------------------ITFQRTNCD-------SGHPSTEYSIAKCVEKKFKPARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPD-ITIEPGTQ-GFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLR-REWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVD------SSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSE-LFGN-------EKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFC 1060          
The following BLAST results are available for this feature:
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA19.000e-10027.00potassium calcium-activated channel subfamily M al... [more]
KCNMA19.963e-10027.21potassium calcium-activated channel subfamily M al... [more]
KCNMA11.064e-9927.01potassium calcium-activated channel subfamily M al... [more]
KCNMA11.202e-9927.01potassium calcium-activated channel subfamily M al... [more]
KCNMA11.664e-9927.01potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo-11.228e-8426.04Calcium-activated potassium channel slo-1 [Source... [more]
slo-13.731e-8325.95Calcium-activated potassium channel slo-1 [Source... [more]
slo-11.250e-8225.78Calcium-activated potassium channel slo-1 [Source... [more]
slo-14.435e-8125.69Calcium-activated potassium channel slo-1 [Source... [more]
slo-11.056e-5629.26Calcium-activated potassium channel slo-1 [Source... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo1.488e-9625.46gene:FBgn0003429 transcript:FBtr0100636[more]
slo1.979e-9625.55gene:FBgn0003429 transcript:FBtr0100637[more]
slo3.656e-9525.46gene:FBgn0003429 transcript:FBtr0334294[more]
slo9.107e-9525.27gene:FBgn0003429 transcript:FBtr0100632[more]
slo3.457e-6828.32gene:FBgn0003429 transcript:FBtr0084685[more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a6.421e-9826.37potassium large conductance calcium-activated chan... [more]
kcnma1a2.159e-9526.34potassium large conductance calcium-activated chan... [more]
kcnma1a9.512e-9028.01potassium large conductance calcium-activated chan... [more]
CABZ01092907.11.339e-6631.74potassium large conductance calcium-activated chan... [more]
kcnt18.247e-2024.52potassium channel, subfamily T, member 1 [Source:Z... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA11.067e-9826.63potassium calcium-activated channel subfamily M al... [more]
KCNMA13.175e-9726.55potassium calcium-activated channel subfamily M al... [more]
KCNMA14.709e-9726.03potassium calcium-activated channel subfamily M al... [more]
KCNMA11.439e-9626.43potassium calcium-activated channel subfamily M al... [more]
KCNMA19.751e-9626.20potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnma19.931e-10026.72potassium large conductance calcium-activated chan... [more]
Kcnma11.509e-9927.11potassium large conductance calcium-activated chan... [more]
Kcnma11.796e-9927.11potassium large conductance calcium-activated chan... [more]
Kcnma12.214e-9927.11potassium large conductance calcium-activated chan... [more]
Kcnma15.551e-9927.11potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AYS8|KCMA1_CHICK3.301e-10127.31Calcium-activated potassium channel subunit alpha-... [more]
sp|O18866|KCMA1_PIG2.105e-9927.11Calcium-activated potassium channel subunit alpha-... [more]
sp|Q28204|KCMA1_BOVIN2.281e-9927.11Calcium-activated potassium channel subunit alpha-... [more]
sp|Q9BG98|KCMA1_RABIT2.288e-9927.11Calcium-activated potassium channel subunit alpha-... [more]
sp|O18867|KCMA1_MACMU2.432e-9927.11Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EWW83.222e-15431.39Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4EUY14.909e-15431.39Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4EUN89.119e-15431.39Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A095ARG81.665e-15331.29Calcium-activated potassium channel subunit alpha-... [more]
A0A4Z2CYR98.862e-15031.04Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a6.487e-9426.28potassium large conductance calcium-activated chan... [more]
ENSAMXT00000044980.11.360e-9228.76pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050440.18.682e-9228.76pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050702.12.912e-9128.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051878.12.919e-6929.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006399.13.444e-5330.73pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1... [more]
ENSPMAT00000006404.18.385e-5331.51pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1... [more]
ENSPMAT00000007042.18.263e-3131.48pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 g... [more]
KCNT19.529e-922.89potassium sodium-activated channel subfamily T mem... [more]
ENSPMAT00000004235.15.381e-626.96pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO327432.432e-1022.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280981.092e-735.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SHAKR61.354e-626.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480594.757e-625.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011055.25.927e-10327.49potassium calcium-activated channel subfamily M al... [more]
kcnma1a1.191e-9726.66calcium-activated potassium channel subunit alpha-... [more]
kcnma1a3.485e-9326.31calcium-activated potassium channel subunit alpha-... [more]
kcnma1a2.578e-8728.08calcium-activated potassium channel subunit alpha-... [more]
kcnma1a1.864e-8525.64calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel subunit alpha-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040071.10.000e+099.71SMESG000040071.1[more]
SMESG000040067.10.000e+050.11SMESG000040067.1[more]
SMESG000050831.11.221e-9727.39SMESG000050831.1[more]
SMESG000014623.11.301e-8827.04SMESG000014623.1[more]
SMESG000076792.12.033e-8125.97SMESG000076792.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034881 ID=SMED30034881|Name=Calcium-activated potassium channel subunit alpha-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3245bp
CGCACACTGTGCAGCACAGTGAATGTTCAGACTGAATTTATTGTGTAAAT
TTGATTGTTATTGGAGCAATTAATACAGCAGTGAAATTCTTTGAAAAAAA
TAAAACCGACTCCACCAAATTCTATCATGAACACTTCACTAGTTTCCCTG
GGGACACTCTCAACCAGTTATCCTTGGTGGTTGACGTATACCATTTCTCT
CGGAATCTTTGGCCTTGGATTCATCATTATTGGAATCATGCAAATTGGAG
TGAAAATGAATCGACACACGAAACCCAACTTAAAAATTAACATGTTGCGA
AGAAAGTCTAGATTACTGATGAATACTGCCATGGGAGAATGCGATTCTGA
TTTTGATGAATGGATTGAAGATGACATCGGGATGACTTCGTCGAAGTTTA
TTGAATTTAGTCTTTGGTGTGAAAGAATTACTTCACAAAGATCATCAATT
GGGAGAATTTCGTGCTTGTTTTTGGTAATATTAAATCTATTATCTTGGTC
CATTTATATTGGTTTTACCTATTACCAAACGACTACAAGTTACTTGGAAG
GAGATTTCTACAGTGCTAAAATGATGATTCCAAAATGGATTGATTTCGGG
TTGAATGTCTTTTTTGCTCTACATTTCATATTTAGAGCATTTGCTGCAAT
GGACATAATAAAATTTTGGATACTTCCAGCCACTCTGATTGATATCTGTG
CCATACCAAATGTTTTTATAAGCACATTTCTTCCTGTCAGACGACAAGGA
ATGAGCTTTTTACGGATATATTATATACGTTATTTATACGACGTGATTTT
TGTAAATTTCGGATTGGTGAAAATAACTTCAAAAACAAAAATTTTCAATT
TAAGCCTTTATCTTGTCAGCGTATGGATGATTGGGAGCGGTTTCATACAC
ATGGAAGAAAATACGGGAGACATTTGGTTGGACAATAATCCTAAGCAAAA
TTGGTCTTTTTGGATTAGTACTTATTTTTTACTGGAAACCGTTTCCACGG
TTGGATATGGAGATTATAACCCACAAACAGTTTCGGGTCAAGTTATCGTT
TGTATTTACATCATATATGCTATTACATTATTTGCAACAGCTCTACCCGA
AATATTCTACGCAATAAAAGACAGCAAATATAATGAAAAATATATAACTC
GGAGTGGAGAAAAGCATATGATCGTCACCGGGCAATTCATCAATTCTACC
ATGAAAACATTTTTAAAAGTTTTTATCAATAAAAGGACAAGAAAACAGTT
TCGAAACATGAAAATAATTATTATGAATAATCAACCTTGTGATAGAGTCC
TTAGTCTTTACTTGAAAAAGTTTTCTTCCTTTATCATGTATTTGATGGGG
TCAATACAGCAAATTTCTGACATGGAAAGAGTGGATTTGCATAAAGCAAA
AACAATTTTTATTCTCTCTTTGCCATACACTAATAAAATCTATGATGATG
ACAGCGAGAACATTATGACAGCAATATCACTTAAAGCACAAGAAGAAAGA
ATTAGAACGATTGTCCAACTTCACTTATATTCAAATAAAATTTTATTGAA
AATGTTTCCGAGATGGAATAAATATAAAAATGATGTCGTTGTTTGTTTGG
ACGAGTTGAGATTAGGACTAATGGCCTACAACTGCCTTGTTCCTGGAATG
GCAACGCTGGTAACCAATTTGATGACTTGTACTGAGCCAATGAAAACTCA
TAATTTATGGAGGAAGGAATATGAAGAAGGCTTAGAAAATCGACTTTACA
ACGTAGAGTTTTCAGATGATTTTCATGGAATGTCTTGCCTAGATGTAGCT
ATAATTCTATATAAATTATGGGATGTTTGTCTTTTGGCCATCAAAAACGT
CAAAAATGACTACCTGAATTCAGTTACAATAAATCCAATGGCGGAAAATG
TTAAAATTGATACGCTGTCAATGATCGGGATAGTAATGGCAAGGGATGAA
TCTCATGCTCGCAGGATCTCGTACTTTTGTTCTAAATGTAGTTATACAAA
TTCTTTTACGATATGCAATTGTCAGATGCAACCTTCCACCAAAAATAATT
TCGATTTGAAAAAAGTGCATAACAGAATGAAAAGCAAAAGACTTAGCCAG
ATATCGAAATCGAGTTATTTATTTTCTCTGATGGATAGCAACCCCTACAA
AATAGATTCGGGTACCTTAACTGAGAACATTGATGAAACCGAAACGTTTT
TCTGGGCCGTGACACCGAAATTAGACGAAATATGTATTGATGTACGACAA
GCAGAAAAAAGAAAATTTTCCAATCACATTCTTCTATGTTTGTGTGGGTC
CGGTGAAGGAACAATTGACTTGTGCAATTTTATGATGCCCTTAAGATTTC
GATCGTTAACATGGGAAAATTTACGTCAGATTGTTATTTTAGGAAATAAA
AAATATTTCGAAGGCCACAAGTGGAGCAATATTAAAAATTTTCCAAAATT
TATCATTGTGCACGGTTCACCGATTCAAGCGAGAGATGTAAGAGCGGCGG
GTTTGTTTGACTGCTATTCCTGTGCTGTTTTGAATGGAAACGATGATGTA
AATGAAACCTCCGATAAGCAATCCTTGATTTGTGCCACCCTGATAAGGTC
TATGCTAGCAGACCATCGGCCTGAGTTTTCTTTAATCACCGAAATAAGAG
AAGATGAAGTTGCATGCCATTTTAGTTCAGTTGAAGCTTTTGATATTGAT
AATAAAATGCCTGTACAACATAGTGAACCATTTGCTGGTGGATTATTATT
CACAAACTCTATTTTATATAGATGCATCTATTCAATTTATCACAATCCAG
ATACATTTTCATTTGTCAGTGCCTTAATTAATGGATCTCGAGGTGAATTA
GTTGAAAAAATGTTTGGATGTGGAGTTGGACTCATACCCAAAAAGGTTGT
CTCTTTAGAAAACCATGTTGCCGATGTTGTTTTCCAATTAGTCCCAATAA
ATGATAACTTGTTTCATAATGTGCCAAACCTCCACGAAGGAAATTTGACA
TACGAGATTCTATTTGAATGGGCATTGCAAAAAAAACATATTCTTTGCCT
GGGGCTGTATCGGCTAAATTTTGGAAAGCGCAGATACGTCTATACTCATC
CGAAAAAGTCCACAGAAATTTTAATGACAGATAAGGTTTATTGCACCTTA
GTTAACAATAGCATTCGAACACAAATTTGACTGTTTGTTCTTTTTTTAGA
GATTTTATCTTATTATTTTCTTTTATAATATGATACCAATATCTT
back to top

protein sequence of SMED30034881-orf-1

>SMED30034881-orf-1 ID=SMED30034881-orf-1|Name=SMED30034881-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1018bp
MNTSLVSLGTLSTSYPWWLTYTISLGIFGLGFIIIGIMQIGVKMNRHTKP
NLKINMLRRKSRLLMNTAMGECDSDFDEWIEDDIGMTSSKFIEFSLWCER
ITSQRSSIGRISCLFLVILNLLSWSIYIGFTYYQTTTSYLEGDFYSAKMM
IPKWIDFGLNVFFALHFIFRAFAAMDIIKFWILPATLIDICAIPNVFIST
FLPVRRQGMSFLRIYYIRYLYDVIFVNFGLVKITSKTKIFNLSLYLVSVW
MIGSGFIHMEENTGDIWLDNNPKQNWSFWISTYFLLETVSTVGYGDYNPQ
TVSGQVIVCIYIIYAITLFATALPEIFYAIKDSKYNEKYITRSGEKHMIV
TGQFINSTMKTFLKVFINKRTRKQFRNMKIIIMNNQPCDRVLSLYLKKFS
SFIMYLMGSIQQISDMERVDLHKAKTIFILSLPYTNKIYDDDSENIMTAI
SLKAQEERIRTIVQLHLYSNKILLKMFPRWNKYKNDVVVCLDELRLGLMA
YNCLVPGMATLVTNLMTCTEPMKTHNLWRKEYEEGLENRLYNVEFSDDFH
GMSCLDVAIILYKLWDVCLLAIKNVKNDYLNSVTINPMAENVKIDTLSMI
GIVMARDESHARRISYFCSKCSYTNSFTICNCQMQPSTKNNFDLKKVHNR
MKSKRLSQISKSSYLFSLMDSNPYKIDSGTLTENIDETETFFWAVTPKLD
EICIDVRQAEKRKFSNHILLCLCGSGEGTIDLCNFMMPLRFRSLTWENLR
QIVILGNKKYFEGHKWSNIKNFPKFIIVHGSPIQARDVRAAGLFDCYSCA
VLNGNDDVNETSDKQSLICATLIRSMLADHRPEFSLITEIREDEVACHFS
SVEAFDIDNKMPVQHSEPFAGGLLFTNSILYRCIYSIYHNPDTFSFVSAL
INGSRGELVEKMFGCGVGLIPKKVVSLENHVADVVFQLVPINDNLFHNVP
NLHEGNLTYEILFEWALQKKHILCLGLYRLNFGKRRYVYTHPKKSTEILM
TDKVYCTLVNNSIRTQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016040NAD(P)-bd_dom
IPR003929K_chnl_BK_asu
IPR013099K_chnl_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0008076voltage-gated potassium channel complex
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
GO:0005249voltage-gated potassium channel activity
GO:0060072large conductance calcium-activated potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003929Calcium-activated potassium channel BK, alpha subunitPFAMPF03493BK_channel_acoord: 479..572
e-value: 1.1E-22
score: 80.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 228..334
e-value: 6.2E-16
score: 60.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 341..477
e-value: 2.7E-10
score: 42.2
coord: 709..857
e-value: 2.7E-6
score: 29.3
NoneNo IPR availablePANTHERPTHR10027CALCIUM-ACTIVATED POTASSIUM CHANNEL ALPHA CHAINcoord: 104..1008
NoneNo IPR availablePANTHERPTHR10027:SF33POTASSIUM LARGE CONDUCTANCE CALCIUM-ACTIVATED CHANNEL, SUBFAMILY M, ALPHA MEMBER 1Acoord: 104..1008
NoneNo IPR availableCDDcd149657tm_Opsins_type1coord: 154..257
e-value: 0.0056809
score: 37.2466
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 114..330
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 154..173
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 212..231
NoneNo IPR availableTMHMMTMhelixcoord: 275..294
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 246..323
e-value: 2.1E-12
score: 46.8