Discoidin domain-containing receptor 2

Overview
NameDiscoidin domain-containing receptor 2
Smed IDSMED30034880
Length (bp)3880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Discoidin domain-containing receptor 2 (SMED30034880) t-SNE clustered cells

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30034880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Discoidin domain-containing receptor 2 (SMED30034880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30034880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034880SMESG000067438.1 dd_Smed_v4_10406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034880SMESG000067438.1 dd_Smed_v4_10406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034880SMESG000067438.1 dd_Smed_v4_10406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034880SMESG000067438.1 dd_Smed_v4_10406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30034880SMESG000067438.1 SMED30034880smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 156.762 bits (395), Expect = 3.095e-38
Identity = 100/369 (27.10%), Postives = 181/369 (49.05%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS----NEIIPKESESIQTNSPI 1358
              + +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  ++ + + E  I+AR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +    +E +P    +  T  P+
Sbjct:   39 GQIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWE--PNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPM 390          

HSP 2 Score: 108.997 bits (271), Expect = 2.311e-23
Identity = 75/235 (31.91%), Postives = 108/235 (45.96%), Query Frame = 3
Query: 2916 FNTRHLYPSVSS----------LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            F +RH  P+ SS          L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F +      Q +  + P Q    P S               L+  CW R+   RP+F+ I  +L Q+
Sbjct:  665 FLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRD------QGRQTYLP-QPAICPDS------------VYKLMLSCWRRDTKNRPSFQEIHLLLLQQ 852          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 156.762 bits (395), Expect = 3.095e-38
Identity = 100/369 (27.10%), Postives = 181/369 (49.05%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS----NEIIPKESESIQTNSPI 1358
              + +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  ++ + + E  I+AR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +    +E +P    +  T  P+
Sbjct:   39 GQIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWE--PNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPM 390          

HSP 2 Score: 108.997 bits (271), Expect = 2.311e-23
Identity = 75/235 (31.91%), Postives = 108/235 (45.96%), Query Frame = 3
Query: 2916 FNTRHLYPSVSS----------LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            F +RH  P+ SS          L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F +      Q +  + P Q    P S               L+  CW R+   RP+F+ I  +L Q+
Sbjct:  665 FLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRD------QGRQTYLP-QPAICPDS------------VYKLMLSCWRRDTKNRPSFQEIHLLLLQQ 852          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 156.762 bits (395), Expect = 3.095e-38
Identity = 100/369 (27.10%), Postives = 181/369 (49.05%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS----NEIIPKESESIQTNSPI 1358
              + +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  ++ + + E  I+AR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +    +E +P    +  T  P+
Sbjct:   39 GQIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWE--PNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPM 390          

HSP 2 Score: 108.997 bits (271), Expect = 2.311e-23
Identity = 75/235 (31.91%), Postives = 108/235 (45.96%), Query Frame = 3
Query: 2916 FNTRHLYPSVSS----------LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            F +RH  P+ SS          L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F +      Q +  + P Q    P S               L+  CW R+   RP+F+ I  +L Q+
Sbjct:  665 FLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRD------QGRQTYLP-QPAICPDS------------VYKLMLSCWRRDTKNRPSFQEIHLLLLQQ 852          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: TYRO3 (TYRO3 protein tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:12446])

HSP 1 Score: 121.709 bits (304), Expect = 1.199e-29
Identity = 71/214 (33.18%), Postives = 109/214 (50.93%), Query Frame = 3
Query: 2949 SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNA--YNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILE 3584
            +L+  +  IA GM YL SR  IHRDLAARNC++ +++ + + D  +S + +   Y           + C S           P++W+A ES+    Y+ ++D+W+FGVTMWEI+ R  QTPY G         +NA  YN  IG +    P E +    +     PSQ +  PS ++L+          DL+ +CW+ +P QRP+F  +   LE
Sbjct:  108 TLIRFMVDIACGMEYLSSRNFIHRDLAARNCMLAEDMTVCVADFGLSRKIYSGDYY---------RQGCASK---------LPVKWLALESLADNLYTVQSDVWAFGVTMWEIMTR-GQTPYAGI--------ENAEIYNYLIGGNRLKQPPECMEDVLTLP-LHPSQGLPRPSDNLLY----------DLMYQCWSADPKQRPSFTCLRMELE 283          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 123.635 bits (309), Expect = 7.727e-28
Identity = 82/321 (25.55%), Postives = 144/321 (44.86%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR------GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQ--FKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIP 1322
            AWCP   +    EE++++DL  L ++  + T GR  G    E++  + L Y R   +W+ +K++  +++++GN D   V + +    ++AR +R YP   ++ +  C+R+ +YGC + DG++ Y+   G        +E   L D TYDG                        + +GV+  D   K +      GY +VGW+     S  VE+  +FD++R+ + ++ +  NM      +       F RG        P        + D R    R +++ L   +ARFL+    F   W++ SEI  IS+  N   P
Sbjct:   90 AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYP-RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYL---SEAVYLNDSTYDGHTVGGLQ-----------YGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRA---RAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFISDVVNNSSP 392          

HSP 2 Score: 113.62 bits (283), Expect = 9.193e-25
Identity = 80/327 (24.46%), Postives = 137/327 (41.90%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLP------RGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 3599
            +K+ + + +KE++++  +K    + L          + V    LC + ++ E   +L+ FL+ H +   A    P      +GPT+                     S   LL +  QIA GM YL +   +HRDLA RNCL+G+N  IKI D  MS   +   Y       +Q              +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  C+  P+G   ++ +++ +NA          V+                   ++ P +          +   +L+  CW+R   QRP F  +   L +   N
Sbjct:  643 TKNARNDFLKEVKIMSRLKDPNIIRLLG--------VCVQDDPLCMITDYMEN-GDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTI---------------------SYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYR-----VQG-------------RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFG--QLTDEQVIENAGEFFRDQGRQVY-------------------LSRPPAC--------PQGLYELMLRCWSRESEQRPPFSQLHRFLAEDALN 892          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 134.806 bits (338), Expect = 7.103e-32
Identity = 112/350 (32.00%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH-FVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFS-RGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFF--EVDWIILSEIVIISEKSN 1310
            +++E   ASS + ++    P  AR  Q         AWCPK  I S  +EW++I      +I ++ T GR  DG   EYA  F + Y R S   W  YK+  + + +  N D  +    + +  IIARRIRI P+S   +   CMR+ ++GC FDD +V Y+V QG   +           D +YDG ++   ++P   L  G+G+L     Y+G + +  NN    +H +VGW RK   +  V++  +F ++R++  I  +  N   +    FSSA + FS  G  + D I     F    DT    PRWI I + N +A+  KI L F  + DW+ +SE+   S  +N
Sbjct:   36 IRDEQISASSSF-DLQSTGPQHARAHQESGSG----AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRT-VCMRVEVFGCPFDDSLVFYNVDQGDLQSG------ISYHDFSYDGNLA---NSPH--LTGGIGKL-----YDGEVGK--NNVFVNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTI---VHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFESNHTN 356          

HSP 2 Score: 102.834 bits (255), Expect = 7.440e-22
Identity = 63/206 (30.58%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 2946 SSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFK 3563
            S  + I TQ+A G++YLES   +HRD+AARNCL+     +KI D  M+   + + Y +  V G                K   P++WMA+E++L   +S  +D+W FGVTMWEI   C + PY       D   D+               ENL    S  + +  Q ++ P        +  S+ +++ I  CWN    +RP+F+
Sbjct:  620 SQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYK--VEG----------------KFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYS------DMTDDDVV-------------ENLQSMSSTGSLK--QVLSRP-------RMCPSKLYNEQILPCWNYESSRRPSFE 779          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 134.806 bits (338), Expect = 7.233e-32
Identity = 112/350 (32.00%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH-FVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFS-RGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFF--EVDWIILSEIVIISEKSN 1310
            +++E   ASS + ++    P  AR  Q         AWCPK  I S  +EW++I      +I ++ T GR  DG   EYA  F + Y R S   W  YK+  + + +  N D  +    + +  IIARRIRI P+S   +   CMR+ ++GC FDD +V Y+V QG   +           D +YDG ++   ++P   L  G+G+L     Y+G + +  NN    +H +VGW RK   +  V++  +F ++R++  I  +  N   +    FSSA + FS  G  + D I     F    DT    PRWI I + N +A+  KI L F  + DW+ +SE+   S  +N
Sbjct:    6 IRDEQISASSSF-DLQSTGPQHARAHQESGSG----AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRT-VCMRVEVFGCPFDDSLVFYNVDQGDLQSG------ISYHDFSYDGNLA---NSPH--LTGGIGKL-----YDGEVGK--NNVFVNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTI---VHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFESNHTN 326          

HSP 2 Score: 102.449 bits (254), Expect = 8.691e-22
Identity = 63/206 (30.58%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 2946 SSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFK 3563
            S  + I TQ+A G++YLES   +HRD+AARNCL+     +KI D  M+   + + Y +  V G                K   P++WMA+E++L   +S  +D+W FGVTMWEI   C + PY       D   D+               ENL    S  + +  Q ++ P        +  S+ +++ I  CWN    +RP+F+
Sbjct:  590 SQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYK--VEG----------------KFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYS------DMTDDDVV-------------ENLQSMSSTGSLK--QVLSRP-------RMCPSKLYNEQILPCWNYESSRRPSFE 749          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 134.806 bits (338), Expect = 7.233e-32
Identity = 112/350 (32.00%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH-FVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFS-RGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFF--EVDWIILSEIVIISEKSN 1310
            +++E   ASS + ++    P  AR  Q         AWCPK  I S  +EW++I      +I ++ T GR  DG   EYA  F + Y R S   W  YK+  + + +  N D  +    + +  IIARRIRI P+S   +   CMR+ ++GC FDD +V Y+V QG   +           D +YDG ++   ++P   L  G+G+L     Y+G + +  NN    +H +VGW RK   +  V++  +F ++R++  I  +  N   +    FSSA + FS  G  + D I     F    DT    PRWI I + N +A+  KI L F  + DW+ +SE+   S  +N
Sbjct:    6 IRDEQISASSSF-DLQSTGPQHARAHQESGSG----AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRT-VCMRVEVFGCPFDDSLVFYNVDQGDLQSG------ISYHDFSYDGNLA---NSPH--LTGGIGKL-----YDGEVGK--NNVFVNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTI---VHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFESNHTN 326          

HSP 2 Score: 102.449 bits (254), Expect = 8.691e-22
Identity = 63/206 (30.58%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 2946 SSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFK 3563
            S  + I TQ+A G++YLES   +HRD+AARNCL+     +KI D  M+   + + Y +  V G                K   P++WMA+E++L   +S  +D+W FGVTMWEI   C + PY       D   D+               ENL    S  + +  Q ++ P        +  S+ +++ I  CWN    +RP+F+
Sbjct:  590 SQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYK--VEG----------------KFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYS------DMTDDDVV-------------ENLQSMSSTGSLK--QVLSRP-------RMCPSKLYNEQILPCWNYESSRRPSFE 749          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-1 (Discoidin domain-containing receptor A [Source:UniProtKB/Swiss-Prot;Acc:Q18163])

HSP 1 Score: 117.857 bits (294), Expect = 1.371e-26
Identity = 102/384 (26.56%), Postives = 167/384 (43.49%), Query Frame = 3
Query:  336 PHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDH--NNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGG---VYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK-----SNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTN 1454
            P  AR+       L   AWCPK  I S   E++++ L D  +I ++ T GR G+G   E+A H+ +DY R   +WIRYKN+     ++GN D     +   +  I+A RIR  P SK  +   CMR  I+GC   +GV         YY+      + D  D   D +    +   +  ++ GLG L D  +      E +  NN      ++GWNR   D  ++ I+ +F+++ +   +         + I V       FS+ G     + +IS + +      +R Y  R   + L N   R ++I + F  DW+ L+E+   S       S +I P  S + Q    +   I    +       +V + +  KN  +D+N
Sbjct:   54 PQNARLHS----ELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDYLRPGSQWIRYKNRTGHVYMDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRT-VCMRAEIHGCK-HEGVT--------YYSTVPDGSRLDTLDFK-DSMFEDSQIYTESGIKRGLGLLTDGFVAQASPFEKNQMNNS-----WIGWNRDTTD-GRITILFEFEEVHNFTDVVLATFGNRIDGIDVI------FSQDGKTFPLFSQISSSERQSLNNTSRRYDFR---VPLHNRAGRKVRISIKFSSDWMFLTEVHFTSAANLTLLSEKIPPPSSAATQQLLVVCGIIFLTIFACVAYCVSVCLKRRQKNKSVDSN 407          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: F11E6.8 (pep chromosome:WBcel235:IV:17444156:17447429:-1 gene:WBGene00008711.1 transcript:F11E6.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F11E6.8)

HSP 1 Score: 97.8265 bits (242), Expect = 3.221e-21
Identity = 66/212 (31.13%), Postives = 98/212 (46.23%), Query Frame = 3
Query: 2943 VSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKF-KEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESIL-QATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLIS 3572
            V  LL    Q+A+GMSYL ++  +HRDLAARNC+I  +  +K+ D  +++    KE YI+ +  G  +                 PL+W+A ES+  +  +S  TD+WSFGV MWE+L R   +PYG   +S  ++R                      H  ++  R  Q    P   I++          DL+Q CW   P  RP F  +S
Sbjct:  181 VLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMISADRIVKVADFGLAVDLLDKESYIDESETGPAR----------------LPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRA-ASPYG--EVSNTKVR----------------------HYLETGMRLPQPTHCP--DIIY----------DLMQCCWRSTPEDRPDFVFLS 339          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329980)

HSP 1 Score: 180.259 bits (456), Expect = 2.888e-46
Identity = 121/363 (33.33%), Postives = 190/363 (52.34%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGW--NRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSP 1355
            L  ++ I +S   ++    P  AR+K  +D    G AWCPK M+ ++ +E++++DL    +I  + T GR G G   EY   + L+Y R    KW R+KN + +++L GN +  +      + +I A +IRIYP  +  +   C+R  I GC +++G+V YS+ +G     + G E  DL D TYDG    D+        +GLGQL+D          D +   +GY ++GW  +   L    VEIV +FD +R+   I  +  NM  +D+ VF  A + FS GG Y+       QF  + DT + + R + I L + + ++LKI+L+F V WI+LSEI  IS  +      E E  ++NSP
Sbjct:   88 LITDAQITASSAHDMAFVGPQHARLKTDND----GGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRT-VCLRAEIVGCPWEEGIVSYSIPKG----VQRGME-VDLSDKTYDGNEQGDR------YVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFS--GEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPAMGNFTDEQEQ-RSNSP 431          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0112617)

HSP 1 Score: 180.259 bits (456), Expect = 2.888e-46
Identity = 121/363 (33.33%), Postives = 190/363 (52.34%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGW--NRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSP 1355
            L  ++ I +S   ++    P  AR+K  +D    G AWCPK M+ ++ +E++++DL    +I  + T GR G G   EY   + L+Y R    KW R+KN + +++L GN +  +      + +I A +IRIYP  +  +   C+R  I GC +++G+V YS+ +G     + G E  DL D TYDG    D+        +GLGQL+D          D +   +GY ++GW  +   L    VEIV +FD +R+   I  +  NM  +D+ VF  A + FS GG Y+       QF  + DT + + R + I L + + ++LKI+L+F V WI+LSEI  IS  +      E E  ++NSP
Sbjct:   88 LITDAQITASSAHDMAFVGPQHARLKTDND----GGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRT-VCLRAEIVGCPWEEGIVSYSIPKG----VQRGME-VDLSDKTYDGNEQGDR------YVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFS--GEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPAMGNFTDEQEQ-RSNSP 431          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329979)

HSP 1 Score: 181.415 bits (459), Expect = 4.263e-46
Identity = 121/363 (33.33%), Postives = 190/363 (52.34%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGW--NRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSP 1355
            L  ++ I +S   ++    P  AR+K  +D    G AWCPK M+ ++ +E++++DL    +I  + T GR G G   EY   + L+Y R    KW R+KN + +++L GN +  +      + +I A +IRIYP  +  +   C+R  I GC +++G+V YS+ +G     + G E  DL D TYDG    D+        +GLGQL+D          D +   +GY ++GW  +   L    VEIV +FD +R+   I  +  NM  +D+ VF  A + FS GG Y+       QF  + DT + + R + I L + + ++LKI+L+F V WI+LSEI  IS  +      E E  ++NSP
Sbjct:   88 LITDAQITASSAHDMAFVGPQHARLKTDND----GGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWRPGFDKWQRWKNIQGKEILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRT-VCLRAEIVGCPWEEGIVSYSIPKG----VQRGME-VDLSDKTYDGNEQGDR------YVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFS--GEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVPAMGNFTDEQEQ-RSNSP 431          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 166.007 bits (419), Expect = 4.317e-41
Identity = 104/361 (28.81%), Postives = 184/361 (50.97%), Query Frame = 3
Query:  297 IASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK-----SNEIIPKESESIQTNSPI 1358
            I +S   ++    P  AR+K  ++    G AWCPK M+     E++++DL  + ++  + T GR G G   EY   + ++Y R    KWIR+++ + +++L GN +  +      +  + A ++R+YP S+  +   C+R  I GC +++G+V YS+ +G     + G +  DL D TYDG    D          GLGQL+D          D N   +GY ++GW    L    VEI+ +F+ +R++  +  +  NM  +D+ VF  A + FS GG ++       QF  + D  + + R + I L + L R++++ L+F   W+++SEI  IS       ++E+   E +S+ +  P+
Sbjct:  122 ITASSAHDMGNVGPQHARLKIDNN----GGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRT-VCLRAEIVGCAWEEGIVSYSIPKG----MQRGMD-IDLSDKTYDGYEEGDH------YVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFS--GEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPVVGNFTDELANGEKQSVTSEYPL 464          

HSP 2 Score: 106.686 bits (265), Expect = 6.902e-23
Identity = 65/231 (28.14%), Postives = 105/231 (45.45%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLF 3632
            S   L++I TQIA GM +LE    +HRDLA R+C+IG  L +K+  I   I +       C + G    +            +  P++WMA+ES+L   ++ K+D+WSF V +WEIL   ++ PY       + + D +   +IG     +    L P                            R+  DL+ ECW R+   RP+F+ I   L++K   F+    H++++
Sbjct:  865 SFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQ-----------SQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPY-------EHLSDKSVIENIGLIYRDYKMHELLPMPPNC----------------------PREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK-PQTHTHMY 1054          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 166.007 bits (419), Expect = 4.317e-41
Identity = 104/361 (28.81%), Postives = 184/361 (50.97%), Query Frame = 3
Query:  297 IASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK-----SNEIIPKESESIQTNSPI 1358
            I +S   ++    P  AR+K  ++    G AWCPK M+     E++++DL  + ++  + T GR G G   EY   + ++Y R    KWIR+++ + +++L GN +  +      +  + A ++R+YP S+  +   C+R  I GC +++G+V YS+ +G     + G +  DL D TYDG    D          GLGQL+D          D N   +GY ++GW    L    VEI+ +F+ +R++  +  +  NM  +D+ VF  A + FS GG ++       QF  + D  + + R + I L + L R++++ L+F   W+++SEI  IS       ++E+   E +S+ +  P+
Sbjct:  122 ITASSAHDMGNVGPQHARLKIDNN----GGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRT-VCLRAEIVGCAWEEGIVSYSIPKG----MQRGMD-IDLSDKTYDGYEEGDH------YVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFS--GEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPVVGNFTDELANGEKQSVTSEYPL 464          

HSP 2 Score: 106.686 bits (265), Expect = 6.902e-23
Identity = 65/231 (28.14%), Postives = 105/231 (45.45%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLF 3632
            S   L++I TQIA GM +LE    +HRDLA R+C+IG  L +K+  I   I +       C + G    +            +  P++WMA+ES+L   ++ K+D+WSF V +WEIL   ++ PY       + + D +   +IG     +    L P                            R+  DL+ ECW R+   RP+F+ I   L++K   F+    H++++
Sbjct:  865 SFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQ-----------SQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPY-------EHLSDKSVIENIGLIYRDYKMHELLPMPPNC----------------------PREIYDLMCECWQRDESSRPSFREIHLYLQRKNLGFK-PQTHTHMY 1054          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2a [Source:ZFIN;Acc:ZDB-GENE-090316-2])

HSP 1 Score: 153.68 bits (387), Expect = 1.838e-37
Identity = 106/365 (29.04%), Postives = 177/365 (48.49%), Query Frame = 3
Query:  285 NESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPE---EWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDH-NNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQTNSP 1355
            +E   ASS W E        A+  ++D     G AWCP+  I + PE   E+++IDL  L  I  + T GR  G    E+A  + + Y R   +WI ++N++ ++++ GN +A ++ + + E  IIAR +R  P+  +  +  CMR+ +YGC++ DG+V Y+   G   +  NG   Y L D  YDG +S         + EGLGQL D +      +  H  N   GY +VGW  +   +  VEI+ +FD+ R+   ++ +  NM    +  F   + +F       D  +    F  V+D      R++ ++L N +A  +K   +F   W++ SEI   S+ +     + P  ++   TN P
Sbjct:   51 DEDISASSQWSEST-----AAKYGRLDCEEGDG-AWCPE--IPAEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRDGSRWISWRNRQGKEVIEGNRNAYDIVLKDLEPPIIARFVRFMPVI-DHSMNVCMRVELYGCEWLDGLVSYNSPLGQQMSL-NGQHIY-LNDSVYDGAMSYS-------MTEGLGQLTDGMCGLDDFTLSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSRRVKTFQKVVCYFRSE---LDWEATPVSFSPVMDDVNPSARFVTVSLYNHMASAIKCQYYFSDIWMMFSEITFQSDTAMYNTTLTPPRTDPPLTNQP 394          

HSP 2 Score: 115.931 bits (289), Expect = 1.379e-25
Identity = 111/466 (23.82%), Postives = 192/466 (41.20%), Query Frame = 3
Query: 2208 PYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTL----KKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLI-SSILEQK 3590
            P R +  L +FS T   ++  +         T+   P  N Q          + +LQG++G +                V +    +KLL+  ++  + Q G V +      G   ++    +     ++T +++   L    N    K+ + + +KE++++  +K    + L A  +            LC + E+ E   +L+ FL++H   +  I  L   PT+                     S S+L  + +QIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE+L  C++ PY    +S +++        I N+   F ++    +  Q    P                        L+  CW+RN  +RP+F+ I  ++LE K
Sbjct:  495 PSRLVRKLPEFSQTSEDTASTI---------TASKTPSVNVQEGVPHYAEADIVNLQGVTGGNTYAVPALTMDLLSGKDVAVEEFSRKLLTFKEKLGEGQFGEVHLCEA--EGMQDFMDKDFSFDVTENQTVLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCMSSD--------PLCMITEYMEN-GDLNQFLSRHE-PEGMIALLSNAPTV---------------------SYSNLHHMASQIASGMKYLSSLNFVHRDLATRNCLVGKNFTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTSSDVWAFGVTLWEMLTFCKEQPYS--QLSDEQV--------IENTGEFFRDQRRQIYLPQPPMCPDP-------------------VYKLMLSCWHRNTKERPSFQEIHHTLLECK 867          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2b (discoidin domain receptor tyrosine kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060503-361])

HSP 1 Score: 152.525 bits (384), Expect = 3.876e-37
Identity = 115/400 (28.75%), Postives = 191/400 (47.75%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKS-SPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR------GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRF-------YAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLI 1418
              +++E   ASS W E        AR  ++D  +  G AWCP  M ++ S +E+++IDL  L  +  + T GR  DG   E+A  + + Y R   +W+ +++++  Q++ GN++A ++ + + E  IIAR +R  P++    I  CMR+ +YGC++ DG+V YS   G   T R G + Y L D  YDG +S         + EGLGQL D     G    D   K +      GY +VGW    L    VE+  +FD++R+   ++        +  NM    + +F  A+  F     +    +P + FK   D+     R+I + L N +A  ++    F   W++ SEI   S+ +     ++P++      + P TH I        DS+  +LI
Sbjct:   35 GQIQDEDISASSQWSESTA-----ARYGRLDFDDGDG-AWCPDVMAEAHSLKEFLQIDLRTLHFVTLVGTQGRHADGVGNEFAQRYRIKYSRDGTRWVSWRDRQGRQIIEGNSNAYDIVLKDLEPPIIARFVRFMPVTDPSMI-VCMRVELYGCEWLDGLVSYSAPAGQQMTFR-GQQIY-LNDTVYDGAVS-------SSMAEGLGQLTD-----GSWGLDDFTKSQVYGVWPGYDYVGWTNASLPGGSVEMTFEFDRVRNFTSMKINLLVQQVHCNNMYAWGVKMFRQAVCSFRSDADW--EPNPVF-FKPKADSISPSARFITVALGNRMASAIRCRFAFSDIWMMFSEIAFQSDTAVYNTSLVPRKRNQAPVDDP-THKI-------DDSSTRILI 402          

HSP 2 Score: 115.161 bits (287), Expect = 2.038e-25
Identity = 96/383 (25.07%), Postives = 158/383 (41.25%), Query Frame = 3
Query: 2472 LKEFHQEQIGHVSVIGKGENGTVGYISI----------AQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            L+EF ++++     +G+G+ G V                 +I  +P    V       ++L     K+ + + MKE+ ++  ++    + L A        + V    LC + E+ E   +L+ FL++H + +  +                              S  +L+ + +QI+ GM YL S   +HRDLA RNCL+G N  IKI D  MS   ++  Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WEIL  C++ PY  F               I N+   F ++N   +      RP+     P S               L+  CW RN  +RPTF  I S L ++
Sbjct:  547 LEEFPRDRLTFKEKLGEGQFGEVHLCEAEGMQEFMKDHCDDICVDPMLVAV-------KTLREDADKNARNDFMKEIRIISRLRDPNIIRLLA--------VCVESDPLCMITEYMEN-GDLNQFLSRHQLQEDGV-----------------------QADSTSISYGTLINMASQISSGMKYLSSLNFVHRDLATRNCLVGMNNIIKIADFGMSRNLYRGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTMASDVWAFGVTLWEILTLCKEQPYAQFTD----------EQVIENTGEFFRDQNKQVYL----LRPA---CCPES------------LYSLMLNCWRRNAKERPTFLEIHSTLTEQ 843          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: BX088694.1 (discoidin domain receptor family, member 2, like [Source:NCBI gene;Acc:565333])

HSP 1 Score: 151.754 bits (382), Expect = 8.192e-37
Identity = 117/446 (26.23%), Postives = 198/446 (44.39%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEI------VIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKR 1586
              +KN+   ASS W +     P  AR+ + +       AWC    ++ S  ++++IDL  L  +  +AT GR   N   E+A  + L+Y R   +WI ++N+   +++ GN +  +  + +    II R +R+ P++       CMR+ ++GC + DG++ YS  +G    A  G     L D TYDG +   K      L  GLGQL D V+      E    ++  GY +VGW    L    VE+  +FD+ R+   ++ ++ NM    + +FSS    F    +      P  +F TVID R    R++ I L++  A  L+   +F   W++ SEI      +++  K   ++   S    +  P T   T     PT + +    P+ G  + L             +G + TI    +  +FLI    +    L +  +R
Sbjct:   32 GRIKNDDITASSQWYDSTG--PQYARLNREEGEG----AWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHT-VCMRVELFGCAWQDGLMAYSSPEGQIMMA-PGFPITSLNDSTYDGPLERRK------LSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPGYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPV-EFHTVIDDRNPSARYVTIPLKHRSATALRCRFYFADTWMMFSEISFQSVTIVLPTKKPPVLTPPSYEANSEIPETTQKTEDWTTPTKTGS----PEEGNTSIL-------------IGCLVTIILLLVVIIFLILWCQYVCKVLEKAPRR 445          

HSP 2 Score: 105.145 bits (261), Expect = 2.758e-22
Identity = 96/432 (22.22%), Postives = 184/432 (42.59%), Query Frame = 3
Query: 2304 SYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKS------FLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSIL 3581
            +   P  +FQ+         + SLQG++G+++       +  P     +L +   ++ EF ++++     +G+G+ G V ++  A+ ++    +   + +          + L    + + + + +KE++++  + +   + L          + V    LC + E+ E   +L+ FL+Q  + ++ + +    P++                     S++ LL +  QI+ GM YL S   +HRDLA RNCL+ ++L IKI+D  MS   +   Y       IQ              +   P++WMA+ESIL   ++  +D+W+FGVT+WEI   C++ PY    +S +++        I N+   F N+      S     PS                       L+  CW+R+   RP+F  +   L
Sbjct:  499 TLCTPHQSFQSSAPHYAETDIISLQGVTGSNM-------YSVPALTVDSLTRKDISVAEFPRQRLLFREKLGEGQFGEV-HLCEAEGLAEFLGEGAPLPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLC--------VCVSSDPLCMVTEYMEN-GDLNMFLSQREI-ESTLTHANNIPSV---------------------SIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYR-----IQG-------------RAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYS--LLSDEQV--------IENTGEFFRNQGRQIFLSAPPLCPSS-------------------LFKLMMRCWSRDITDRPSFNKLHQAL 844          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 151.369 bits (381), Expect = 1.248e-36
Identity = 116/446 (26.01%), Postives = 198/446 (44.39%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEI------VIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKR 1586
              +KN+   ASS W +     P  AR+ + +       AWC    ++ S  ++++IDL  L  +  +AT GR   N   E+A  + L+Y R   +WI ++N+   +++ GN +  +  + +    II R +R+ P++       CMR+ ++GC + DG++ YS  +G    A  G     L D TYDG +   K      L  GLGQL D V+      E    ++  GY +VGW    L    VE+  +FD+ R+   ++ ++ NM    + +FSS    F    +      P  +F TVID R    R++ + L++  A  L+   +F   W++ SEI      +++  K   ++   S    +  P T   T     PT + +    P+ G  + L             +G + TI    +  +FLI    +    L +  +R
Sbjct:   32 GRIKNDDITASSQWYDSTG--PQYARLNREEGEG----AWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHT-VCMRVELFGCAWQDGLMAYSSPEGQIMMA-PGFPITSLNDSTYDGPLERRK------LSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPV-EFHTVIDDRNPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQSVTIVLPTKKPPVLTPPSYEANSEIPETTQKTEDWTTPTKTGS----PEEGNTSIL-------------IGCLVTIILLLVVIIFLILWCQYVCKVLEKAPRR 445          

HSP 2 Score: 107.842 bits (268), Expect = 3.833e-23
Identity = 107/464 (23.06%), Postives = 197/464 (42.46%), Query Frame = 3
Query: 2217 QISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGN---SVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKS------FLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSIL 3581
            ++  LSQ + T + S  +  P        +   P  +FQ+         + SLQG++G+   SV   T D        S+T K +  ++ EF ++++     +G+G+ G V ++  A+ ++    +   + +          + L    + + + + +KE++++  + +   + L          + V    LC + E+ E   +L+ FL+Q  + ++ + +    P++                     S++ LL +  QI+ GM YL S   +HRDLA RNCL+ ++L IKI+D  MS   +   Y       IQ              +   P++WMA+ESIL   ++  +D+W+FGVT+WEI   C++ PY    +S +++        I N+   F N+      S     PS                       L+  CW+R+   RP+F  +   L
Sbjct:  498 KLPELSQSAETSACSGGYAEPD------VTLCTPHQSFQSSAPHYAETDIISLQGVTGSNMYSVPALTVD--------SLTRKDI--SVAEFPRQRLLFREKLGEGQFGEV-HLCEAEGLAEFLGEGAPLPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLC--------VCVSSDPLCMVTEYMEN-GDLNMFLSQREI-ESTLTHANNIPSV---------------------SIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYR-----IQG-------------RAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYS--LLSDEQV--------IENTGEFFRNQGRQIFLSAPPLCPSS-------------------LFKLMMRCWSRDITDRPSFNKLHQAL 866          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 150.984 bits (380), Expect = 1.525e-36
Identity = 116/446 (26.01%), Postives = 198/446 (44.39%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEI------VIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKR 1586
              +KN+   ASS W +     P  AR+ + +       AWC    ++ S  ++++IDL  L  +  +AT GR   N   E+A  + L+Y R   +WI ++N+   +++ GN +  +  + +    II R +R+ P++       CMR+ ++GC + DG++ YS  +G    A  G     L D TYDG +   K      L  GLGQL D V+      E    ++  GY +VGW    L    VE+  +FD+ R+   ++ ++ NM    + +FSS    F    +      P  +F TVID R    R++ + L++  A  L+   +F   W++ SEI      +++  K   ++   S    +  P T   T     PT + +    P+ G  + L             +G + TI    +  +FLI    +    L +  +R
Sbjct:   20 GRIKNDDITASSQWYDSTG--PQYARLNREEGEG----AWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRNRFGNEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHT-VCMRVELFGCAWQDGLMAYSSPEGQIMMA-PGFPITSLNDSTYDGPLERRK------LSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWESEPV-EFHTVIDDRNPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQSVTIVLPTKKPPVLTPPSYEANSEIPETTQKTEDWTTPTKTGS----PEEGNTSIL-------------IGCLVTIILLLVVIIFLILWCQYVCKVLEKAPRR 433          

HSP 2 Score: 107.842 bits (268), Expect = 3.970e-23
Identity = 107/464 (23.06%), Postives = 197/464 (42.46%), Query Frame = 3
Query: 2217 QISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGN---SVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKS------FLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSIL 3581
            ++  LSQ + T + S  +  P        +   P  +FQ+         + SLQG++G+   SV   T D        S+T K +  ++ EF ++++     +G+G+ G V ++  A+ ++    +   + +          + L    + + + + +KE++++  + +   + L          + V    LC + E+ E   +L+ FL+Q  + ++ + +    P++                     S++ LL +  QI+ GM YL S   +HRDLA RNCL+ ++L IKI+D  MS   +   Y       IQ              +   P++WMA+ESIL   ++  +D+W+FGVT+WEI   C++ PY    +S +++        I N+   F N+      S     PS                       L+  CW+R+   RP+F  +   L
Sbjct:  486 KLPELSQSAETSACSGGYAEPD------VTLCTPHQSFQSSAPHYAETDIISLQGVTGSNMYSVPALTVD--------SLTRKDI--SVAEFPRQRLLFREKLGEGQFGEV-HLCEAEGLAEFLGEGAPLPEQDGRPVLVAVKQLRADATSNARNDFLKEIKIMSRLNNPNIIQLLC--------VCVSSDPLCMVTEYMEN-GDLNMFLSQREI-ESTLTHANNIPSV---------------------SIADLLHMSVQISSGMKYLASLNFVHRDLATRNCLLDRHLTIKISDFGMSRNLYSSDYYR-----IQG-------------RAVLPIRWMAWESILLGKFTTASDVWAFGVTLWEIFTLCKEQPYS--LLSDEQV--------IENTGEFFRNQGRQIFLSAPPLCPSS-------------------LFKLMMRCWSRDITDRPSFNKLHQAL 854          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 156.377 bits (394), Expect = 3.294e-38
Identity = 105/366 (28.69%), Postives = 178/366 (48.63%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEE---WIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQT 1346
             ++ +E   ASS W E        A+  ++D     G AWCP+  +   PEE   +++IDL  L  I  + T GR  G    E+A  F ++Y R   +WI ++N+   Q+L+GN +  ++ + + E  I+AR +R  P++ +  +  C+R+ +YGC + DG+V Y+   G  +    G   Y L D  YDG I          + EGLGQL D V      +  H   +  GY +VGW+ +   +  VEIV +FD++R+   ++ +  NM  + + +F      F      ++  S +     V+D      R++ + L N +AR +K   +F   W++ SEI   S+ +   N + P +  S+ T
Sbjct:    4 GHIPDEDITASSQWSEST-----AAKYGRLDSEGGDG-AWCPEMPV--DPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDGTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVT-DHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIY-LNDTIYDGAIGYS-------MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWEANSISSTL--VLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASVPT 350          

HSP 2 Score: 107.842 bits (268), Expect = 5.303e-23
Identity = 103/416 (24.76%), Postives = 165/416 (39.66%), Query Frame = 3
Query: 2370 SLQGISGN---SVMVATND-------AFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVF-PNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILE 3584
            +LQG++G    SV   T D       A ++ P   +T K+ L       + Q G V +      G   ++     + T P + T+++   L    N    K+ + + +KE++++  +K    + L A  + E          LC + E+   +EN    LNQ    +     LP                       L  S + L  +  QIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+F VT+WE L  C++ PY    +S +++ +N           V+ P  N+ P +                               L+  CW R    RP+F+ I   L+
Sbjct:  489 NLQGVTGGNTYSVPAITMDLLSGKEVAVEEFPRKHLTFKEKLG------EGQFGEVHLCEA--EGVEEFLDKDLILETSPGQPTLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCIAED--------PLCMITEY---MENGD--LNQFLSRQQPEGGLPAAT--------------------LPISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYS--EMSDEQVIENTGEFFRDQGKQVYLPKPNICPERVYK----------------------------LMLSCWRRETKDRPSFQEICQSLQ 811          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 156.377 bits (394), Expect = 4.211e-38
Identity = 105/366 (28.69%), Postives = 178/366 (48.63%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEE---WIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQT 1346
             ++ +E   ASS W E        A+  ++D     G AWCP+  +   PEE   +++IDL  L  I  + T GR  G    E+A  F ++Y R   +WI ++N+   Q+L+GN +  ++ + + E  I+AR +R  P++ +  +  C+R+ +YGC + DG+V Y+   G  +    G   Y L D  YDG I          + EGLGQL D V      +  H   +  GY +VGW+ +   +  VEIV +FD++R+   ++ +  NM  + + +F      F      ++  S +     V+D      R++ + L N +AR +K   +F   W++ SEI   S+ +   N + P +  S+ T
Sbjct:   36 GHIPDEDITASSQWSEST-----AAKYGRLDSEGGDG-AWCPEMPV--DPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDGTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVT-DHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIY-LNDTIYDGAIGYS-------MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWEANSISSTL--VLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASVPT 382          

HSP 2 Score: 108.227 bits (269), Expect = 3.821e-23
Identity = 101/417 (24.22%), Postives = 165/417 (39.57%), Query Frame = 3
Query: 2373 LQGISGN---SVMVATND-------AFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVF-PNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            LQG++G    SV   T D       A ++ P   +T K+ L       + Q G V +      G   ++     + T P + T+++   L    N    K+ + + +KE++++  +K    + L A  + E          LC + E+ E   +L+ FL++H  N                           + RH+            QIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+F VT+WE L  C++ PY    +S +++ +N           V+ P  N+ P +                               L+  CW R    RP+F+ I   L+ +
Sbjct:  531 LQGVTGGNTYSVPAITMDLLSGKEVAVEEFPRKHLTFKEKLG------EGQFGEVHLCEA--EGVEEFLDKDLILETSPGQPTLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCIAED--------PLCMITEYMEN-GDLNQFLSRHRENNVKF--------------------HKNDLRHM----------AAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYS--EMSDEQVIENTGEFFRDQGKQVYLPKPNICPERVYK----------------------------LMLSCWRRETKDRPSFQEICQSLQSE 848          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 155.606 bits (392), Expect = 6.193e-38
Identity = 105/366 (28.69%), Postives = 178/366 (48.63%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEE---WIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQT 1346
             ++ +E   ASS W E        A+  ++D     G AWCP+  +   PEE   +++IDL  L  I  + T GR  G    E+A  F ++Y R   +WI ++N+   Q+L+GN +  ++ + + E  I+AR +R  P++ +  +  C+R+ +YGC + DG+V Y+   G  +    G   Y L D  YDG I          + EGLGQL D V      +  H   +  GY +VGW+ +   +  VEIV +FD++R+   ++ +  NM  + + +F      F      ++  S +     V+D      R++ + L N +AR +K   +F   W++ SEI   S+ +   N + P +  S+ T
Sbjct:    4 GHIPDEDITASSQWSEST-----AAKYGRLDSEGGDG-AWCPEMPV--DPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDGTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVT-DHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIY-LNDTIYDGAIGYS-------MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWEANSISSTL--VLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSDAAMYNNSMNPPQPASVPT 350          

HSP 2 Score: 112.849 bits (281), Expect = 1.541e-24
Identity = 115/471 (24.42%), Postives = 191/471 (40.55%), Query Frame = 3
Query: 2208 PYRQISHLSQFSP-------THSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPS--LQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVF-PNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            P R I  L +F+        T +++ +  +P++AD  P      + N Q   +   T S+P+  +  +SG  V      A ++ P   +T K+ L       + Q G V +      G   ++     + T P + T+++   L    N    K+ + + +KE++++  +K    + L A  + E          LC + E+   +EN    LNQ    +     LP   TLY+            + RH+            QIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+F VT+WE L  C++ PY    +S +++ +N           V+ P  N+ P +                               L+  CW R    RP+F+ I   L+ +
Sbjct:  452 PTRLIRKLPEFTAQTVGEEETGNSAGKSALPASADGVPHYAEADIVNLQ-GVTGGNTYSVPAITMDLLSGKEV------AVEEFPRKHLTFKEKLG------EGQFGEVHLCEA--EGVEEFLDKDLILETSPGQPTLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCIAED--------PLCMITEY---MENGD--LNQFLSRQQPEGGLP-AATLYT------------DLRHM----------AAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYS--EMSDEQVIENTGEFFRDQGKQVYLPKPNICPER----------------------------VYKLMLSCWRRETKDRPSFQEICQSLQSE 819          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:100497889])

HSP 1 Score: 154.066 bits (388), Expect = 1.473e-37
Identity = 102/349 (29.23%), Postives = 170/349 (48.71%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEE---WIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK 1304
             ++ +E   ASS W E        A+  ++D     G AWCP+  +   PEE   +++IDL  L  I  + T GR  G    E+A  F ++Y R   +WI ++N+   Q+L+GN +  ++ + + E  I+AR +R  P++ +  +  C+R+ +YGC + DG+V Y+   G  +    G   Y L D  YDG I          + EGLGQL D V      +  H   +  GY +VGW+ +   +  VEIV +FD++R+   ++ +  NM  + + +F      F      ++  S +     V+D      R++ + L N +AR +K   +F   W++ SEI   S K
Sbjct:    4 GHIPDEDITASSQWSEST-----AAKYGRLDSEGGDG-AWCPEMPV--DPEELTEFLQIDLRVLHFITLVGTQGRHAGGHGNEFAQMFKINYSRDGTRWISWRNRHGRQVLDGNVNPYDIVLKDLEPPIVARFLRFIPVT-DHSMNVCLRVELYGCVWLDGLVSYNAPSGQQFLLPEGYAIY-LNDTIYDGAIGYS-------MTEGLGQLTDGVSGLDDFTLTHEYHMWPGYDYVGWSNESFSNGYVEIVFEFDRIRNFTTMKVHCNNMFSKGVKIFKDVQCFFRSDANEWEANSISSTL--VLDDANPSARYVTVQLHNHMARAIKCHYYFADSWMMFSEITFQSGK 333          

HSP 2 Score: 107.071 bits (266), Expect = 8.030e-23
Identity = 103/418 (24.64%), Postives = 166/418 (39.71%), Query Frame = 3
Query: 2370 SLQGISGN---SVMVATND-------AFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVF-PNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            +LQG++G    SV   T D       A ++ P   +T K+ L       + Q G V +      G   ++     + T P + T+++   L    N    K+ + + +KE++++  +K    + L A  + E          LC + E+   +EN    LNQ    +     LP                       L  S + L  +  QIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+F VT+WE L  C++ PY    +S +++ +N           V+ P  N+ P +                               L+  CW R    RP+F+ I   L+ +
Sbjct:  427 NLQGVTGGNTYSVPAITMDLLSGKEVAVEEFPRKHLTFKEKLG------EGQFGEVHLCEA--EGVEEFLDKDLILETSPGQPTLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCIAED--------PLCMITEY---MENGD--LNQFLSRQQPEGGLPAAT--------------------LPISYTDLRHMAAQIASGMKYLSSLNFVHRDLATRNCLVGRNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFAVTLWETLTFCREQPYS--EMSDEQVIENTGEFFRDQGKQVYLPKPNICPERVYK----------------------------LMLSCWRRETKDRPSFQEICQSLQSE 751          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 154.066 bits (388), Expect = 2.458e-37
Identity = 117/449 (26.06%), Postives = 202/449 (44.99%), Query Frame = 3
Query:  153 FQCLIIICFIDKSSQSGKATFA------RVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR---GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFK-----TVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTN 1454
            F+C  ++  +     SG+A  A      R  L   DR           +++E  IASS W E     P  AR+++ +       AWCP  +++    ++++IDL +L  I  + T GR       E+A  + +DY R  G+W+ +++ + +Q++ GN D   V + +    IIAR IR+ P++K   +  CMR+ +YGC + DG+  YSV +G  Y A  G     L D TYDG   ++K    G    GLGQL D +  +G+     + + R   GY ++GW         VE+   FD+ R+   ++ +  N+  + + +F  A   F        R+   ++ +      V+D +    R++ I L+  +   +    +F   W++ SEI   S+    +      ++ T SP +         P  +T   +  QN     L+T 
Sbjct:    2 FRCFFLLALL-----SGRAKCAVIPASCRYALGMHDR----------TIRDEDIIASSQWYESTG--PQYARLQREEGDG----AWCPAGLLQPEDVQYLQIDLHELHFITLIGTQGRHARATGKEFARAYRVDYSRNGGRWLSWRDHQGQQVMRGNVDEYEVVLADLRPPIIARYIRVIPVTKVP-MTVCMRVELYGCKWSDGLTSYSVPEGETYIA-PGQPIAFLNDSTYDGY--LEKRRQFG----GLGQLTDGI--HGLDDFTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFK------PRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFESDMGIAV-----PTLGTQSPTS--------APAQTTEVPVALQNSTERKLETT 400          

HSP 2 Score: 126.716 bits (317), Expect = 9.124e-29
Identity = 113/467 (24.20%), Postives = 196/467 (41.97%), Query Frame = 3
Query: 2208 PYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYIS---IAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKI 3593
            P R++  LSQ +   + S  +  P   DL  ++   P   FQ          + SLQG++GN++       +  P     +L K    + EF + Q+     +G+G+ G V       + + +   P++ +        + L    +K  + + +KE++++  +KH   + L          + V    LC + E+ E   +L+ FL+Q  +                           F   +  PSVS  +LL++  QIA GM YL S   +HRDLA RNCL+G +  IK+ D  MS   +   Y       IQ              +   P++WMA+ESIL   ++  +D W+FGVT+WE+   C++ PY    ++ +++        I N+   F ++    + SQ+   P                       +L+  CW+R+   RPTF+ I   L +++
Sbjct:  502 PLRKLPELSQSAEDSACSGDYAEP---DLTKST---PHQGFQNSVPHYAETDIVSLQGVTGNNM-------YAVPAVTVDSLTKKDITVGEFPRNQLRLKEKLGEGQFGEVHLCEAEGLQEFLEMSPNEFSDQPNMVAVKMLRPDVTKTARNDFLKEIKIISRLKHPNIIRLLG--------VCVRDDPLCMITEYMEN-GDLNQFLSQREIRS------------------------QFTKANNIPSVSRQNLLYMAAQIAAGMKYLASLNFVHRDLATRNCLVGNSYTIKVADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMAWESILLGKFTTCSDAWAFGVTLWEMFSLCKEQPYS--VLTDEQV--------IENTGEFFRDQGRQIYLSQTPLCPGPVF-------------------ELMMRCWSRDIKDRPTFETIHHFLIEQL 875          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 157.918 bits (398), Expect = 1.033e-38
Identity = 97/348 (27.87%), Postives = 175/348 (50.29%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
             ++ +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  +V + + E  I+AR +R+ P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +
Sbjct:   39 GHIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPT--AVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAA 369          

HSP 2 Score: 107.842 bits (268), Expect = 4.583e-23
Identity = 67/217 (30.88%), Postives = 99/217 (45.62%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            S ++L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F ++    +  Q    P                        L+  CW R    RP+F+ I  +L Q+
Sbjct:  682 SYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRDQGRQIYLPQPALCPDS-------------------VYKLMLSCWRRETKHRPSFQEIHLLLLQQ 851          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 157.918 bits (398), Expect = 1.033e-38
Identity = 97/348 (27.87%), Postives = 175/348 (50.29%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
             ++ +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  +V + + E  I+AR +R+ P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +
Sbjct:   39 GHIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPT--AVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAA 369          

HSP 2 Score: 107.842 bits (268), Expect = 4.583e-23
Identity = 67/217 (30.88%), Postives = 99/217 (45.62%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            S ++L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F ++    +  Q    P                        L+  CW R    RP+F+ I  +L Q+
Sbjct:  682 SYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRDQGRQIYLPQPALCPDS-------------------VYKLMLSCWRRETKHRPSFQEIHLLLLQQ 851          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 157.918 bits (398), Expect = 1.033e-38
Identity = 97/348 (27.87%), Postives = 175/348 (50.29%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
             ++ +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  +V + + E  I+AR +R+ P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +
Sbjct:   39 GHIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPT--AVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAA 369          

HSP 2 Score: 107.842 bits (268), Expect = 4.583e-23
Identity = 67/217 (30.88%), Postives = 99/217 (45.62%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            S ++L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F ++    +  Q    P                        L+  CW R    RP+F+ I  +L Q+
Sbjct:  682 SYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRDQGRQIYLPQPALCPDS-------------------VYKLMLSCWRRETKHRPSFQEIHLLLLQQ 851          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 124.405 bits (311), Expect = 8.349e-29
Identity = 80/318 (25.16%), Postives = 149/318 (46.86%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISED---HNNKIR---GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQF--KTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNE 1313
            AWCP   +    EE++++DL  L ++  + T GR  G    E++  + L Y R   +W+ +K++  +++++GN D   V + +    ++AR +R YP + ++ +  C+R+ +YGC + DG++ Y+   G   T +       L D TYDG  +                     + +GV+  D    + ++R   GY +VGW+ +   +  VE+  +FD++R+ + ++ +  NM      +       F RG        P       ++ D R    R I++ L   + RFL+    F   W++ SEI  IS+  N+
Sbjct:   73 AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRA-DRVMSVCLRVELYGCLWRDGLLSYTAPVGQ--TMQLSEVMVHLNDSTYDGYTAGGLQY-----------GGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRA---RAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 123.635 bits (309), Expect = 5.053e-28
Identity = 80/318 (25.16%), Postives = 148/318 (46.54%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISED---HNNKIR---GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQF--KTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNE 1313
            AWCP   +    EE++++DL  L ++  + T GR  G    E++  + L Y R   +W+ +K++  +++++GN D   V + +    ++AR +R YP   ++ +  C+R+ +YGC + DG++ Y+   G   T +       L D TYDG  +                     + +GV+  D    + ++R   GY +VGW+ +   +  VE+  +FD++R+ + ++ +  NM      +       F RG        P       ++ D R    R I++ L   + RFL+    F   W++ SEI  IS+  N+
Sbjct:   73 AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP-RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQ--TMQLSEVMVHLNDSTYDGYTAGGLQ-----------YGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRA---RAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          

HSP 2 Score: 111.309 bits (277), Expect = 3.730e-24
Identity = 81/327 (24.77%), Postives = 136/327 (41.59%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNL------PRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 3599
            +K+ + + +KE++++  +K    + L          + V    LC + ++ E   +L+ FL+   +   A   L       +GPT+                     S   LL +  QIA GM YL +   +HRDLA RNCL+G+N  IKI D  MS   +   Y    V G                +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  C+  P+G   ++ +++ +NA          V+                   ++ P +          +   +L+  CW+R P QRP F  +   L     N
Sbjct:  660 TKNARNDFLKEVKIMSRLKDPNIIRLLG--------VCVQDDPLCMITDYMEN-GDLNQFLSARQLENKATQGLSGDTESDQGPTI---------------------SYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYR--VQG----------------RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFG--QLTDEQVIENAGEFFRDQGRQVY-------------------LSRPPAC--------PQTLYELMLRCWSREPEQRPPFAQLHRFLADDALN 909          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q62371|DDR2_MOUSE (Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 7.225e-38
Identity = 97/348 (27.87%), Postives = 175/348 (50.29%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
             ++ +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  +V + + E  I+AR +R+ P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +
Sbjct:   39 GHIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPT--AVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAA 369          

HSP 2 Score: 107.842 bits (268), Expect = 3.205e-22
Identity = 67/217 (30.88%), Postives = 99/217 (45.62%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            S ++L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F ++    +  Q    P                        L+  CW R    RP+F+ I  +L Q+
Sbjct:  682 SYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRDQGRQIYLPQPALCPDS-------------------VYKLMLSCWRRETKHRPSFQEIHLLLLQQ 851          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q16832|DDR2_HUMAN (Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 1.486e-37
Identity = 100/369 (27.10%), Postives = 181/369 (49.05%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSP-EEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS----NEIIPKESESIQTNSPI 1358
              + +E   ASS W E        A+  ++D     G AWCP+  ++    +E+++IDL  L  I  + T GR  G    E+AP + ++Y R   +WI ++N+  +Q+L+GN++  ++ + + E  I+AR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G  +    G+  Y L D  YDG +          + EGLGQL D V      ++ H   +  GY +VGW  +   +  +EI+ +FD++R+   ++ +  NM  + + +F     +F      ++    A  F  V+D      R++ + L + +A  +K    F   W++ SEI   S+ +    +E +P    +  T  P+
Sbjct:   39 GQIPDEDITASSQWSEST-----AAKYGRLDSEEGDG-AWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVT-DHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSIIY-LNDSVYDGAVGYS-------MTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWE--PNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPM 390          

HSP 2 Score: 108.997 bits (271), Expect = 1.110e-22
Identity = 75/235 (31.91%), Postives = 108/235 (45.96%), Query Frame = 3
Query: 2916 FNTRHLYPSVSS----------LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQK 3590
            F +RH  P+ SS          L F+ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE    CQ+ PY    +S +++        I N+   F +      Q +  + P Q    P S               L+  CW R+   RP+F+ I  +L Q+
Sbjct:  665 FLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETFTFCQEQPYS--QLSDEQV--------IENTGEFFRD------QGRQTYLP-QPAICPDS------------VYKLMLSCWRRDTKNRPSFQEIHLLLLQQ 852          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q95ZV7|DDRB_CAEEL (Discoidin domain-containing receptor tyrosine kinase B OS=Caenorhabditis elegans OX=6239 GN=ddr-2 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 9.035e-31
Identity = 112/350 (32.00%), Postives = 172/350 (49.14%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVS-GKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYH-FVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFS-RGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFF--EVDWIILSEIVIISEKSN 1310
            +++E   ASS + ++    P  AR  Q         AWCPK  I S  +EW++I      +I ++ T GR  DG   EYA  F + Y R S   W  YK+  + + +  N D  +    + +  IIARRIRI P+S   +   CMR+ ++GC FDD +V Y+V QG   +           D +YDG ++   ++P   L  G+G+L     Y+G + +  NN    +H +VGW RK   +  V++  +F ++R++  I  +  N   +    FSSA + FS  G  + D I     F    DT    PRWI I + N +A+  KI L F  + DW+ +SE+   S  +N
Sbjct:   36 IRDEQISASSSF-DLQSTGPQHARAHQESGSG----AWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRT-VCMRVEVFGCPFDDSLVFYNVDQGDLQSG------ISYHDFSYDGNLA---NSPH--LTGGIGKL-----YDGEVGK--NNVFVNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTI---VHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFESNHTN 356          

HSP 2 Score: 102.834 bits (255), Expect = 9.464e-21
Identity = 63/206 (30.58%), Postives = 97/206 (47.09%), Query Frame = 3
Query: 2946 SSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFK 3563
            S  + I TQ+A G++YLES   +HRD+AARNCL+     +KI D  M+   + + Y +  V G                K   P++WMA+E++L   +S  +D+W FGVTMWEI   C + PY       D   D+               ENL    S  + +  Q ++ P        +  S+ +++ I  CWN    +RP+F+
Sbjct:  620 SQCISICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYYK--VEG----------------KFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYS------DMTDDDVV-------------ENLQSMSSTGSLK--QVLSRP-------RMCPSKLYNEQILPCWNYESSRRPSFE 779          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q63474|DDR1_RAT (Epithelial discoidin domain-containing receptor 1 OS=Rattus norvegicus OX=10116 GN=Ddr1 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 4.778e-28
Identity = 82/318 (25.79%), Postives = 148/318 (46.54%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISED---HNNKIR---GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQF--KTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNE 1313
            AWCP   +    EE++++DL  L ++  + T GR  G    E++  + L Y R   +W+ +K++  +++++GN D   V + +    ++AR +R YP   ++ +  C+R+ +YGC + DG++ Y+   G        +E   L D TYDG  +                     + +GV+  D    + ++R   GY +VGW+     S  VE+  +FD++RS + ++ +  NM      +       F RG        P +     ++ D R    R I++ L   + RFL+    F   W++ SEI  IS+  N+
Sbjct:   73 AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP-RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQL---SEMVYLNDSTYDGYTAGGLQ-----------YGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNHSFPSGYVEMEFEFDRLRSFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVHHALGGSLGDPRA---RAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 372          

HSP 2 Score: 114.775 bits (286), Expect = 2.143e-24
Identity = 82/327 (25.08%), Postives = 137/327 (41.90%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLP------RGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 3599
            +K+ + + +KE++++  +K    + L          + V    LC + ++ E   +L+ FL+ H +       LP      +GPT+                     S   LL +  QIA GM YL +   +HRDLA RNCL+G+N  IKI D  MS   +   Y    V G                +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  C+  P+G   ++ +++ +NA          V+                   ++ P +          +   +L+  CW+R P QRP F  +   L     N
Sbjct:  659 TKNARNDFLKEVKIMSRLKDLNIIRLLG--------VCVQDDPLCMITDYMEN-GDLNQFLSAHQLENKVTQGLPGDRESDQGPTI---------------------SYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYR--VQG----------------RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFG--QLTDEQVIENAGEFFRDQGRQVY-------------------LSRPPAC--------PQTLYELMLRCWSREPEQRPPFSQLHRFLADDALN 908          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 3.534e-27
Identity = 80/318 (25.16%), Postives = 148/318 (46.54%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISED---HNNKIR---GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQF--KTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNE 1313
            AWCP   +    EE++++DL  L ++  + T GR  G    E++  + L Y R   +W+ +K++  +++++GN D   V + +    ++AR +R YP   ++ +  C+R+ +YGC + DG++ Y+   G   T +       L D TYDG  +                     + +GV+  D    + ++R   GY +VGW+ +   +  VE+  +FD++R+ + ++ +  NM      +       F RG        P       ++ D R    R I++ L   + RFL+    F   W++ SEI  IS+  N+
Sbjct:   73 AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYP-RADRVMSVCLRVELYGCLWRDGLLSYTAPVGQ--TMQLSEVMVHLNDSTYDGYTAGGLQ-----------YGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRA---RAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFISDVVND 373          

HSP 2 Score: 111.309 bits (277), Expect = 2.609e-23
Identity = 81/327 (24.77%), Postives = 136/327 (41.59%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNL------PRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITN 3599
            +K+ + + +KE++++  +K    + L          + V    LC + ++ E   +L+ FL+   +   A   L       +GPT+                     S   LL +  QIA GM YL +   +HRDLA RNCL+G+N  IKI D  MS   +   Y    V G                +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  C+  P+G   ++ +++ +NA          V+                   ++ P +          +   +L+  CW+R P QRP F  +   L     N
Sbjct:  660 TKNARNDFLKEVKIMSRLKDPNIIRLLG--------VCVQDDPLCMITDYMEN-GDLNQFLSARQLENKATQGLSGDTESDQGPTI---------------------SYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYR--VQG----------------RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRSQPFG--QLTDEQVIENAGEFFRDQGRQVY-------------------LSRPPAC--------PQTLYELMLRCWSREPEQRPPFAQLHRFLADDALN 909          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A4Z2DC18 (Discoidin domain-containing receptor 2 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002553 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.457e-55
Identity = 116/308 (37.66%), Postives = 174/308 (56.49%), Query Frame = 3
Query:  255 PEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQM--DDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKY--------DLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISE--DHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDR 1139
            P  N +    + SF +SSVWK   +F+P +AR+ ++     +  G+AWCP   ++    EWI+ +   L +I  + TAGRGDGN  EY P+F L YQR  +G W  +      ++L  N D RN+A T  +S++IA+RIRIYP S   + + C+R  +YGCDF DGV+ YS+ QG   T   G + +          +DLTYDG + I+  N    L  G+GQLMDNV Y G +S+  D +    G+HF+GW+   + S  + I+ KFD++R+   +R +  + +P    VFS A + FS  G  +D+
Sbjct:   44 PLINSIDTFPDTSFSSSSVWKNATDFQPFRARLTEVYGSSEHTSGYAWCPNTHVEDGLREWIQAEFSHLVIISVIFTAGRGDGNVKEYMPNFVLRYQREDNGVWYEHVKSDGTRVLKANNDPRNIARTTLDSVVIAKRIRIYPYSHRSKQQVCLRFALYGCDFPDGVISYSMPQGDIVTY--GRQLFGSPYSIPQSFQDLTYDGQL-IESENQ---LIGGIGQLMDNVAYLGNVSQHSDSHPTQPGFHFIGWH---IPSKDLRILFKFDEVRNFIWLRIFTFDSVPLKSRVFSRAHVEFSMDGKTFDK 342          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A095BZ25 (Discoidin domain-containing receptor 2 OS=Schistosoma haematobium OX=6185 GN=MS3_02635 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.263e-54
Identity = 147/460 (31.96%), Postives = 224/460 (48.70%), Query Frame = 3
Query:  255 PEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQM--DDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYT--------ARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISE--DHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYD----------------------------------------RISPAYQFKTVIDTRVY-YPRW-----INITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNR 1457
            P  N V    + SF +SSVWK   +F+P +AR+ ++   + +  G+AWCP   ++    EWI+ +   L +I  + TAGRGDGN  EY P+F L YQR  +G W  +      ++L  N D RN+A T  +S++IA+RIRIYP S   + + C+R  +YGCDF DGV+ YS+ QG   T        +       + +DLTYDG + I+  N    L  G+GQLMDN+ Y G +++  D +    G+HF+GWN   + +  + IV KFD++R+   +R +  + +P    VFS AI+ FS  G  +D                                        R S +   + + DT +Y    W     + I L +  AR++ + L     WI+LSE+      S  + PK    + +N  I +N  S+K  P D T+          NHLD ++
Sbjct:   43 PLINSVDKFPDTSFSSSSVWKNATDFQPFRARLTEVYGSNEHTSGYAWCPNTHVEDGLREWIQAEFSHLVIISVIFTAGRGDGNVKEYMPNFVLRYQREDNGVWYEHVKTDGTRVLKANNDPRNIARTTLDSVVIAKRIRIYPYSHRSKQQVCLRFALYGCDFPDGVISYSMPQGDTITYGQQLLFGSPYSTIPQNFQDLTYDGQL-IELEN---QLVGGIGQLMDNIAYLGNVTQHSDSHPAQPGFHFIGWN---VPNKNLRIVFKFDEVRTFIWLRIFTFDSVPLKSRVFSQAIVEFSMDGKNFDKSIEISTNHARLIDPSQINPTRLSISDNDIQSSSSLSRLKRTSNSMHNELIQDTIIYNNHEWDGALVVQIPLASYRARYVSLTLTSTDSWILLSEVQF---NSTIVQPKSLLPLLSNEEINNNNKSMKKPPDDDTS----------NHLDNSQ 482          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: R7UMC7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155564 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 6.244e-52
Identity = 122/340 (35.88%), Postives = 190/340 (55.88%), Query Frame = 3
Query:  276 NLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGK-WIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNN-KIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEI 1286
             + + + IASS+  E V   P  AR++      + G AWCPK+ I     E++++DLG+LK+I  + T GR G+G   EY   + L+YQR +G+ W R+KN+R+++++ GN +     +   +  IIAR+IR  P S   + + CMR+ ++GC + D +V Y + QG     R G+E  DL D TYDG      +   G+L  GLGQL D          D     I+GY +VGW  +   SN +E+  KFDQ R+   IR +A NM  +D+ VF  A + FS GG +Y  +     F  + DT + + R + I + + + RF+K++LFF+  W++LSE+
Sbjct:    5 QIPDSALIASSMANEDVG--PTSARIRM----EIGGGAWCPKRPISKDVHEYLQVDLGELKVITLVETQGRFGEGQGQEYTDQYLLEYQREAGEPWFRFKNRREQEIIEGNINTYIGEVRIIDPPIIARKIRFIPYSVHPK-QVCMRVELHGCPWTDSIVSYDMRQGE----RRGSE-VDLYDFTYDG------TQTSGMLAGGLGQLTDGAEGQDSFRLDPGGLGIKGYQWVGWKNETFRSNPIELTFKFDQPRNFTSIRIHANNMFSKDVRVFKKAKVFFSIGGEHY--LGEPLDFHYMRDTTIEFARSVFIPVPHRVGRFVKLELFFDAKWLMLSEV 324          

HSP 2 Score: 135.961 bits (341), Expect = 1.655e-28
Identity = 110/420 (26.19%), Postives = 179/420 (42.62%), Query Frame = 3
Query: 2367 PSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSN---LKEFHQEQIGHVSVIGKGENGTVGYISIAQNIST----EPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNS-SAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            P LQG+SGN++    N           TL  L  +   + E  ++ +  +  +G+G+ G V    +   + T     P+           + L +  S+  + +  KE++++  +K    + +   +  E+         L  + E+ E   +LH FL Q +++                  +     S  N + +  S   L+++ TQIA GM YLE   ++HRDLA RNCL+G N  IKI D  MS   +   Y +     I+ N                P++WMA+ES+L   +S K+D+WSFGVT+WE+L   ++ PY G  +S D++  N     +GN    V P     P                            R+  DL+ ECWNR+   RP+F+ I   L++K   F
Sbjct:  573 PGLQGVSGNNIYAVPN-----------TLDLLWKDDLTVMEIPRDSLKPIEKLGEGQFGEVHLCEVVPELLTIEDMGPNSQGARPALVAAKMLRSNASEQARTDFHKEVKIMSRLKDPNIVQVLGVMTQEE--------PLSVVVEYMEG-GDLHQFLRQRSLDCG----------------NGTMTRSRKNAKLI--SHGCLVYVATQIASGMKYLEGLNMVHRDLATRNCLVGHNYAIKIADFGMSRSLYSTDYYK-----IEGNT-------------VLPIRWMAWESLLLGKFSTKSDVWSFGVTLWEVLTLAKEHPYEG--LSDDQVIANCNQCYLGNGLDIVLPQPATCP----------------------------REIYDLMVECWNRDEVARPSFREIHMFLQRKNMGF 906          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A183AAM6 (F5/8 type C domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4011 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.277e-51
Identity = 114/300 (38.00%), Postives = 169/300 (56.33%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQM--DDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRV-SGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYT-ARN--------GNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHN--NKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYD 1136
              + +F ASS  ++ +EF+P+QAR+  +     +  GHAWCP   I+ S  EWI+ +  DL MI  + TAGRGDGN  E+ P+F L YQR  +G W  +  +   ++L  N+D RN+A    +SM+IA+RIRIYP S++ + + C+R  ++GC F DGVV YS+ QG   + A N        G+   + RDL+YDG +     +    L EG+GQLMDNV Y G ++          G+HFVGW +       V I+ KFD +R+   +R +  + IP    +FS  ++ FS  G  Y+
Sbjct:   11 FPDSAFSASSTLEDRIEFQPYQARLTDVYGSKEHTSGHAWCPNTPIEESLREWIQAEFTDLVMIGAIFTAGRGDGNVKEFMPNFVLKYQREDNGPWFEHVKRDGTRVLRANSDPRNLARATLDSMVIAKRIRIYPYSRDGKQQVCLRFALFGCKFPDGVVSYSMPQGGDRSYASNPTSLGNPIGSSSANFRDLSYDGQLIGTNDH----LTEGMGQLMDNVAYLGNVTTPLAMYPSQPGFHFVGWYQH--GQTDVPIIFKFDTVRTFTWVRLFTFDSIPLRARLFSRVVVAFSLDGQTYN 304          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A3R7CV08 (Discoidin domain-containing receptor 2 OS=Clonorchis sinensis OX=79923 GN=Ddr2 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 2.287e-51
Identity = 125/387 (32.30%), Postives = 210/387 (54.26%), Query Frame = 3
Query:  279 LKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSG-KWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDG---VISIDKSNPKGLLEE------GLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRK--FLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEI----VIISEKSNEIIPKESESIQTNSPITHNITSVKYIP 1391
            L   +F ASSV+K   E + H+A +           AWCP + I++   EW++I+   LK+++ L T GR +   A Y P F L YQR +G +W  Y+ +   +LL  N +++ +A++  +  I+A+R R+YP ++ +    C+RI +YG  F DGV+EYS+ +G  Y   +  +   L D +YDG   +  +  +NP+ +         G+G LMD   Y G + E  +N    ++ VGW R+     S  + ++  FDQ+R+  ++R +A+N +   + +F  A+I FS GG YYDR S A  ++   DT+    RW++I L + + RF++I L+F+ DWI+LSEI    V +S      + K S+ +   S +  N    +++P
Sbjct:   68 LPPSAFSASSVYKNQPESQAHKANLVVFASQEESSGAWCPAKPIQAERSEWLQIEFDTLKIMRVLFTEGRANNQNA-YVPAFLLRYQRQTGHRWYDYRMRNGTKLLYANNNSQTIAIS-LDPPIVAKRFRLYPYNELEPRFMCLRIAVYGSVFTDGVIEYSIPEGDVYRM-DPRQHVSLNDTSYDGSWIIPPVTSNNPESITSRRAYFYGGIGLLMDKQYYEGSLPETADN----HNVVGWFRRQHSRPSEHIMMLFCFDQVRNFTELRLHALNSL-RYVALFRRALIQFSIGGRYYDRKSAAILYEGRRDTQSRQARWVSIPLDHRIGRFVRITLWFDYDWIVLSEITFDSVPVSSSMVPAVEKLSDPVMKLSDVDLNQLDEQHLP 446          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103037878])

HSP 1 Score: 149.828 bits (377), Expect = 3.056e-36
Identity = 109/386 (28.24%), Postives = 181/386 (46.89%), Query Frame = 3
Query:  285 NESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPE---EWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDH-NNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLI 1418
            +E   ASS W +        A+  ++D     G AWCP+  I   PE   E+++IDL  L  I  + T GR  G    E+A  + + Y R   +WI ++N+  +Q++ GN +A +V + + +  IIAR +R  P+  +  +  CMR+ +YGC++ DG+V Y+   G        ++   L D  YDG +S         + EGLGQL D +      +  H  N   GY +VGW  +   +  VEI+ +FD+ R+   ++ +  NM  + +  F   + +F       D       F  V+D      R++ ++L N +A  +K   +F   W++ SEI   S+ +     +IP +S    +  P  + I  V     DS   +LI
Sbjct:   51 DEDISASSQWSDST-----AAKYGRLDCEEGDG-AWCPE--IPGEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRDGSRWISWRNRHGKQVIEGNRNAYDVVLQDLQPPIIARFVRFMPVI-DHSMNVCMRVELYGCEWLDGLVSYNAPLGQKMILH--SQPIYLNDSVYDGAMSYS-------MTEGLGQLTDGMCGLDDFTFSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSQRVKTFQKVVCYFRSES---DWEPTPVSFSPVVDDVNPSARFVTVSLNNHMASAIKCQYYFSDMWMMFSEITFQSDTAMYNTTLIPPKSGPPTSTQPGDNPIHKVD----DSNTRILI 411          

HSP 2 Score: 115.546 bits (288), Expect = 1.263e-25
Identity = 109/462 (23.59%), Postives = 191/462 (41.34%), Query Frame = 3
Query: 2208 PYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTL----KKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSIL 3581
            P R +  L +FS T   ++     S +         P ++ Q          + +LQG++G +                + +    +KLL+  ++  + Q G V +    +     Y+    +     ++T +++   L    N    K+ + + +KE++++  +K    + L A  +            LC + E+ E   +L+ FL++H   +  I  L   PT+                     S ++L  + TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE L  C++ PY    +S +++        I N+   F ++    +  Q    P     +P+                L+  CWNRN  +RP+F+ I  +L
Sbjct:  495 PSRLVRKLPEFSQTSEDTASTCTASKS---------PQSSAQEGVPHYAEADIVNLQGVTGGNTYAVPALTMDLLSGKDIAVEEFPRKLLTFKEKLGEGQFGEVHLCEAED--MEDYMDEDFSFDVSDNQTVLVAVKMLRADAN----KNARNDFLKEIKIMSRLKDPNIIRLLAVCMSSD--------PLCMITEYMEN-GDLNQFLSRHE-PEGMIALLSNAPTV---------------------SYNNLHHMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETLTFCKEQPYS--QLSDEQV--------IENTGEFFRDQRRQIYLPQPPLCP-----DPAYK--------------LMLSCWNRNAKERPSFQEIHQVL 863          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 146.747 bits (369), Expect = 2.602e-35
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKS-SPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS---NEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLI 1418
              +++E   ASS W E        AR  ++D  +  G AWCP  + ++ S +E+++IDL  L  +  + T GR  DG   E+A  + + Y R   +W+ + ++   Q+++GN +   V + + E  IIAR +R  P+S +  +  CMR+ +YGC++ DG+V YS   G   T +N +    L D  YDG  ++D S     + EGLGQL D        ++     +  GY +VGW      S  VE+V +FD++R+   ++ +  NM    +  F  A+ +F     +  R      FK   D      R++ + L + +A  +K    F   W++ SEI   S  +     +IP+     +   P  H      +   DS   +LI
Sbjct:   35 GKIQDEDISASSQWSEST-----AARYGRLDFDDGDG-AWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQGRHADGMGNEFAQSYRIKYSRDGVRWVSWHDRNGGQVIDGNKNPYEVVLKDLEPPIIARFVRFMPVS-DPSMTVCMRVELYGCEWLDGLVSYSAPVGQEMTFQNLHVY--LNDTVYDG--TVDHS-----MTEGLGQLTDGSWGLDNFTQSQVYGVWPGYDYVGWTNASFPSGSVEMVFEFDRVRNFTSMKVHCNNMYTSGVRAFQQAVCYFRSESDWEAR---PVSFKPEADNTNTSARFVTVALGHRMASAIKCRFAFSDAWMMFSEIAFQSGTAVYNTSLIPR-----KRGHPSAHPGGDPTHKIDDSNTRILI 398          

HSP 2 Score: 124.405 bits (311), Expect = 2.428e-28
Identity = 100/391 (25.58%), Postives = 166/391 (42.46%), Query Frame = 3
Query: 2472 LKEFHQEQIGHVSVIGKGENGTVGYISI----------AQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLEN--LHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEF 3608
            L+EF +E++     +G+G+ G V                  +  EP    V       ++L    +K+ + + +KE+ ++  ++    + L A        + V    LC + E+   +EN  L+ FL++H +  +         T+                     S S+L+ + TQIA GM YL S   +HRDLA RNCL+G N  IKI D  MS   ++  Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WE L  C++ PY    +S D++        I N+   F ++N   +  +    P           +H           L+Q CW RN  +RP+F+ I S L Q   + + 
Sbjct:  549 LEEFPREKLTFKEKLGEGQFGEVHLCEANGMQDFMKEDEDGVENEPILVAV-------KTLREDATKNTRNDFLKEIRIMSRLRDPNIIRLLA--------VCVESDPLCMITEY---MENGDLNKFLSRHKLQDSGEEQKDTSSTI---------------------SYSTLIRMATQIASGMKYLSSLNFVHRDLATRNCLVGTNYTIKIADFGMSRNLYRGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTMASDVWAFGVTLWETLTLCKEQPYS--QLSDDQV--------IENTGEFFRDQNKQVYLPRPACCP---------DAVHS----------LMQSCWRRNAKERPSFQHIHSTLLQHQADLDM 853          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 142.124 bits (357), Expect = 8.559e-34
Identity = 89/308 (28.90%), Postives = 158/308 (51.30%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISE 1301
            AWCP   +  S  E+++++L  L  +  + T GR  DG+  E+A  + L Y R   +WI +K++  +++++GN +  +V + +    IIAR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH     +G+  Y L D  YDG I        G L  GLGQL D V+      E    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS  +  F +  +      PA + +  + D +    R +++ L    A+ L+    F   W+++SEI   SE
Sbjct:   76 AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHL-SGSPIY-LNDSIYDGSIE------AGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEF-KASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSE 373          

HSP 2 Score: 105.531 bits (262), Expect = 2.125e-22
Identity = 104/418 (24.88%), Postives = 176/418 (42.11%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIA--QNISTEPSKTTVISKSFLY---RSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SLQG+SGN+       A    P++          L E  +E++     +G+G+ G V    I   Q++        V     L    + L    SK+ + + +KE+++L  +K    + L          + V    LC + E+ E   +L+ +L+Q       +L    GP                   H  P++S  +L+ + +QIA GM +L S   +HRDLA RNCL+G        +      +  E +I+ A  G+ +N        I   +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA              E    H  Q       ++  P+           +   +L+  CWNR+   RP+F  + S L +   N 
Sbjct:  634 SLQGVSGNNTYAVP--ALSATPTDC-------PPLPELPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLG--------VCVSSDPLCMVTEYMES-GDLNQYLSQR------VLLDKTGPL------------------HNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVG-------GERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQG-RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYS--HMTDEQVIDNA-------------GEFFRDHGRQI------YLTRPAVC--------PQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMNM 972          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 142.124 bits (357), Expect = 1.016e-33
Identity = 89/308 (28.90%), Postives = 158/308 (51.30%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISE 1301
            AWCP   +  S  E+++++L  L  +  + T GR  DG+  E+A  + L Y R   +WI +K++  +++++GN +  +V + +    IIAR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH     +G+  Y L D  YDG I        G L  GLGQL D V+      E    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS  +  F +  +      PA + +  + D +    R +++ L    A+ L+    F   W+++SEI   SE
Sbjct:   95 AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHL-SGSPIY-LNDSIYDGSIE------AGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEF-KASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSE 392          

HSP 2 Score: 104.76 bits (260), Expect = 3.199e-22
Identity = 104/418 (24.88%), Postives = 176/418 (42.11%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIA--QNISTEPSKTTVISKSFLY---RSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SLQG+SGN+       A    P++          L E  +E++     +G+G+ G V    I   Q++        V     L    + L    SK+ + + +KE+++L  +K    + L          + V    LC + E+ E   +L+ +L+Q       +L    GP                   H  P++S  +L+ + +QIA GM +L S   +HRDLA RNCL+G        +      +  E +I+ A  G+ +N        I   +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA              E    H  Q       ++  P+           +   +L+  CWNR+   RP+F  + S L +   N 
Sbjct:  653 SLQGVSGNNTYAVP--ALSATPTDC-------PPLPELPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLG--------VCVSSDPLCMVTEYMES-GDLNQYLSQR------VLLDKTGPL------------------HNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVG-------GERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQG-RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYS--HMTDEQVIDNA-------------GEFFRDHGRQI------YLTRPAVC--------PQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMNM 991          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 141.739 bits (356), Expect = 1.035e-33
Identity = 89/308 (28.90%), Postives = 158/308 (51.30%), Query Frame = 3
Query:  387 AWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISE 1301
            AWCP   +  S  E+++++L  L  +  + T GR  DG+  E+A  + L Y R   +WI +K++  +++++GN +  +V + +    IIAR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH     +G+  Y L D  YDG I        G L  GLGQL D V+      E    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS  +  F +  +      PA + +  + D +    R +++ L    A+ L+    F   W+++SEI   SE
Sbjct:   76 AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSRDGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHL-SGSPIY-LNDSIYDGSIE------AGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEF-KASLLDHWTEPALKLRVPLEDLKDPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSE 373          

HSP 2 Score: 105.145 bits (261), Expect = 2.084e-22
Identity = 104/418 (24.88%), Postives = 176/418 (42.11%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIA--QNISTEPSKTTVISKSFLY---RSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SLQG+SGN+       A    P++          L E  +E++     +G+G+ G V    I   Q++        V     L    + L    SK+ + + +KE+++L  +K    + L          + V    LC + E+ E   +L+ +L+Q       +L    GP                   H  P++S  +L+ + +QIA GM +L S   +HRDLA RNCL+G        +      +  E +I+ A  G+ +N        I   +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA              E    H  Q       ++  P+           +   +L+  CWNR+   RP+F  + S L +   N 
Sbjct:  596 SLQGVSGNNTYAVP--ALSATPTDC-------PPLPELPRERLIFKEKLGEGQFGEVHLCEIENPQDLPNLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIRLLG--------VCVSSDPLCMVTEYMES-GDLNQYLSQR------VLLDKTGPL------------------HNTPTISYPALISMASQIASGMKFLASLNFVHRDLATRNCLVG-------GERGDGEDRMGERHIKIADFGMSRNLYAGDYYRIQG-RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYS--HMTDEQVIDNA-------------GEFFRDHGRQI------YLTRPAVC--------PQGLYELMLSCWNRDCKLRPSFTHMHSFLAEDAMNM 934          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009339.1 (pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gene:ENSPMAG00000008449.1 transcript:ENSPMAT00000009339.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 8.264e-26
Identity = 54/154 (35.06%), Postives = 81/154 (52.60%), Query Frame = 3
Query: 2937 PSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAI------SFDRIRDNAYNLSIGNS 3380
            P +  L+++ +QI  GM+YL S   +HRDLA RNCL+G++  IKI D  MS   +   Y       IQ              +   P++WMA+ESIL   ++  +D+W+FGVT+WE+L  C++ PYG          + +  RD    +S G S
Sbjct:   80 PKLDKLVYMASQIVSGMAYLSSLNFVHRDLATRNCLVGEHHTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMAWESILLGKFTPASDVWAFGVTLWEMLTLCREQPYGALTDEQVIENTGEFFRDQGRQVSAGTS 215          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 4.017e-24
Identity = 65/211 (30.81%), Postives = 97/211 (45.97%), Query Frame = 3
Query: 2955 LFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQ 3587
            LF+ TQ+A GM+YL  R+ +HRDLA RNCL+G  L +KI+D  +S   +   Y        + NE    N +I       P++WM  ESI    Y+ ++D+W+FGV +WEI     Q PY  F +S + +    Y +  GN                        +A P         G   D  +L++ CW   P  RP+F  +  +L +
Sbjct:   87 LFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLSQSIYAADY-------YKANE----NDAI-------PIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQ-PY--FGMSHEEV---IYFVRDGNV-----------------------LACPD--------GCPLDLYNLMRLCWAHAPADRPSFASVQHVLAR 242          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 8.207e-22
Identity = 55/207 (26.57%), Postives = 90/207 (43.48%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTF 3560
            S+  +L +  +IA GM+YL +++ +HRDLAARNC++ ++  +KI D  M+   ++  Y      G+                   P++WM+ ES+    ++  +D+WSFGV +WEI  + +Q PY G +       +      +     V P                   A P                +LI++CW  NP  RPTF
Sbjct:  131 SLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGL------------------LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQ-PYQGLS------NEQVLKFVMDGGLLVLPP------------------ACPER------------LQELIRKCWQYNPRMRPTF 282          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 8.419e-21
Identity = 55/207 (26.57%), Postives = 90/207 (43.48%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTF 3560
            S+  +L +  +IA GM+YL +++ +HRDLAARNC++ ++  +KI D  M+   ++  Y      G+                   P++WM+ ES+    ++  +D+WSFGV +WEI  + +Q PY G +       +      +     V P                   A P                +LI++CW  NP  RPTF
Sbjct:  170 SLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGL------------------LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQ-PYQGLS------NEQVLKFVMDGGLLVLPP------------------ACPER------------LQELIRKCWQYNPRMRPTF 321          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008763.1 (pep scaffold:Pmarinus_7.0:GL480478:1796:23946:1 gene:ENSPMAG00000007909.1 transcript:ENSPMAT00000008763.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 3.412e-20
Identity = 84/307 (27.36%), Postives = 143/307 (46.58%), Query Frame = 3
Query: 2424 QQPPS------NSVTLKKLLSNLK-EFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGF 3323
            + PPS      +SV   K+L + K EF ++ +     +G+GE G V   + A  +  +   TTV  K  L    ++   +D+    + EL LL  + H   + L         + +  +  L  + E+ +   +L +FL    V + A   +P G      S  N     + + R L  ++  L+    QI+RGM+YL   +++HRDLAARN L+ +  K+KI+D  +S   +                  + +S +   K   P++WMA ES+ +  Y+ ++D+WSFG+ +WEI+     TPY G 
Sbjct:  177 RMPPSESADNLSSVEACKILEDPKWEFPRKNLALGKTLGEGEFGKV-VKATAFRLKGKAGYTTVAVK-MLKECASHSELRDL----LSELNLLKQVNHPNIIRL-------HGACTQDEGPLYLIVEYAK-YGSLRSFLR---VRRKAEFAVPAG----GASNRNSRLLDNPDERGL--TLGDLVSFAWQISRGMTYLADMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVY------------------EGDSYVKRTKGRIPVKWMAIESLFEHMYTSQSDVWSFGILLWEIMTL-GGTPYPGI 441          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 66.2402 bits (160), Expect = 3.103e-11
Identity = 55/201 (27.36%), Postives = 87/201 (43.28%), Query Frame = 3
Query: 2961 IITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESI-LQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFP-NENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPT 3557
            + TQ+ +G++YL S+ I+HRD+ A N L+ Q+   KI+D  +S                +K++D  SNS +++    +   WMA E +  +  YS K DIWS G  + E+     + P+    +        A    IG S +  P  E+  P  SQ                      + R+F D    C+  NP +RPT
Sbjct: 1283 LTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----------------RKSKDIYSNSDMTMRGTVF---WMAPEMVDTKQGYSAKVDIWSLGCIVLEMF--AGKRPWSNLEVV-------AAMFKIGKSKSAPPIPEDTLPLISQ----------------------IGRNFLDA---CFEINPEKRPT 1430          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 58.9214 bits (141), Expect = 4.118e-9
Identity = 31/113 (27.43%), Postives = 55/113 (48.67%), Query Frame = 3
Query: 2952 LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEIL 3290
            + +I+ +  +G+ +L  + IIHRD+ + N L+    ++KITD              CA +  ++++        ++V   Y   WMA E + Q  Y  K D+WS G+   E+L
Sbjct:  670 IAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGF-----------CARLTDKRSKRA------TMVGTPY---WMAPEVVKQREYDEKIDVWSLGIMTIEML 762          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 56.9954 bits (136), Expect = 1.548e-8
Identity = 30/121 (24.79%), Postives = 56/121 (46.28%), Query Frame = 3
Query: 2952 LLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPY 3314
            + +I+ +  +G+ +L +++IIHRD+ + N L+     +KITD    ++  ++      +VG                       WMA E + Q  Y  K D+WS G+ + E++    + PY
Sbjct:  484 MAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTP--------------------YWMAPEIVNQKGYDEKVDVWSLGIMLIEMIE--GEPPY 582          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 56.6102 bits (135), Expect = 1.740e-8
Identity = 36/131 (27.48%), Postives = 61/131 (46.56%), Query Frame = 3
Query: 2961 IITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDN 3353
            I   + RG+SYL  +++IHRD+  +N L+ +N ++K+ D  +S                   E  +S ++      FY    MA E I    YS  +D+WS G+T+ E+ +       G F  S +++  N
Sbjct:  329 IAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVS------------------GEAVNSLATTFTGTSFY----MAPERIQGQPYSVTSDVWSLGLTILEVAN-------GKFPCSSEKMAAN 430          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 55.0694 bits (131), Expect = 4.706e-8
Identity = 38/131 (29.01%), Postives = 56/131 (42.75%), Query Frame = 3
Query: 2961 IITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDN 3353
            I   + RG+SYL  R++IHRD+  +N L+ +  +IK+ D  +S                   E  +S +       FY    MA E I    YS   D+WS G+T+ E+         G F    D+I  N
Sbjct:  322 IAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVS------------------GEAVNSLAMTFTGTSFY----MAPERIQGQPYSVTCDVWSLGLTLLEVAG-------GRFPFESDKITQN 423          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO44269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW90])

HSP 1 Score: 113.235 bits (282), Expect = 9.710e-28
Identity = 85/320 (26.56%), Postives = 132/320 (41.25%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKIT 3596
             K++K +  KE++++ G++H   + L     D+          +C + E+ E   +L+ FL Q  +      + P   T                         +LL++  Q+A GM Y+ S Q +HRDLA RNCL+G +  +KI D  MS   + +HY       IQ              +   P++WMA E ILQ  ++  +D+W+FGVT+WEIL    + PYG          D      I N   +F             FRP     + + + L        D    ++ CW   P  RP F  I S LE ++ 
Sbjct:    7 DKNIKQDFFKEVKIMAGVRHENVVRLLGVCKDD---------PMCMIVEYMEN-GDLNQFLKQRELASGNSAD-PNKVTY-----------------------QALLYMALQLAAGMKYIASHQFVHRDLATRNCLVGHSFTVKIADFGMSRHLYSKHYYR-----IQG-------------RVILPIRWMAPECILQGKFTSASDVWAFGVTLWEILTLAAEYPYG----------DLTDEKVIENVQLMF-------------FRPK----SDAITFLSRPEICPPDVYAKMRSCWAIEPSARPDFHDIHSFLENRVA 247          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO47097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN91])

HSP 1 Score: 104.375 bits (259), Expect = 2.476e-24
Identity = 65/227 (28.63%), Postives = 101/227 (44.49%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFK-EHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTF----KLISSILEQKITNFE 3605
            +++ L+    Q++R M +L SR+ +HRDLAARN L+G+N  +KI D  ++   +K EHY++                         P++WMA E+++   Y+  +D+WSFGV +WEI      +PY G                        P   +Y +  +      Q MA P            ++  DL+  CW  +P QRPTF    + I  ILE K T  +
Sbjct:  133 TLTDLVITSFQVSRAMQFLASRRCVHRDLAARNVLVGENYVMKIADFGLARDIYKEEHYVK-------------------TTAGLLPVKWMAIEALVDQVYTHSSDVWSFGVLLWEIF-TLGGSPYPG-----------------------LPANEVYQYLME-----GQRMAQPEDC--------PQEMYDLMLRCWQHDPAQRPTFTQLLETIDKILEGKTTEVQ 303          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 104.375 bits (259), Expect = 2.717e-24
Identity = 62/220 (28.18%), Postives = 96/220 (43.64%), Query Frame = 3
Query: 2937 PSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKIT 3596
            P++  +L +  +IA GM+YL +R+ +HRDLAARNC++  NL +KI D  M+   ++  Y      G+                   P++WMA ES+    ++  +D+WSFGV MWE+     Q PY G        + N   L       V P  +  P +                              DL+  CW  +P  RPTF  I S++E+ ++
Sbjct:  126 PTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGMTRDIYETDYYRKGGKGL------------------LPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQ-PYPG--------KSNEEVLKYVVDGGVMPKPDDCPDR----------------------------LFDLMTLCWQFSPKARPTFLSIISLIEEDLS 290          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO47110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB1])

HSP 1 Score: 96.2857 bits (238), Expect = 1.013e-21
Identity = 67/215 (31.16%), Postives = 92/215 (42.79%), Query Frame = 3
Query: 2940 SVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILE 3584
            S   LL +    ARGM ++   + +HRDLA RN L+ ++L  KITD  +S   + +        GI  N                PL+WMA ES+L   Y+ ++DIWSFGV MWE+       PY                      SAV PNE L      S FR S+    P             +  D++  CWN  P  RP+F  + ++LE
Sbjct:  119 SGKDLLKLALGAARGMRHISGNRFVHRDLATRNVLVTEDLTAKITDFGLSRDIYSD--------GIYLNAKGGK----------LPLKWMAPESLLDYVYTTQSDIWSFGVLMWEVWS-FGAMPY----------------------SAVVPNELL--SMLMSGFRLSRPPLCPE------------EIYDVMMSCWNAEPEVRPSFAKLCTVLE 278          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 95.5153 bits (236), Expect = 2.262e-21
Identity = 63/213 (29.58%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 2949 SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAIS--FDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSIL 3581
            +L+++ TQ+   MSYLES   IHRDLAARNCL+G N  +K+ D  +S  +     I  A  G +                 +P++W A E++   T+S K+D+W+FG+ +WE L     +PY G  +S  +D++ D  Y                              M  P         G   +   L+Q CW  +P+ RP+FK I   L
Sbjct:  111 TLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLS--RLVSEDIYTAHQGAK-----------------FPIKWTAPEALAHNTFSIKSDVWAFGILLWE-LATYGMSPYPGIDLSQVYDKL-DGGY-----------------------------RMPCPE--------GCPPEVYSLMQTCWCWDPNSRPSFKEIHEKL 265          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 158.303 bits (399), Expect = 5.962e-39
Identity = 101/348 (29.02%), Postives = 173/348 (49.71%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIK-SSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDH-NNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
              +++E   ASS W E        AR  ++D     G AWCP+  ++  + +E+I+IDL  L  I  + T GR  G    E+A  + + Y R   +WI ++N++ +Q++ GN +  +  + + +  IIAR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G           ++  D  YDG I+        ++ EGLGQL D V+     ++ H      GY +VGWN +   S  VEI+ +FD+ R+   ++ +  NM  + I +F   + +F       D  S    F  V+D      R+I + L N +A  +K   +F+  W++ SEI   S+++
Sbjct:   39 GQIRDEDISASSQWSEST-----AARHGRLDCEEGDG-AWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQGRHAGGMGNEFAQMYMIKYSRDGSRWISWRNRQGKQVIEGNRNTYDTVLRDLDPPIIARFVRFMPVT-DHSMNVCMRVELYGCKWLDGLVSYNAPAGEQMKLPAFPVFFN--DSVYDGAIT-------HMMTEGLGQLSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDS---DWESTVLSFSPVVDENDPSARFITVELTNRMANAIKCQFYFKDAWMLFSEITFQSDRA 367          

HSP 2 Score: 113.235 bits (282), Expect = 6.608e-25
Identity = 107/414 (25.85%), Postives = 185/414 (44.69%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSN----LKEFHQEQIGHVSVIGKGENGTVGYISIAQNIS---------TEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAV-NKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLI 3569
            +LQG++G++               +VTL  LLS     ++EF ++ +     +G+G+ G V ++  A+ +            P    V+    + RS  N N+++   + +KE++++  +K    + L A        + ++   LC + E+ E   +L+ FL++H    + A+L+                     NT  +  S S+L ++ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WEIL+ C++ PY        ++ D      I N+   F +      Q +  + P   + + S                ++  CW RN  +RP+F+ I
Sbjct:  533 NLQGVTGSNTYAIP----------AVTLD-LLSGKDVAVEEFPRKLLTFKEKLGEGQFGEV-HLCEAEGMQEFLHEEYLFDIPEDQPVLVAVKMLRSDANGNARN---DFLKEIKIMSRLKDPNIIRLLA--------VCIYSNPLCMITEYMEN-GDLNQFLSRHEPEGQLALLS---------------------NTATV--SFSNLCYMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYS-------QLTDEQV---IENTGEFFRD------QKRQIYLPQPVLCSDS-------------LYKIMLTCWRRNAKERPSFQEI 852          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:101161722])

HSP 1 Score: 158.303 bits (399), Expect = 5.962e-39
Identity = 101/348 (29.02%), Postives = 173/348 (49.71%), Query Frame = 3
Query:  273 ANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIK-SSPEEWIEIDLGDLKMIKNLATAGRGDGNFA-EYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDH-NNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKS 1307
              +++E   ASS W E        AR  ++D     G AWCP+  ++  + +E+I+IDL  L  I  + T GR  G    E+A  + + Y R   +WI ++N++ +Q++ GN +  +  + + +  IIAR +R  P++ +  +  CMR+ +YGC + DG+V Y+   G           ++  D  YDG I+        ++ EGLGQL D V+     ++ H      GY +VGWN +   S  VEI+ +FD+ R+   ++ +  NM  + I +F   + +F       D  S    F  V+D      R+I + L N +A  +K   +F+  W++ SEI   S+++
Sbjct:   39 GQIRDEDISASSQWSEST-----AARHGRLDCEEGDG-AWCPETTVEPDNLKEFIQIDLNLLHFITLVGTQGRHAGGMGNEFAQMYMIKYSRDGSRWISWRNRQGKQVIEGNRNTYDTVLRDLDPPIIARFVRFMPVT-DHSMNVCMRVELYGCKWLDGLVSYNAPAGEQMKLPAFPVFFN--DSVYDGAIT-------HMMTEGLGQLSDGVMGLDDFTQSHVYQAWPGYDYVGWNNESFPSGFVEIMFEFDRPRNFTTMKVHCNNMFSQHIKIFRQVVCYFRSDS---DWESTVLSFSPVVDENDPSARFITVELTNRMANAIKCQFYFKDAWMLFSEITFQSDRA 367          

HSP 2 Score: 113.235 bits (282), Expect = 6.608e-25
Identity = 107/414 (25.85%), Postives = 185/414 (44.69%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSN----LKEFHQEQIGHVSVIGKGENGTVGYISIAQNIS---------TEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAV-NKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLI 3569
            +LQG++G++               +VTL  LLS     ++EF ++ +     +G+G+ G V ++  A+ +            P    V+    + RS  N N+++   + +KE++++  +K    + L A        + ++   LC + E+ E   +L+ FL++H    + A+L+                     NT  +  S S+L ++ TQIA GM YL S   +HRDLA RNCL+G+N  IKI D  MS   +   Y       IQ              +   P++WM++ESIL   ++  +D+W+FGVT+WEIL+ C++ PY        ++ D      I N+   F +      Q +  + P   + + S                ++  CW RN  +RP+F+ I
Sbjct:  533 NLQGVTGSNTYAIP----------AVTLD-LLSGKDVAVEEFPRKLLTFKEKLGEGQFGEV-HLCEAEGMQEFLHEEYLFDIPEDQPVLVAVKMLRSDANGNARN---DFLKEIKIMSRLKDPNIIRLLA--------VCIYSNPLCMITEYMEN-GDLNQFLSRHEPEGQLALLS---------------------NTATV--SFSNLCYMATQIASGMKYLSSLNFVHRDLATRNCLVGKNYTIKIADFGMSRNLYSGDYYR-----IQG-------------RAVLPIRWMSWESILLGKFTTASDVWAFGVTLWEILNFCKEQPYS-------QLTDEQV---IENTGEFFRD------QKRQIYLPQPVLCSDS-------------LYKIMLTCWRRNAKERPSFQEI 852          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 145.976 bits (367), Expect = 3.152e-35
Identity = 118/454 (25.99%), Postives = 211/454 (46.48%), Query Frame = 3
Query:  270 VANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIR-GYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEII---PKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPI 1613
               + +    ASS W +  E +  +    + D       AWCP   +  S  E+++IDL  L  +  + T GR  DG+  E+   + L Y R   KWI +K++  +++++GNT+   V + +    I+AR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH      G   Y L D  YDG      S  + +   GLGQL D V+     ++    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS     F + G+     SP       + D +    R I+I L    A+ L    +F   W+++SEI  +S ++   +   P+ S  I ++  + +   +    P  ST T + P+ G     D + ++           A +  C +G + L+ L V  V   R++ K+  GK+ + I
Sbjct:   33 AGTIPDSDISASSAWSDSTEAKHGRLSTGEGDG------AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRDGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNL-PGLPVY-LNDSIYDG------STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLF-KLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSVRTLSSVLLSPRHSVFISSHMFVLYPPFTPPE-PLSSTNTTVTPRAGLPVAKDDSSNT-----------AILIGCLVGIILLL-LAVIAVILWRQYWKKILGKVCSDI 457          

HSP 2 Score: 102.449 bits (254), Expect = 1.382e-21
Identity = 86/335 (25.67%), Postives = 141/335 (42.09%), Query Frame = 3
Query: 2637 SKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNL-----------KIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SK+ + + +KE+++L  +K    + L          + V    LC + E+ E  +     LNQ+  ++  +L    GP+                  H  P++S  +L+ I +QIA GM +L S   +HRDLA RNCL+G +            +IKI D  MS   +   Y       IQ              +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA          V+                   +  P+           +   +L+  CWNR+   RP+F  I S L +   N 
Sbjct:  499 SKNARNDFLKEVKILSRLKDPNIIQLLG--------VCVSSDPLCMVTEYMECGD-----LNQYLSHR--VLLDKTGPS------------------HNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGEDRGGERQIKIADFGMSRNLYAGDYYR-----IQG-------------RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSN--LTDEQVIDNAGEFFRDQGRQVY-------------------LGKPAVC--------PQGLYELMLSCWNRDCKLRPSFAHIHSFLTEDAMNM 753          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 146.747 bits (369), Expect = 3.891e-35
Identity = 124/466 (26.61%), Postives = 210/466 (45.06%), Query Frame = 3
Query:  234 KPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQ------TNSPITHNITSVKYIPTDSTATVLIPQNGK--NNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGK 1598
            KPD+           + +    ASS W +  E +  +    + D       AWCP   +  S  E+++IDL  L  +  + T GR  DG+  E+   + L Y R   KWI +K++  +++++GNT+   V + +    I+AR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH      G   Y L D  YDG      S  + +   GLGQL D V+     ++    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS     F + G+     SP       + D +    R I+I L    A+ L    +F   W+++SEI  +SE   E    ES S        T S    N+T+    P  +++      N +   +   T R+    A       A +  C +G + L+ L V  V   R++ K+  GK
Sbjct:   31 KPDQCRYALGMEAGTIPDSDISASSAWSDSTEAKHGRLSTGEGDG------AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRDGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNL-PGLPVY-LNDSIYDG------STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLF-KLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTT----PVFTSSFSSPSTNTRPSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL-LAVIAVILWRQYWKKILGK 475          

HSP 2 Score: 112.464 bits (280), Expect = 1.338e-24
Identity = 106/419 (25.30%), Postives = 178/419 (42.48%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSK----TTVISKSFLY--RSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SLQG+SGN+       A   P +++ +L +L      F ++       +G+G+ G V    I +N    PS          +  L   + L    SK+ + + +KE+++L  +K    + L          + V    LC + E+ E  +     LNQ+  ++  +L    GP+                  H  P++S  +L+ I +QIA GM +L S   +HRDLA RNCL+G +      D      +  E  I+ A  G+ +N        I   +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA          V+                   +  P+           +   +L+  CWNR+   RP+F  I S L +   N 
Sbjct:  637 SLQGVSGNNTYAVPALASSSPGADAASLPELPRQCLIFKEK-------LGEGQFGEVHLCEI-ENPQDLPSLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLG--------VCVSSDPLCMVTEYMECGD-----LNQYLSHR--VLLDKTGPS------------------HNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGED------RGGERQIKIADFGMSRNLYAGDYYRIQG-RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSN--LTDEQVIDNAGEFFRDQGRQVY-------------------LGKPAVC--------PQGLYELMLSCWNRDCKLRPSFAHIHSFLTEDAMNM 978          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 144.436 bits (363), Expect = 1.791e-34
Identity = 127/483 (26.29%), Postives = 211/483 (43.69%), Query Frame = 3
Query:  234 KPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGR-GDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKI-RGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVI-DTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQ------TNSPITHNITSVKYI--------------PTDSTATVLIPQNGKNNHLD-----TNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGK 1598
            KPD+           + +    ASS W +  E +  +    + D       AWCP   +  S  E+++IDL  L  +  + T GR  DG+  E+   + L Y R   KWI +K++  +++++GNT+   V + +    I+AR +R YP++ ++ +  C+R+ +YGC ++DG+  Y+   GH      G   Y L D  YDG      S  + +   GLGQL D V+     ++    ++  GY +VGW+R+ L    V+I   F++ R    ++ ++ N   + + VFS     F + G+     SP       + D +    R I+I L    A+ L    +F   W+++SEI  +SE   E    ES S        T S    N+T+  +               P  ST T  +     N  +      T R+    A       A +  C +G + L+ L V  V   R++ K+  GK
Sbjct:   31 KPDQCRYALGMEAGTIPDSDISASSAWSDSTEAKHGRLSTGEGDG------AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRDGVKWITWKDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLA-DRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNL-PGLPVY-LNDSIYDG------STEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLF-KLGILLPWSSPPLTLPVPLEDLKDPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEPYEEDTDAESFSYHLPKDPGTTSSAPVNVTTPVFTSSFSSPSTNTRPSEPLSSTNTSFMRDTSGNWTVSESAAVTPRAGLPVAKDDSSNTAILIGCLVGIILLL-LAVIAVILWRQYWKKILGK 496          

HSP 2 Score: 112.464 bits (280), Expect = 1.451e-24
Identity = 106/419 (25.30%), Postives = 178/419 (42.48%), Query Frame = 3
Query: 2370 SLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSK----TTVISKSFLY--RSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVS--SLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNF 3602
            SLQG+SGN+       A   P +++ +L +L      F ++       +G+G+ G V    I +N    PS          +  L   + L    SK+ + + +KE+++L  +K    + L          + V    LC + E+ E  +     LNQ+  ++  +L    GP+                  H  P++S  +L+ I +QIA GM +L S   +HRDLA RNCL+G +      D      +  E  I+ A  G+ +N        I   +   P++WMA+E IL   ++  +D+W+FGVT+WE+L  CQ+ PY    ++ +++ DNA          V+                   +  P+           +   +L+  CWNR+   RP+F  I S L +   N 
Sbjct:  658 SLQGVSGNNTYAVPALASSSPGADAASLPELPRQCLIFKEK-------LGEGQFGEVHLCEI-ENPQDLPSLEFPFNVRKGRPLLVAVKILRPDASKNARNDFLKEVKILSRLKDPNIIQLLG--------VCVSSDPLCMVTEYMECGD-----LNQYLSHR--VLLDKTGPS------------------HNAPTISYPALISIASQIASGMKFLSSLNFVHRDLATRNCLVGGDRGENGED------RGGERQIKIADFGMSRNLYAGDYYRIQG-RAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEMLSVCQEQPYSN--LTDEQVIDNAGEFFRDQGRQVY-------------------LGKPAVC--------PQGLYELMLSCWNRDCKLRPSFAHIHSFLTEDAMNM 999          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 2400.16 bits (6219), Expect = 0.000e+0
Identity = 1189/1195 (99.50%), Postives = 1192/1195 (99.75%), Query Frame = 3
Query:   75 MDFFISLSFTTINFSLKMGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLXXXXXXXXXXXXFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 3659
            MDFFISLSFTTINFSLKMGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRY+NQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK NEIIPKESESIQTN PITHNITSVKYIPTDSTATVLIPQNGKNNH+DTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTE SKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHE+LGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY
Sbjct:    1 MDFFISLSFTTINFSLKMGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIPTDSTATVLIPQNGKNNHIDTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEHSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 1195          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 2367.42 bits (6134), Expect = 0.000e+0
Identity = 1172/1178 (99.49%), Postives = 1175/1178 (99.75%), Query Frame = 3
Query:  126 MGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLXXXXXXXXXXXXFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 3659
            MGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRY+NQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK NEIIPKESESIQTN PITHNITSVKYIPTDSTATVLIPQNGKNNH+DTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTE SKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHE+LGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY
Sbjct:    1 MGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIPTDSTATVLIPQNGKNNHIDTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEHSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 1178          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 2344.7 bits (6075), Expect = 0.000e+0
Identity = 1164/1180 (98.64%), Postives = 1170/1180 (99.15%), Query Frame = 3
Query:  120 LKMGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLXXXXXXXXXXXXFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 3659
            +KM  F  LFTFQ LIIICF+DKS QSG+ TFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRY+NQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK NEIIPKESESIQTN PITHNITSVKYIPTDSTATVLIPQNGKNNH+DTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTE SKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHE+LGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY
Sbjct:    1 MKMELFSLLFTFQSLIIICFVDKSRQSGRTTFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIPTDSTATVLIPQNGKNNHIDTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEHSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 1180          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067438.1 (SMESG000067438.1)

HSP 1 Score: 2342 bits (6068), Expect = 0.000e+0
Identity = 1163/1178 (98.73%), Postives = 1168/1178 (99.15%), Query Frame = 3
Query:  126 MGFFPSLFTFQCLIIICFIDKSSQSGKATFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLXXXXXXXXXXXXFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 3659
            M  F  LFTFQ LIIICF+DKS QSG+ TFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRY+NQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEK NEIIPKESESIQTN PITHNITSVKYIPTDSTATVLIPQNGKNNH+DTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTE SKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHE+LGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY
Sbjct:    1 MELFSLLFTFQSLIIICFVDKSRQSGRTTFARVVLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSGKWIRYRNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKYNEIIPKESESIQTNYPITHNITSVKYIPTDSTATVLIPQNGKNNHIDTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYPGNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEHSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCFLFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIGNSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHEDLGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY 1178          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000016549.1 (SMESG000016549.1)

HSP 1 Score: 327.02 bits (837), Expect = 1.686e-93
Identity = 339/1217 (27.86%), Postives = 537/1217 (44.12%), Query Frame = 3
Query:  264 NLVANLKNESFIASSVWKEIVEFEPHQARMKQ-----MDDPNLLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHFYLDYQRVSG-KWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYPISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLTYDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWNRKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGGVYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWIILSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQNGKNNHLDTNRXXXXXXXXXLGLIATISSCFLGFVFLIALIVFGVFTLRRHKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLXXXXXXXXXXXXFYYKYPGNVELGLTYPVM-GKEYMTLSSKSGTDY------------DMAGGNSLDGLIPTGTRDIKYNGMNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFENGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPPNQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVNNFQTDQSVI-MTNSM-----------PSLQGISGNSVMVAT----NDAFQQPPSNSVTLKKLLSNLKEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSLNNYNSKDVKYETMKELELLCGIKHSVFLPLTAYV----LDEQNSMSVHQTAL-----CFLFEFDEPLENLHTFLNQHA--VNKAAILNLPRGPTLYXXXXXXXXXXXXFNTRHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKITDIAMSIQKFKEHYI-------ECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESILQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNA---------YN---LSIGNSSAVFP-NENL--------------YPHQSQ-SNFRPSQHMAN-PSSSILHEN------LGLSRDFSDLIQECWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNS 3650
            NL+ +L +++F  SS       F P+ AR K      +D P     AWCPK  +  + +E+I++D  DLK +  L T G  +GN   +   FYLDYQR +G +W RYKN+   +L+ GN D+RN+ +T F+S IIARRIRI PIS   +   C++   YG +F+DGVVEYS+ QG  +T      K+ L+D  YDG   I+      +L  G+GQLMDN+I    I+  +N ++   +FVGW + F  + K+E++ +FD++R +K + F+ +N + ++I +FSSA   FS GG  Y + +    FK   D ++   RW+++ L +  A+F+++ L F + WI+L+E+   +    E  P E +   + S    N       PT     +LI                    + +GL+  IS C L F       +             KGK   P++  R    P I + + +P+      SS  G  Y   P  +     Y  M G +  TL+ +  T+Y              +  N   G+ P    +  YN   + +  +GQ +         R S DGS G SSN +Y++ SL   +          P +   +    +  +K+NP+    L   P +    +P  Q           S+    RQ + +  F P +S     L PS  + Y   ++    N   D S+I   N +             LQ   G S ++      N++F       + ++K    L +   E++    +IG G  G++              K        + +++N      V+   +K +  L  I    F+ +  Y      DE          L     C + +       LH F+ +H+  V+ A I      P   +   S        +++ L  S S L++I  QI+ GMS+LE   +IHRDLA RNC++G  L I ITD AM   KF++ YI       + + +G+    D D N +        PLQWM++E++L+  YS K+D+WSFGV  W++L  CQ  PY     +   I   A         +N   L  G  +++ P NE+L               P  SQ  N    + +AN  +  + H++      L  +R+  DLI  CW+  P  RP FK IS  L+QKI NF    ++  + + +  S
Sbjct:   35 NLINDLSDDAFSCSSFRDN---FFPYLAREKNSKNRMIDSP----QAWCPKNEVGPNSKEYIQVDFKDLKALSYLVTNGLDNGNDGFFVSFFYLDYQRENGSEWHRYKNESDHKLIEGNVDSRNMKITKFKSNIIARRIRIIPISNITKT-VCLKFTFYGGNFNDGVVEYSMPQGDIFTIYQ--IKFPLKDRIYDG---IEHRKNDNVLRRGIGQLMDNIINENSIASINNGEV---NFVGW-QNFDKNRKIEMIFRFDKVRIMKGVSFHILNDLKKNISIFSSARFEFSIGGEIYGKCAKNITFKHNADLKLKTARWLHVNLSDSPAKFVRVTLEFRLQWIVLTEVQFTTNVPKEEYPTEKQGSDSRSKSKPN----SMFPTSKINNLLI--------------CFCVIITFVGLMCIISICILRFRRQRKRRI-------------KGK---PLHSIRYGNMP-INNVIPIPV-----VSSSNGGIYKPIPNGI-----YDCMPGFQSQTLNVRKVTNYPNQQLFGTYSNRKNSNSNQNPGIAPINQDN--YNA--TLSQIVGQPNVALYCPENKRASYDGSYGTSSNPEYSNGSLEKKT---------LPLHLVPLSPTMYEQYKLNPNNHHGLPNPPHQFNLMSPVLQ-----------SYQQDSRQ-TFVDNF-PVNS-----LAPSMINNYVQPFIYQPANLTIDSSIIRWPNELYELLEKHSRFDTCLQSPVGGSTVLREKFDGNESFTMKDYEEIIMEK----LSKIDIEKMELQKLIGSGRYGSI-------------KKGIYNGSVVVVKAINRDCVPSVRISFLKMISDLMKISSKNFVKIVGYCDYSTTDEGEEFPFQDILLKPSISCIIMQHTHQ-GYLHKFIRRHSRPVSSALINATNNKPGSDTSCTSVEDEPEESSSKPLL-SHSCLIYIAAQISDGMSFLEHEGLIHRDLATRNCIVGPRLSILITDTAMDNNKFQKDYITINKVLSDLSTIGM----DIDVNINFYQPSVSLPLQWMSWEAVLKGRYSSKSDVWSFGVLFWDLLTFCQFRPYFCVPQNLTNIDSTANYVKCLSLLFNFKCLEHGLDNSLMPNNESLSQIRKGTSWTTPLPLPVPSQIINISSDRRLANIQTPRMTHQDSSVNRILDSNREIRDLISSCWSTEPSNRPKFKDISIFLKQKINNFNVEEEYQYIQTNVRRS 1135          
The following BLAST results are available for this feature:
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR23.095e-3827.10discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR23.095e-3827.10discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR23.095e-3827.10discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
TYRO31.199e-2933.18TYRO3 protein tyrosine kinase [Source:HGNC Symbol;... [more]
DDR17.727e-2825.55discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr-27.103e-3232.00Discoidin domain-containing receptor tyrosine kina... [more]
ddr-27.233e-3232.00Discoidin domain-containing receptor tyrosine kina... [more]
ddr-27.233e-3232.00Discoidin domain-containing receptor tyrosine kina... [more]
ddr-11.371e-2626.56Discoidin domain-containing receptor A [Source:Un... [more]
F11E6.83.221e-2131.13pep chromosome:WBcel235:IV:17444156:17447429:-1 ge... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smal2.888e-4633.33gene:FBgn0085409 transcript:FBtr0329980[more]
smal2.888e-4633.33gene:FBgn0085409 transcript:FBtr0112617[more]
smal4.263e-4633.33gene:FBgn0085409 transcript:FBtr0329979[more]
Ddr4.317e-4128.81gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr4.317e-4128.81gene:FBgn0053531 transcript:FBtr0344770[more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2a1.838e-3729.04discoidin domain receptor tyrosine kinase 2a [Sour... [more]
ddr2b3.876e-3728.75discoidin domain receptor tyrosine kinase 2b [Sour... [more]
BX088694.18.192e-3726.23discoidin domain receptor family, member 2, like [... [more]
ddr2l1.248e-3626.01discoidin domain receptor family, member 2, like [... [more]
ddr2l1.525e-3626.01discoidin domain receptor family, member 2, like [... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR23.294e-3828.69discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR24.211e-3828.69discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR26.193e-3828.69discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR21.473e-3729.23discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2l2.458e-3726.06discoidin domain receptor tyrosine kinase 2 like [... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr21.033e-3827.87discoidin domain receptor family, member 2 [Source... [more]
Ddr21.033e-3827.87discoidin domain receptor family, member 2 [Source... [more]
Ddr21.033e-3827.87discoidin domain receptor family, member 2 [Source... [more]
Ddr18.349e-2925.16discoidin domain receptor family, member 1 [Source... [more]
Ddr15.053e-2825.16discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62371|DDR2_MOUSE7.225e-3827.87Discoidin domain-containing receptor 2 OS=Mus musc... [more]
sp|Q16832|DDR2_HUMAN1.486e-3727.10Discoidin domain-containing receptor 2 OS=Homo sap... [more]
sp|Q95ZV7|DDRB_CAEEL9.035e-3132.00Discoidin domain-containing receptor tyrosine kina... [more]
sp|Q63474|DDR1_RAT4.778e-2825.79Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q03146|DDR1_MOUSE3.534e-2725.16Epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DC185.457e-5537.66Discoidin domain-containing receptor 2 (Fragment) ... [more]
A0A095BZ252.263e-5431.96Discoidin domain-containing receptor 2 OS=Schistos... [more]
R7UMC76.244e-5235.88Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A183AAM62.277e-5138.00F5/8 type C domain-containing protein OS=Echinosto... [more]
A0A3R7CV082.287e-5132.30Discoidin domain-containing receptor 2 OS=Clonorch... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2a3.056e-3628.24discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ENSAMXT00000019857.22.602e-3528.09discoidin domain-containing receptor 2-like [Sourc... [more]
ddr18.559e-3428.90discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr11.016e-3328.90discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr11.035e-3328.90discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009339.18.264e-2635.06pep scaffold:Pmarinus_7.0:GL479558:1022:6538:1 gen... [more]
ENSPMAT00000001705.14.017e-2430.81pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
ENSPMAT00000009485.18.207e-2226.57pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.18.419e-2126.57pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
ENSPMAT00000008763.13.412e-2027.36pep scaffold:Pmarinus_7.0:GL480478:1796:23946:1 ge... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK13.103e-1127.36MAPKKK acting in the protein kinase C signaling pa... [more]
CLA44.118e-927.43Cdc42p-activated signal transducing kinase; member... [more]
SKM11.548e-824.79Member of the PAK family of serine/threonine prote... [more]
MKK11.740e-827.48MAPKK involved in the protein kinase C signaling p... [more]
MKK24.706e-829.01MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442699.710e-2826.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470972.476e-2428.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476522.717e-2428.18Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO471101.013e-2131.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471952.262e-2129.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2a5.962e-3929.02discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr2a5.962e-3929.02discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
ddr13.152e-3525.99epithelial discoidin domain-containing receptor 1 ... [more]
ddr13.891e-3526.61epithelial discoidin domain-containing receptor 1 ... [more]
ddr11.791e-3426.29epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067438.10.000e+099.50SMESG000067438.1[more]
SMESG000067438.10.000e+099.49SMESG000067438.1[more]
SMESG000067438.10.000e+098.64SMESG000067438.1[more]
SMESG000067438.10.000e+098.73SMESG000067438.1[more]
SMESG000016549.11.686e-9327.86SMESG000016549.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034880 ID=SMED30034880|Name=Discoidin domain-containing receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3880bp
GTCCTATGACGTCACAAGTAATGTATTTCTGAAACATTTCCCAGTTTTTA
TTCAACCAAGAATATTATTCAATCATGGATTTTTTCATTTCATTATCATT
CACAACAATTAATTTTTCATTGAAAATGGGATTTTTTCCTTCATTATTCA
CATTTCAGTGTTTGATTATTATTTGTTTCATAGATAAATCCAGTCAATCA
GGAAAAGCTACATTTGCTCGAGTCGTTTTAAACAAACCGGACAGACAACT
GCTGCCGGAAAAGAATCTTGTGGCCAATTTAAAAAACGAATCTTTTATAG
CAAGCAGTGTTTGGAAAGAAATTGTAGAATTTGAACCTCATCAAGCCCGA
ATGAAACAAATGGATGATCCAAATCTTCTGGGACATGCCTGGTGTCCTAA
ACAGATGATTAAATCTTCTCCTGAAGAATGGATTGAAATCGACCTGGGAG
ACTTAAAAATGATAAAAAACCTGGCTACTGCGGGTCGCGGAGATGGGAAT
TTTGCTGAATATGCTCCACATTTCTATCTCGACTATCAGCGAGTATCCGG
TAAATGGATTAGGTATAAAAATCAAAGAAAAGAGCAACTACTTAATGGAA
ACACTGACGCACGAAATGTAGCCATGACCAATTTTGAGTCCATGATTATT
GCTCGGCGAATACGTATTTATCCGATCAGTAAGGAGAAACAGATCAGAGC
CTGCATGAGAATAATAATTTACGGATGTGATTTTGACGACGGAGTTGTTG
AGTATTCGGTAAGTCAAGGACATTATTATACGGCGCGAAATGGAAATGAA
AAATATGATTTACGGGATTTAACTTATGACGGAGTCATTTCCATTGATAA
GTCAAATCCCAAAGGTCTACTGGAAGAAGGACTAGGTCAACTTATGGATA
ATGTGATTTACAACGGTGTGATATCAGAAGATCATAACAACAAAATTCGA
GGTTATCATTTCGTCGGGTGGAACCGTAAATTCCTAGATTCAAATAAAGT
CGAAATAGTTATGAAATTCGATCAAATGAGATCAGTTAAACAAATTAGAT
TTTATGCAATGAACATGATTCCCGAAGACATTGGAGTATTTTCTAGTGCA
ATTATTCATTTCAGTCGAGGTGGGGTTTATTATGATCGGATTTCCCCAGC
ATATCAATTCAAAACTGTCATTGACACAAGGGTTTATTATCCAAGATGGA
TCAACATTACACTGCAAAATGTTTTGGCACGTTTTCTAAAAATTGACCTC
TTTTTTGAAGTGGATTGGATAATTTTGTCAGAAATTGTCATAATTTCAGA
AAAGTCTAATGAAATCATTCCAAAAGAATCCGAATCAATTCAAACAAATT
CTCCAATTACGCACAATATAACAAGTGTGAAATATATTCCAACGGATTCG
ACTGCAACTGTTCTAATTCCACAAAATGGCAAAAATAATCATCTAGATAC
AAATAGATCATCTTCATTTACGGCTAGTTCAAGCCTAGGTTTAATTGCAA
CCATTTCAAGCTGTTTTCTTGGATTCGTGTTTTTAATTGCTCTTATTGTT
TTTGGTGTTTTCACTTTACGCCGACATAAAAAACGAACAAAAGGAAAATT
AAGAAACCCAATTTATCAAACCAGAATCAACGGAGGACCTTTTATTGGTG
ACAGCGTTGTCGTTCCCTTAACAGGAGGAACTCAAAGCAGTTCTGGTACA
GGAAGCTTTTATTATAAATACCCAGGCAATGTTGAACTTGGCTTGACCTA
TCCTGTAATGGGAAAAGAATACATGACCCTATCTAGTAAATCAGGAACTG
ATTATGATATGGCGGGAGGAAATAGCCTCGATGGTCTTATACCAACTGGA
ACAAGGGATATTAAATATAATGGAATGAATTCATACGCACCTCCTATGGG
TCAAAATGATTCACCTTATCCTACAAATATTTATTCTAGAAATAGTGCTG
ATGGAAGTACTGGAGGAAGTTCAAATACAGATTACGCTTCTACGTCTTTA
TATCACTTTTCTCAAGTATTCGAAAATGGTTCAAACTTTTATCCGTATAA
TCAACAAAATGTTGGCATGAATAGTTTTGCATTGCACAAAATGAATCCTT
CTGTAATGTCATCGTTAAGTGGATCACCATTTAAAGTGCAAAGTCCAACA
CCGTCAACACAAATTCTGCCACCTAATCAATTGATGGATATGTTTTCTCA
TTATTCGCCGTACCGACAAATCTCGCATCTCAGTCAGTTTAGTCCGACGC
ACAGTACATCTTCCAGATTCTTGATGCCATCTAATGCTGACCTTTATCCA
ACTTCATACGTCGTACCTGTGAATAATTTTCAAACTGATCAGTCAGTTAT
CATGACAAATTCAATGCCATCTTTGCAAGGAATTTCTGGAAATTCTGTCA
TGGTAGCTACAAACGACGCATTTCAACAGCCACCTTCGAATTCCGTGACA
TTAAAGAAATTGCTATCAAATTTAAAAGAATTCCATCAAGAACAAATCGG
TCATGTATCGGTAATTGGAAAAGGTGAAAATGGGACAGTCGGTTATATTA
GCATTGCACAAAATATATCAACCGAACCCAGTAAAACAACTGTTATTTCC
AAATCGTTTTTATACAGATCTTTGAACAATTACAACTCAAAAGATGTCAA
ATATGAAACGATGAAAGAATTAGAGCTTCTGTGCGGAATTAAACATTCAG
TATTTTTGCCGTTAACTGCTTATGTTCTCGATGAACAAAATTCAATGTCA
GTCCATCAAACGGCATTATGTTTTTTATTCGAATTCGATGAACCTTTAGA
GAATCTCCATACTTTTCTGAATCAACATGCAGTGAATAAGGCTGCTATTC
TCAATCTCCCCAGAGGCCCAACTCTCTATTCACAGTCAATTTCAAATATA
TCAGCAAATTCATCATTTAATACCCGTCATTTATATCCCAGCGTTTCATC
TTTATTATTCATAATAACGCAAATTGCTAGAGGAATGAGCTACCTAGAGA
GCCGGCAGATTATACACAGAGATCTGGCAGCCCGAAATTGTTTAATCGGA
CAAAATCTGAAAATAAAAATCACAGATATTGCCATGTCAATTCAGAAATT
CAAAGAGCACTATATTGAATGTGCTGTTGTTGGAATTCAGAAGAATGAAG
ACTGTGATAGTAATTCCTCTATATCTGTTGTGAAAAGATTTTATCCTTTG
CAATGGATGGCGTTTGAGTCAATATTACAGGCGACTTATTCTTGCAAAAC
TGACATTTGGTCTTTTGGAGTAACGATGTGGGAAATTTTGCACAGATGCC
AACAGACTCCATATGGAGGATTTGCTATTTCATTTGATCGAATTCGAGAC
AACGCATATAATTTGTCAATCGGAAACTCTTCGGCAGTATTTCCAAATGA
GAACCTTTATCCCCATCAATCCCAATCGAATTTCCGCCCGTCACAGCATA
TGGCTAATCCATCTAGCTCAATTTTACACGAGAATCTTGGTCTCAGTCGA
GACTTTTCTGATTTAATTCAAGAATGCTGGAACAGAAATCCCCACCAAAG
ACCGACATTTAAATTGATCAGTTCAATTCTGGAACAGAAAATCACAAATT
TTGAATTTGCCAATGATCATTCGAATTTATTTAGCACTATCAACAATTCT
GAGACTTATTGAAACTCTCTTTTACAGAGGAATTTATATAGAATATTTCA
AAAGAAATTATAGAACTTTTTTCTAAGATCAATCTTAGAGTGCCAAAGAA
ACTGTGATTTGGAGTTTTCTTGTTGGAAGAAGAAGAAATATTATGAAGTT
TTTATTTGTGAAAATATTGGATGAATAAAATGCCATGTTTTTTTTATTTC
TCATAAATAAACATAATTTGTCTTTGTAAA
back to top

protein sequence of SMED30034880-orf-1

>SMED30034880-orf-1 ID=SMED30034880-orf-1|Name=SMED30034880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1196bp
MDFFISLSFTTINFSLKMGFFPSLFTFQCLIIICFIDKSSQSGKATFARV
VLNKPDRQLLPEKNLVANLKNESFIASSVWKEIVEFEPHQARMKQMDDPN
LLGHAWCPKQMIKSSPEEWIEIDLGDLKMIKNLATAGRGDGNFAEYAPHF
YLDYQRVSGKWIRYKNQRKEQLLNGNTDARNVAMTNFESMIIARRIRIYP
ISKEKQIRACMRIIIYGCDFDDGVVEYSVSQGHYYTARNGNEKYDLRDLT
YDGVISIDKSNPKGLLEEGLGQLMDNVIYNGVISEDHNNKIRGYHFVGWN
RKFLDSNKVEIVMKFDQMRSVKQIRFYAMNMIPEDIGVFSSAIIHFSRGG
VYYDRISPAYQFKTVIDTRVYYPRWINITLQNVLARFLKIDLFFEVDWII
LSEIVIISEKSNEIIPKESESIQTNSPITHNITSVKYIPTDSTATVLIPQ
NGKNNHLDTNRSSSFTASSSLGLIATISSCFLGFVFLIALIVFGVFTLRR
HKKRTKGKLRNPIYQTRINGGPFIGDSVVVPLTGGTQSSSGTGSFYYKYP
GNVELGLTYPVMGKEYMTLSSKSGTDYDMAGGNSLDGLIPTGTRDIKYNG
MNSYAPPMGQNDSPYPTNIYSRNSADGSTGGSSNTDYASTSLYHFSQVFE
NGSNFYPYNQQNVGMNSFALHKMNPSVMSSLSGSPFKVQSPTPSTQILPP
NQLMDMFSHYSPYRQISHLSQFSPTHSTSSRFLMPSNADLYPTSYVVPVN
NFQTDQSVIMTNSMPSLQGISGNSVMVATNDAFQQPPSNSVTLKKLLSNL
KEFHQEQIGHVSVIGKGENGTVGYISIAQNISTEPSKTTVISKSFLYRSL
NNYNSKDVKYETMKELELLCGIKHSVFLPLTAYVLDEQNSMSVHQTALCF
LFEFDEPLENLHTFLNQHAVNKAAILNLPRGPTLYSQSISNISANSSFNT
RHLYPSVSSLLFIITQIARGMSYLESRQIIHRDLAARNCLIGQNLKIKIT
DIAMSIQKFKEHYIECAVVGIQKNEDCDSNSSISVVKRFYPLQWMAFESI
LQATYSCKTDIWSFGVTMWEILHRCQQTPYGGFAISFDRIRDNAYNLSIG
NSSAVFPNENLYPHQSQSNFRPSQHMANPSSSILHENLGLSRDFSDLIQE
CWNRNPHQRPTFKLISSILEQKITNFEFANDHSNLFSTINNSETY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0018108peptidyl-tyrosine phosphorylation
GO:0006468protein phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000421FA58C
IPR020635Tyr_kinase_cat_dom
IPR008979Galactose-bd-like_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004713protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 808..1169
e-value: 1.1E-22
score: 91.3
IPR000421Coagulation factor 5/8 C-terminal domainSMARTSM00231disc_4coord: 62..218
e-value: 7.9E-6
score: 35.4
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 101..211
e-value: 2.0E-13
score: 50.6
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 58..218
score: 24.586
IPR000421Coagulation factor 5/8 C-terminal domainCDDcd00057FA58Ccoord: 76..217
e-value: 2.81852E-23
score: 95.1116
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 937..1191
e-value: 1.3E-37
score: 130.9
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 223..415
e-value: 4.4E-40
score: 139.2
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 69..1172
NoneNo IPR availablePANTHERPTHR24416:SF515coord: 69..1172
NoneNo IPR availableTMHMMTMhelixcoord: 517..539
NoneNo IPR availableTMHMMTMhelixcoord: 474..496
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 61..222
e-value: 1.7E-34
score: 121.0
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 70..221
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 812..1168
e-value: 4.6E-42
score: 144.1
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 979..991
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 808..1185
score: 25.87
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 782..1167