Rab-like protein 6

Overview
NameRab-like protein 6
Smed IDSMED30034858
Length (bp)2968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rab-like protein 6 (SMED30034858) t-SNE clustered cells

Violin plots show distribution of expression levels for Rab-like protein 6 (SMED30034858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rab-like protein 6 (SMED30034858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rab-like protein 6 (SMED30034858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Rab-like protein 6 vs. Ensembl Human
Match: RABL6 (RAB, member RAS oncogene family like 6 [Source:HGNC Symbol;Acc:HGNC:24703])

HSP 1 Score: 264.618 bits (675), Expect = 7.027e-78
Identity = 127/228 (55.70%), Postives = 167/228 (73.25%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+ +M
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDM 250          
BLAST of Rab-like protein 6 vs. Ensembl Human
Match: RABL6 (RAB, member RAS oncogene family like 6 [Source:HGNC Symbol;Acc:HGNC:24703])

HSP 1 Score: 262.692 bits (670), Expect = 9.424e-77
Identity = 127/228 (55.70%), Postives = 167/228 (73.25%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+ +M
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDM 250          
BLAST of Rab-like protein 6 vs. Ensembl Human
Match: RABL6 (RAB, member RAS oncogene family like 6 [Source:HGNC Symbol;Acc:HGNC:24703])

HSP 1 Score: 268.085 bits (684), Expect = 1.047e-76
Identity = 128/229 (55.90%), Postives = 168/229 (73.36%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSG--LIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++ S   G    +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+ +M
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDSRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDM 251          
BLAST of Rab-like protein 6 vs. Ensembl Human
Match: RABL6 (RAB, member RAS oncogene family like 6 [Source:HGNC Symbol;Acc:HGNC:24703])

HSP 1 Score: 265.388 bits (677), Expect = 1.092e-75
Identity = 127/228 (55.70%), Postives = 167/228 (73.25%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+ +M
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDM 250          
BLAST of Rab-like protein 6 vs. Ensembl Human
Match: RABL6 (RAB, member RAS oncogene family like 6 [Source:HGNC Symbol;Acc:HGNC:24703])

HSP 1 Score: 246.899 bits (629), Expect = 1.321e-73
Identity = 121/220 (55.00%), Postives = 158/220 (71.82%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQ 853
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQ+D  L Q
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQKDVRLAQ 242          
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Match: F08G12.1 (pep chromosome:WBcel235:X:11302074:11305873:-1 gene:WBGene00008585.1 transcript:F08G12.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F08G12.1)

HSP 1 Score: 216.853 bits (551), Expect = 8.678e-60
Identity = 133/288 (46.18%), Postives = 193/288 (67.01%), Query Frame = 2
Query:  116 SIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXX-------XENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVE----SMPSYK-SGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFI 943
            +I K+  G+KE+         K+ V  S ++ +   LQ++F+RGVQYN+KIVIRGDRNVGK+ L  RL+GL F E+Y+ T+EI+VA ++WNY++ DD+VKV+VWD+VD+  KK+    K       ++ ++G D   + C DA F+DVYKG N VI V DITK+WT  YV++E+  VP+ IPVLVLAN RDMG HR +T+ Q  + VE    S PS   S   ++  +SM+  +GL ++H FFNIPFL LQR++L++QL TN++E+  +  EL+  +   ++ YD FI
Sbjct:    4 AIRKKLGGDKEE--------NKSTVMPSGVQRVDAELQRKFARGVQYNLKIVIRGDRNVGKTCLWKRLQGLSFQEEYVATEEIQVANINWNYRATDDVVKVDVWDIVDQSTKKRVKDDKLKLANNGMDKNDGLDYEDTAC-DARFVDVYKGTNGVIFVFDITKTWTWEYVQKEIVKVPNKIPVLVLANRRDMGHHRQVTDLQCSTFVELFNSSHPSPDGSPRARFAPASMRYAFGLKFVHHFFNIPFLCLQRESLIRQLETNKSEIVSSYHELDCYQETPEADYDTFI 282          
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 58.151 bits (139), Expect = 3.595e-9
Identity = 48/206 (23.30%), Postives = 87/206 (42.23%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQ 853
            +K++I GD  VGK++L+ +     FS QY  T  I    +  +   +D  V +++WD                   G++   S+ +       Y+GA+  ++  D+T         SW   ++ +     PD+ P ++L N  D+ S R ++  + QS  ++      G I Y+E S K    +          FL + RD L ++
Sbjct:   10 LKVIILGDSGVGKTSLMNQYVNRRFSNQYKAT--IGADFLTRDVNIDDRTVTLQIWDTA-----------------GQERFQSLGVA-----FYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQT-----KGNIPYYEVSAKEALNV-------EAAFLAIARDALARE 179          
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Match: rab-7 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146])

HSP 1 Score: 58.151 bits (139), Expect = 3.595e-9
Identity = 48/206 (23.30%), Postives = 87/206 (42.23%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQ 853
            +K++I GD  VGK++L+ +     FS QY  T  I    +  +   +D  V +++WD                   G++   S+ +       Y+GA+  ++  D+T         SW   ++ +     PD+ P ++L N  D+ S R ++  + QS  ++      G I Y+E S K    +          FL + RD L ++
Sbjct:   10 LKVIILGDSGVGKTSLMNQYVNRRFSNQYKAT--IGADFLTRDVNIDDRTVTLQIWDTA-----------------GQERFQSLGVA-----FYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFPFVLLGNKVDLESQRAVSSKRAQSWCQT-----KGNIPYYEVSAKEALNV-------EAAFLAIARDALARE 179          
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Match: rab-35 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3])

HSP 1 Score: 53.5286 bits (127), Expect = 1.497e-7
Identity = 45/181 (24.86%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  239 SRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDN---IPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMK 772
            +R   +  K++I GD  VGKS+LL R     FSE YI T  ++      +   N   VK+++WD                   G++   +I         Y+G + V++V D+T   +   V+R LQ + +N   +  +++ N  +    R + E   ++  +SM       I ++E+S K
Sbjct:    4 TRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDI--NGQRVKLQIWDTA-----------------GQERFRTIT-----STYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMN------ISFFETSAK 154          
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 50.8322 bits (120), Expect = 1.026e-6
Identity = 44/180 (24.44%), Postives = 80/180 (44.44%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVP----DNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            Y  K+++ GD  VGKS LL R     ++E YI T  ++  +  +  + K+    +K+++WD                   G++   +I         Y+GA+ +I+V DIT   T N V++ LQ +     +N+  L++ N  D+ + R +     Q     +       I + E+S K+
Sbjct:   10 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT----IKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLG------IPFLETSAKS 157          
BLAST of Rab-like protein 6 vs. Ensembl Fly
Match: RabX2 (gene:FBgn0030200 transcript:FBtr0071448)

HSP 1 Score: 52.7582 bits (125), Expect = 2.387e-7
Identity = 38/153 (24.84%), Postives = 69/153 (45.10%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV----PDNIPVLVLANHRDMGSHRTITEDQ 700
            Y  K+++ GD  VGKS LL R     F+E+Y+ T  I+V        S   ++ ++VWD                        G    ++     Y+ A+ +++V DIT S +   ++  ++ +    PD + VL++ N  D  +HR ++ +Q
Sbjct:    6 YLFKVLVLGDSGVGKSCLLMRFSDDRFTEKYLRTMGIDVKARSVELVSR--VMMLQVWDT----------------------SGDKRFNSLMPSNYRSAHGILLVYDITSSKSFQNIDGWMKEIRRMCPDKVTVLLVGNKSDDPNHRQVSMEQ 134          
BLAST of Rab-like protein 6 vs. Ensembl Fly
Match: Rab7 (gene:FBgn0015795 transcript:FBtr0084503)

HSP 1 Score: 51.6026 bits (122), Expect = 6.707e-7
Identity = 47/181 (25.97%), Postives = 79/181 (43.65%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            +K++I GD +VGK++L+ +     FS QY  T  I           ND +V +++WD                   G++   S  L   F   Y+GA+  ++V D+T         SW   ++ +     PD+ P +VL N  D+  +R ++  + Q   +S        I Y+E+S K G
Sbjct:    9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKAT--IGADFCTKEVVVNDRVVTMQIWDTA-----------------GQERFQS--LGVAF---YRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKND-----IPYYETSAKEG 159          
BLAST of Rab-like protein 6 vs. Ensembl Fly
Match: Rab7 (gene:FBgn0015795 transcript:FBtr0308612)

HSP 1 Score: 51.6026 bits (122), Expect = 6.707e-7
Identity = 47/181 (25.97%), Postives = 79/181 (43.65%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            +K++I GD +VGK++L+ +     FS QY  T  I           ND +V +++WD                   G++   S  L   F   Y+GA+  ++V D+T         SW   ++ +     PD+ P +VL N  D+  +R ++  + Q   +S        I Y+E+S K G
Sbjct:    9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKAT--IGADFCTKEVVVNDRVVTMQIWDTA-----------------GQERFQS--LGVAF---YRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKND-----IPYYETSAKEG 159          
BLAST of Rab-like protein 6 vs. Ensembl Fly
Match: Rab7 (gene:FBgn0015795 transcript:FBtr0308611)

HSP 1 Score: 51.6026 bits (122), Expect = 6.707e-7
Identity = 47/181 (25.97%), Postives = 79/181 (43.65%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            +K++I GD +VGK++L+ +     FS QY  T  I           ND +V +++WD                   G++   S  L   F   Y+GA+  ++V D+T         SW   ++ +     PD+ P +VL N  D+  +R ++  + Q   +S        I Y+E+S K G
Sbjct:    9 LKVIILGDSSVGKTSLMNQYVNKRFSNQYKAT--IGADFCTKEVVVNDRVVTMQIWDTA-----------------GQERFQS--LGVAF---YRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPFVVLGNKVDL-DNRQVSTRRAQQWCQSKND-----IPYYETSAKEG 159          
BLAST of Rab-like protein 6 vs. Ensembl Fly
Match: Rab35 (gene:FBgn0031090 transcript:FBtr0333549)

HSP 1 Score: 48.9062 bits (115), Expect = 5.195e-6
Identity = 51/216 (23.61%), Postives = 90/216 (41.67%), Query Frame = 2
Query:  236 FSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPV---LVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAE 874
             +RG  +  K++I GD  VGKS+LL R     FS  YI T  ++      + +     VK+++WD                   G++   +I         Y+G + VI+V D+T   +   V R L+ + +N  V   +++ N  D    + +  +  Q   + M       I+ +E+S K+   +  +       FL + R  L  +L T+  E
Sbjct:    1 MARGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMR--VKLQIWDTA-----------------GQERFRTIT-----STYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMD------IELFETSAKDNINVENM-------FLSITRQVLDHKLRTSPNE 179          
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Match: rabl6b (RAB, member RAS oncogene family-like 6b [Source:ZFIN;Acc:ZDB-GENE-081104-97])

HSP 1 Score: 239.195 bits (609), Expect = 5.697e-67
Identity = 140/251 (55.78%), Postives = 178/251 (70.92%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXX-XXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFI 943
            + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+ KK S   KLEN+  E     + LDAEFLDVYK  N VI++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR +  D I+  +  +     S  I Y ESSMKNG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ ++    +EL   +   D  YD F+
Sbjct:   24 AGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFQEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGKGKKKSEALKLENEPQEQAESELALDAEFLDVYKNCNGVIMMFDITKQWTYNYILRELPKVPTHVPVCVLGNYRDMGEHRVVLPDDIRDFITGLNRPLGSSYIHYAESSMKNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQNYDIFL 274          
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Match: rabl6b (RAB, member RAS oncogene family-like 6b [Source:ZFIN;Acc:ZDB-GENE-081104-97])

HSP 1 Score: 237.654 bits (605), Expect = 7.898e-66
Identity = 135/250 (54.00%), Postives = 175/250 (70.00%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFI 943
            + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+ KK S      +  ++    + LDAEFLDVYK  N VI++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR +  D I+  +  +     S  I Y ESSMKNG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ ++    +EL   +   D  YD F+
Sbjct:   24 AGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFQEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGKGKKKSEALKLENEPQEAESELALDAEFLDVYKNCNGVIMMFDITKQWTYNYILRELPKVPTHVPVCVLGNYRDMGEHRVVLPDDIRDFITGLNRPLGSSYIHYAESSMKNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQNYDIFL 273          
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Match: rabl6a (RAB, member RAS oncogene family-like 6a [Source:ZFIN;Acc:ZDB-GENE-030131-6174])

HSP 1 Score: 159.844 bits (403), Expect = 1.231e-40
Identity = 84/161 (52.17%), Postives = 105/161 (65.22%), Query Frame = 2
Query:  509 ICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM---PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPKINISQA 982
            + LDAEFLDVYK  N VI++ DITK WT NY+ REL  VP +IPV VL N RDMG HR I  D I+  + S+   P   S  I Y ESSMKNG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ ++    +EL   +   D  YD F+  ++  K   S A
Sbjct:    1 MALDAEFLDVYKNCNGVIMMFDITKQWTFNYILRELPKVPTHIPVCVLGNQRDMGEHRVILPDDIRDFINSLNRPPG--SSYIHYAESSMKNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQNYDIFLEMMEARKAYGSPA 159          
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Match: rabl6b (RAB, member RAS oncogene family-like 6b [Source:ZFIN;Acc:ZDB-GENE-081104-97])

HSP 1 Score: 98.5969 bits (244), Expect = 3.933e-24
Identity = 44/73 (60.27%), Postives = 56/73 (76.71%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVK 415
            + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK   DI K
Sbjct:   24 AGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFQEEYIPTQEIQVTSIHWNYKRLHDIEK 96          
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Match: CABZ01075628.1 (pep chromosome:GRCz11:5:5666864:5669879:-1 gene:ENSDARG00000115005.1 transcript:ENSDART00000191963.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01075628.1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.152e-24
Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDI 409
            + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKSAL  RL+G  F E+YIPT EI+V  +HWNYKS   I
Sbjct:   23 AGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNSGKSALWHRLQGKKFLEEYIPTQEIQVTSIHWNYKSEYQI 93          
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:100135091])

HSP 1 Score: 245.743 bits (626), Expect = 4.031e-72
Identity = 127/244 (52.05%), Postives = 162/244 (66.39%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY-KSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQR------------DTLLKQLATNEAEMCLAS 889
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+ L  RL+G  F E+YIPT EI+V  +HWNYK+ DDIVKVEVWDVVDKG+ KK     L+ +N E     + LDAEF DVY   N VI++ DITK WT  Y+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S  I+Y ESSMKN +GL Y+HKFFNIPFLQLQ             D  L  L TN+ +  LA+
Sbjct:   23 AGLQSMNQTLQRRFAKGVQYNMKIVIRGDRNTGKTTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDIVKVEVWDVVDKGKCKKRGEGSLKLEN-EPQEADMALDAEFPDVYNNCNGVIMMFDITKQWTFTYIMRELPKVPSHVPVCVLGNYRDMGEHRVILPDDVRECIQNLNRRPGSSYIRYAESSMKNSFGLKYLHKFFNIPFLQLQELSVQQETEDQNYDIFLDMLETNKRQASLAA 265          
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:100135091])

HSP 1 Score: 244.973 bits (624), Expect = 1.509e-71
Identity = 127/244 (52.05%), Postives = 162/244 (66.39%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY-KSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQR------------DTLLKQLATNEAEMCLAS 889
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+ L  RL+G  F E+YIPT EI+V  +HWNYK+ DDIVKVEVWDVVDKG+ KK     L+ +N E     + LDAEF DVY   N VI++ DITK WT  Y+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S  I+Y ESSMKN +GL Y+HKFFNIPFLQLQ             D  L  L TN+ +  LA+
Sbjct:   23 AGLQSMNQTLQRRFAKGVQYNMKIVIRGDRNTGKTTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDIVKVEVWDVVDKGKCKKRGEGSLKLEN-EPQEADMALDAEFPDVYNNCNGVIMMFDITKQWTFTYIMRELPKVPSHVPVCVLGNYRDMGEHRVILPDDVRECIQNLNRRPGSSYIRYAESSMKNSFGLKYLHKFFNIPFLQLQELSVQQETEDQNYDIFLDMLETNKRQASLAA 265          
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:100135091])

HSP 1 Score: 240.736 bits (613), Expect = 2.403e-69
Identity = 119/213 (55.87%), Postives = 151/213 (70.89%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY-KSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQ 832
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+ L  RL+G  F E+YIPT EI+V  +HWNYK+ DDIVKVEVWDVVDKG+ KK     L+ +N       + LDAEF DVY   N VI++ DITK WT  Y+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S  I+Y ESSMKN +GL Y+HKFFNIPFLQLQ
Sbjct:   23 AGLQSMNQTLQRRFAKGVQYNMKIVIRGDRNTGKTTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDIVKVEVWDVVDKGKCKKRGEGSLKLENEPQEEADMALDAEFPDVYNNCNGVIMMFDITKQWTFTYIMRELPKVPSHVPVCVLGNYRDMGEHRVILPDDVRECIQNLNRRPGSSYIRYAESSMKNSFGLKYLHKFFNIPFLQLQ 235          
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:100135091])

HSP 1 Score: 239.58 bits (610), Expect = 4.775e-69
Identity = 119/213 (55.87%), Postives = 151/213 (70.89%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY-KSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQ 832
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+ L  RL+G  F E+YIPT EI+V  +HWNYK+ DDIVKVEVWDVVDKG+ KK     L+ +N       + LDAEF DVY   N VI++ DITK WT  Y+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S  I+Y ESSMKN +GL Y+HKFFNIPFLQLQ
Sbjct:   23 AGLQSMNQTLQRRFAKGVQYNMKIVIRGDRNTGKTTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDIVKVEVWDVVDKGKCKKRGEGSLKLENEPQEEADMALDAEFPDVYNNCNGVIMMFDITKQWTFTYIMRELPKVPSHVPVCVLGNYRDMGEHRVILPDDVRECIQNLNRRPGSSYIRYAESSMKNSFGLKYLHKFFNIPFLQLQ 235          
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 50.8322 bits (120), Expect = 2.441e-6
Identity = 42/180 (23.33%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV----PDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            Y  K+++ GD  VGKS LL R     ++E YI T  ++  +  +  + K+    +K+++WD                   G++   +I         Y+GA+ +I+V D+T   + N V++ LQ +     +N+  L++ N  D+ + + +     +   +S+       I + E+S KN
Sbjct:   11 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT----IKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLG------IPFLETSAKN 158          
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Match: Rabl6 (RAB, member RAS oncogene family-like 6 [Source:MGI Symbol;Acc:MGI:2442633])

HSP 1 Score: 235.728 bits (600), Expect = 2.418e-65
Identity = 128/225 (56.89%), Postives = 164/225 (72.89%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYK-SGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNE 868
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NYV REL  VP ++PV VL N+RDMG HR I  D ++  +E +     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNCNGVVMMFDITKQWTFNYVLRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQ 247          
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Match: Rab17 (RAB17, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:104640])

HSP 1 Score: 57.7658 bits (138), Expect = 1.037e-8
Identity = 59/215 (27.44%), Postives = 91/215 (42.33%), Query Frame = 2
Query:  227 QKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWN--YKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDT 841
            Q   + G  Y  K+V+ G  +VGK++L  R    DFS   +PT    V C  +          +K+E+WD                   G++   S+C        ++GANA ++V DIT+         W L  +E+E Q  P  + V+++ N  D+G  R +T  + +   ES    KS L  + E+S K  Y +  I        LQ   DT
Sbjct:    9 QASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS-NVLPT----VGCAFFTKVLDLGSSSLKLEIWDTA-----------------GQEKYQSVC-----HLYFRGANAALLVYDITRKDSFHKAQQW-LEDLEKEFQ--PGEVVVMLVGNKTDLGEEREVTFQEGKEFAES----KSLL--FMETSAKLNYQVSEIFNTVAQELLQRAGDT 187          
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Match: Rab17 (RAB17, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:104640])

HSP 1 Score: 57.7658 bits (138), Expect = 1.037e-8
Identity = 59/215 (27.44%), Postives = 91/215 (42.33%), Query Frame = 2
Query:  227 QKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWN--YKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDT 841
            Q   + G  Y  K+V+ G  +VGK++L  R    DFS   +PT    V C  +          +K+E+WD                   G++   S+C        ++GANA ++V DIT+         W L  +E+E Q  P  + V+++ N  D+G  R +T  + +   ES    KS L  + E+S K  Y +  I        LQ   DT
Sbjct:    9 QASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS-NVLPT----VGCAFFTKVLDLGSSSLKLEIWDTA-----------------GQEKYQSVC-----HLYFRGANAALLVYDITRKDSFHKAQQW-LEDLEKEFQ--PGEVVVMLVGNKTDLGEEREVTFQEGKEFAES----KSLL--FMETSAKLNYQVSEIFNTVAQELLQRAGDT 187          
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Match: Rab17 (RAB17, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:104640])

HSP 1 Score: 53.5286 bits (127), Expect = 7.032e-8
Identity = 45/165 (27.27%), Postives = 72/165 (43.64%), Query Frame = 2
Query:  227 QKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWN--YKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTIT 691
            Q   + G  Y  K+V+ G  +VGK++L  R    DFS   +PT    V C  +          +K+E+WD                   G++   S+C        ++GANA ++V DIT+         W L  +E+E Q  P  + V+++ N  D+G  R +T
Sbjct:    9 QASTASGQPYVSKLVLLGSSSVGKTSLALRYMKQDFS-NVLPT----VGCAFFTKVLDLGSSSLKLEIWDTA-----------------GQEKYQSVC-----HLYFRGANAALLVYDITRKDSFHKAQQW-LEDLEKEFQ--PGEVVVMLVGNKTDLGEEREVT 143          
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 52.373 bits (124), Expect = 5.727e-7
Identity = 47/201 (23.38%), Postives = 86/201 (42.79%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDN----IPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLK 850
             K+++ GD  VGK+ L+ R    +F+  YI T  I+      + +     +K++VWD                   G++   +I         Y+GA  +I+V DIT   +   ++  ++ + +N    +  L+L N  DM + R +  +Q + L           I+++E+S K+   +       +  F  L RD LLK
Sbjct:    9 FKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKR--IKLQVWDTA-----------------GQERFKTITTA-----YYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHR------IRFFETSAKSSVNV-------DEAFSSLARDILLK 172          
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Match: sp|Q3YEC7|RABL6_HUMAN (Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2)

HSP 1 Score: 265.388 bits (677), Expect = 5.242e-75
Identity = 127/228 (55.70%), Postives = 167/228 (73.25%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DDIVKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++  ++++     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+ +M
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDM 250          
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Match: sp|Q5U3K5|RABL6_MOUSE (Rab-like protein 6 OS=Mus musculus OX=10090 GN=Rabl6 PE=1 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 1.691e-64
Identity = 128/225 (56.89%), Postives = 164/225 (72.89%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYK-SGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNE 868
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NYV REL  VP ++PV VL N+RDMG HR I  D ++  +E +     S   +Y ESSMKN +GL Y+HKFFNIPFLQLQR+TLL+QL TN+
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGKCKKRGDGLKTENDPQEAESELALDAEFLDVYKNCNGVVMMFDITKQWTFNYVLRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIEHLDRPPGSSYFRYAESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQ 247          
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Match: sp|Q08DA0|RABL6_BOVIN (Rab-like protein 6 OS=Bos taurus OX=9913 GN=RABL6 PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 4.767e-63
Identity = 130/254 (51.18%), Postives = 178/254 (70.08%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLK 955
            + ++S+   LQ+RF++GVQYNMKIVIRGDRN GK+AL  RL+G  F E+YIPT EI+V  +HW+YK+ DD+VKVEVWDVVDKG+ KK        ++ ++    + LDAEFLDVYK  N V+++ DITK WT NY+ REL  VP ++PV VL N+RDMG HR I  D ++ +++ +     S   +Y ESSMKN +GL Y+H+FFNIPFLQLQR+TLL+QL TN+ ++    +EL   +   D  YD F+  ++
Sbjct:   23 AGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGKKFVEEYIPTQEIQVTSIHWSYKTTDDVVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNCNGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDVLDHLDRPPGSSYFRYAESSMKNSFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELSVQQETEDQNYDIFLEMME 276          
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Match: sp|P34143|RABC_DICDI (Ras-related protein RabC OS=Dictyostelium discoideum OX=44689 GN=rabC PE=2 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 2.795e-9
Identity = 48/182 (26.37%), Postives = 83/182 (45.60%), Query Frame = 2
Query:  263 KIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDIT--KSW--TLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYI 796
            KI++ G+  VGKS++L R     FS+ + PT  ++        K     VK+++WD                   G++   SI         Y+G++ VI+V D+T  KS+    N+VE   Q   D + ++++ N  DM + R +T +Q Q + E + +      K+ E S K   G+  +
Sbjct:    8 KIILVGESGVGKSSILVRFTDNTFSQHFAPTLGVDFNVKTIRNKETGQTVKLQLWDTA-----------------GQERFKSIT-----QTFYRGSHGVIVVYDVTDPKSFERCKNWVEDINQYTQDGMIIILVGNKSDMVAQRKVTFEQGQEMAEQLKT------KFLEVSAKENNGVTQV 161          
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Match: sp|Q9S810|RAA1I_ARATH (Ras-related protein RABA1i OS=Arabidopsis thaliana OX=3702 GN=RABA1I PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 7.118e-9
Identity = 45/164 (27.44%), Postives = 76/164 (46.34%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPD----NIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY 733
            Y  K+V+ GD  VGKS LL+R    DFS     T  +E A    + + +D IVK ++WD                   G++   +I         Y+GA   ++V D+T+  T   VER L+ + D    NI ++++ N  D+   R I+ ++ ++  E   ++
Sbjct:   12 YLFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRATIGVEFAT--RSIQCDDKIVKAQIWDTA-----------------GQERYRAITSA-----YYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLRHLRAISTEEAKAFAERENTF 151          
BLAST of Rab-like protein 6 vs. TrEMBL
Match: T1G004 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20214402 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.915e-83
Identity = 131/225 (58.22%), Postives = 172/225 (76.44%), Query Frame = 2
Query:  203 IKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            ++++G +LQ +F RG+ YNMKI+IRGDRNVGK+ L  RL+G  F E+Y+PTDEI+VA + WNYK++DDI+KVEVWDVVDKGRKK+              P   CLDAEF+DVYKG + VI+VLDITK WT +YVE+E+  +P   P+L+LANHRDMG HRT++EDQ+++ VESM   + G I+Y ESSM+NG+GL YIHKFFN+PFL LQR TL+ QL  N+ ++
Sbjct:    1 MQTMGASLQSKFGRGINYNMKIIIRGDRNVGKTCLHLRLQGQKFREEYLPTDEIQVASIQWNYKTSDDIIKVEVWDVVDKGRKKRKIEGLKLEQQA--VPDETCLDAEFVDVYKGTHGVIMVLDITKQWTFDYVEKEVPKIPSGTPILILANHRDMGHHRTVSEDQVKTFVESMQEMREGSIQYAESSMRNGFGLKYIHKFFNLPFLHLQRLTLVSQLEKNKEDI 223          
BLAST of Rab-like protein 6 vs. TrEMBL
Match: V9IGB6 (Putative GTP-binding protein Parf OS=Apis cerana OX=7461 GN=ACCB07314 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.738e-83
Identity = 150/281 (53.38%), Postives = 200/281 (71.17%), Query Frame = 2
Query:  113 MSIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDX-XXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTL 952
             S FKR  G+ + + N+ P+   AH      +S+   LQ++F++GVQYNMKI+I+GDRNVGK+ L  RL+G  F E+YIPT+EI+V  + WNYK+ DDIVKVEVWDVVDK  R+KK  GLK++N   E+      LDAEFLDVYKG N VII++DITKSWT +YV+REL  +P +IPV+VL NH DM  HRT+T D +   ++S+   ++  ++Y ESSM+NG+GL  +HKFFN+PFLQLQR+TLLKQL TNE E  L  QEL+  +   D+ Y+ F+  L
Sbjct:    2 FSAFKRLAGKSDGVGNISPR--PAH------QSMPTTLQRKFAKGVQYNMKIIIKGDRNVGKTCLFHRLQGQKFIEEYIPTEEIQVTSIQWNYKATDDIVKVEVWDVVDKGRRRKKLEGLKMDNSQSENVIEEPALDAEFLDVYKGTNGVIIMMDITKSWTFDYVQRELPKIPSHIPVIVLGNHCDMAHHRTVTSDHVTYFIDSLHE-RAAQVRYAESSMRNGFGLKLLHKFFNLPFLQLQRETLLKQLETNEEETRLTIQELDLFQDSDDANYNKFLDNL 273          
BLAST of Rab-like protein 6 vs. TrEMBL
Match: T1K7M9 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107361124 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 4.103e-83
Identity = 145/297 (48.82%), Postives = 206/297 (69.36%), Query Frame = 2
Query:  116 SIFKRFFGEKEDINNVQPQVFKAH--VNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNP-------GSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYK-SGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPKINIS 976
            S  KR  G + D       VF  +     ++++ +G +LQ++F++GVQYNMKI+I+GDRNVGK+ L  RL+G  F E+Y PT+EI+VA +HWNYK+ DD+VKVEVWD+VDKG+K+        N++    P         + LDAEF+DVYKG N VI++LD+TK+WTL+YV+REL  VP NIPVLVL+NHRDMG HR ++EDQ++  ++ +   + SG ++Y E+SM+NG+GL ++HKFFN+PFL LQR+TLLKQL TN  E+    QEL+ L+   +  YD F+  L + +  I+
Sbjct:    3 SALKRLVGNQNDNKTGPDDVFNQNNCPRRNSVQPMGHHLQRKFAKGVQYNMKIIIKGDRNVGKTCLFMRLQGQKFIEEYTPTEEIQVASIHWNYKATDDVVKVEVWDIVDKGKKRPQIDGLKLNNDKPTLPPKESETAAELALDAEFIDVYKGTNGVIMMLDMTKAWTLDYVQRELPKVPSNIPVLVLSNHRDMGHHRAVSEDQVRMFIDGLQRTEGSGQVRYAEASMRNGFGLKFLHKFFNLPFLHLQRETLLKQLETNSLEINATCQELDILQEADEQDYDKFLDMLTNKRRQIA 299          
BLAST of Rab-like protein 6 vs. TrEMBL
Match: A0A443SP37 (Rab-like protein 6 isoform X1 OS=Leptotrombidium deliense OX=299467 GN=B4U80_09134 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.924e-82
Identity = 158/297 (53.20%), Postives = 210/297 (70.71%), Query Frame = 2
Query:  113 MSIFKRFFGEKEDINNVQPQVF--KAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXX-XXXXXXENDNGEDN-----PGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMP-SYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPKINIS 976
             S FKRF G + +  NV  +    K     S ++ +   LQ++F++GVQYNMKI+I+GDRNVGKS L  RL+G  F E+Y+PTDEI+VA + WNYK+ DDIVKVEVWD+VDKG+K+K   GLKL+N   + N          LDAEF+DVYKG N VI++LD+TK+WT +YV+REL  VP NIPVLVLANHRDMG HR ++EDQI++ +ES+  S  +G I+Y ESSM+NG+GL ++HKFFN+PFL LQR+TLLKQL TN  E+     EL+ L+   D  YD F++ +   +  I+
Sbjct:    2 FSAFKRFVGNQNEPKNVTEEGGNQKTCRKPSGVQPMDVYLQRKFAKGVQYNMKIIIKGDRNVGKSCLFLRLQGDRFKEEYVPTDEIQVASIQWNYKATDDIVKVEVWDIVDKGKKRKPVEGLKLDNKCAKKNLPPEEEYDHALDAEFIDVYKGTNGVIMMLDMTKAWTFDYVQRELPKVPSNIPVLVLANHRDMGHHRAVSEDQIKTFIESLSRSEGAGQIRYAESSMRNGFGLKFLHKFFNLPFLHLQRETLLKQLETNCQEIHSTCIELDLLQESDDQNYDRFLNIITDKRRQIA 298          
BLAST of Rab-like protein 6 vs. TrEMBL
Match: A0A2L2Y3V5 (Rab-like protein 1 OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.724e-81
Identity = 147/261 (56.32%), Postives = 193/261 (73.95%), Query Frame = 2
Query:  203 IKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVV-DXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYK-SGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPKINISQ 979
            ++++G NLQ++F++GVQYNMKI+I+GDRNVGKS L  RL+G  F E+Y+PT+EI+VA + WNYK+ DDIVKVEVWDVV    +KKK  GLKL+N   E  P    LDAEF+DVYKG N VI+VLDITK WT  YV+REL  VP +IPVLVLANHRDMG HRT+TEDQ++  +E +   + S  I+Y E SM+NG+GL Y+HKFFN+PFLQLQ++TLLKQL  N  E+    +EL+ L    +  YD F+  L + +  +++
Sbjct:   24 VQAMGLNLQRKFAKGVQYNMKIIIKGDRNVGKSCLFERLQGKKFVEEYLPTEEIQVASIQWNYKATDDIVKVEVWDVVDKGKKKKKIDGLKLDNKVTEQVPEEAALDAEFIDVYKGTNGVIMVLDITKQWTFAYVQRELPLVPHHIPVLVLANHRDMGHHRTVTEDQVKFFIEGLERPRDSAQIRYAEGSMRNGFGLKYLHKFFNLPFLQLQKETLLKQLEINNNEIQATVEELDCLSESEEQNYDVFLDNLTNRRRQVAE 284          
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Match: rabl6a (RAB, member RAS oncogene family-like 6a [Source:ZFIN;Acc:ZDB-GENE-030131-6174])

HSP 1 Score: 238.424 bits (607), Expect = 2.400e-66
Identity = 139/259 (53.67%), Postives = 180/259 (69.50%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM---PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPK 964
            + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKSAL  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+ KK        +  +++   + LDAEFLDVYK  N VI++ DITK WT NY+ REL  VP ++PV VL N RDMG HR I  D I+  + ++   P   S  I Y ESSMKNG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ ++    +EL   +   D  YD FI  ++  K
Sbjct:   23 AGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSALWHRLQGKKFIEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGKGKKRGENLKLENEPQESETEMALDAEFLDVYKNCNGVIMMFDITKQWTFNYIMRELPKVPTHVPVCVLGNQRDMGEHRVILPDDIRDFINNLNRPPG--SSYIHYAESSMKNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDIDATLEELNVQQETEDQNYDIFIDMMEARK 279          
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Match: rabl6b (RAB, member RAS oncogene family-like 6b [Source:ZFIN;Acc:ZDB-GENE-081104-97])

HSP 1 Score: 224.557 bits (571), Expect = 9.892e-62
Identity = 133/253 (52.57%), Postives = 169/253 (66.80%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTL 952
            + ++S+  +LQ+RF++  + N  IVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG  KK   +    +  E     I LDAEFLDVYK  N VI++ DITK WT +Y+ REL  VP ++PV VL NHRDMG HR I  D I+  +  M     S  I Y ESSMKNG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ +M    +EL   +   D  YD F+  +
Sbjct:   24 AGLQSMNQSLQRRFAK--ESNTTIVIRGDRNTGKSTLWQRLQGGKFQEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGELKKLISVSGVINTAE---SEIALDAEFLDVYKNCNGVIMMFDITKQWTYSYILRELPRVPTHVPVCVLGNHRDMGEHRVILPDDIRDFISGMNRPLGSSYIHYAESSMKNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDMDATLEELTVQQETEDQNYDIFLEMM 271          
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:103045400])

HSP 1 Score: 52.7582 bits (125), Expect = 3.331e-7
Identity = 46/179 (25.70%), Postives = 79/179 (44.13%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVP----DNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            Y  K+++ GD  VGKS LL R     ++E YI T  I V       + +  IVK+++WD                   G++   +I         Y+GA+ +IIV D+T   + N +++ L+ +     +N+  L++ N  D+ S + +     +   E +       I + ESS KN 
Sbjct:    7 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYIST--IGVDFKIRTIEMDGKIVKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIIVYDVTDQESFNNLKQWLEEIDRYACENVSKLLVGNKSDLTSKKVVDFTTAKEFAEPLK------IPFLESSAKNA 155          
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Match: rab1ba (zRAB1B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-873])

HSP 1 Score: 52.7582 bits (125), Expect = 4.640e-7
Identity = 48/201 (23.88%), Postives = 90/201 (44.78%), Query Frame = 2
Query:  191 NNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV----PDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            + S I S G +     SR   Y  K+++ GD  VGKS LL R     ++E YI T  ++  +  +  + K+    +K+++WD                   G++   +I         Y+GA+ +I+V D+T   + N V++ LQ +     +N+  L++ N  D+ + + +     +   +S+       I + E+S KN
Sbjct:    7 HESRIVSSGASFLLLDSRKHDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT----IKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIVVYDVTDQESYNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLA------IPFLETSAKN 175          
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Match: rab25a (RAB25, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-041212-69])

HSP 1 Score: 52.373 bits (124), Expect = 4.912e-7
Identity = 42/163 (25.77%), Postives = 72/163 (44.17%), Query Frame = 2
Query:  245 GVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPD----NIPVLVLANHRDMGSHRTITEDQIQSLVES 721
            G  +  K+V+ G+  VGKS LL+R    +F+     T  +E +      + +   +K ++WD     R +  +                         Y+GA   ++V DITK  T  YVER L+ + D    ++ V+++ N  D+   RTI  ++ +S  ES
Sbjct:    8 GYNFVFKVVLIGESGVGKSNLLSRFTKNEFNHDSRTTIGVEFST--RTIQLDTVTIKAQIWDTAGLERYRAITSAY----------------------YRGAVGALLVYDITKHLTYEYVERWLKELYDHADPHMVVMLVGNKSDLDMQRTIPTEEAKSFAES 146          
BLAST of Rab-like protein 6 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 50.447 bits (119), Expect = 3.583e-7
Identity = 42/180 (23.33%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV----PDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            Y  K+++ GD  VGKS LL R     ++E YI T  ++  +  +  + K+    +K+++WD                   G++   +I         Y+GA+ +I+V D+T   + N V++ LQ +     +N+  L++ N  D+ + + +     +   +S+       I + E+S KN
Sbjct:   10 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT----IKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLE------IPFLETSAKN 157          
BLAST of Rab-like protein 6 vs. Ensembl Sea Lamprey
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 50.447 bits (119), Expect = 4.390e-7
Identity = 40/155 (25.81%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  266 IVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPD----NIPVLVLANHRDMGSHRTITEDQIQSLVE 718
            +V+ GD  VGKS LL+R    +F+ +   T  +E A    + + +   +K ++WD                   G++   +I         Y+GA   ++V DI K  T   VER L+ + D    NI ++++ N  D+   R +T D+ ++  E
Sbjct:    1 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT--RSIQVDGKTIKAQIWDTA-----------------GQERYRAITSA-----YYRGAYGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVTTDEAKAFAE 131          
BLAST of Rab-like protein 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006572.1 (pep scaffold:Pmarinus_7.0:GL495441:238:797:1 gene:ENSPMAG00000005938.1 transcript:ENSPMAT00000006572.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 4.594e-6
Identity = 46/179 (25.70%), Postives = 77/179 (43.02%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWT----LNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            Y  K++I GD  VGKS LLAR+   +F         I V    +  K  + IVK+++WD                        GSI         Y+GA+ V +  DIT+  T    +++++   Q    +I + ++ N  D+   R +T ++    +E    Y   + K++E+S K G
Sbjct:    2 YLFKLIIIGDTGVGKSCLLARIMDNEFKIT------IGVEFGSFVIKMEEKIVKLQIWD----------------------TAGSITRI-----FYRGAHCVFLTYDITRDDTFVNVIDWLKEIKQHANSDIVIYLIGNRCDLEDDREVTRER---AIEFCKQY--SIDKFFETSAKTG 142          
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 51.6026 bits (122), Expect = 1.355e-7
Identity = 50/178 (28.09%), Postives = 79/178 (44.38%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV----PDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            MKI++ GD  VGKS LL R     F+  +I T  I+  +  V  N K     VK+++WD                   G++   +I         Y+GA  +I+V D+T   T   +++  + V     D   +L++ N  DM   R +T DQ ++L + +       I + ESS KN
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKK----VKLQLWDTA-----------------GQERFRTITTA-----YYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELG------IPFIESSAKN 165          
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Match: YPT7 (Rab family GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); interacts with the cargo selection/retromer complex for retrograde sorting; similar to mammalian Rab7 [Source:SGD;Acc:S000004460])

HSP 1 Score: 49.6766 bits (117), Expect = 4.436e-7
Identity = 51/220 (23.18%), Postives = 89/220 (40.45%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQY-------IPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDIT--------KSWTLNYVERELQGVPDNIPVLVLANHRDM-GSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEA 871
            +K++I GD  VGK++L+ R     +S+QY         T E+ V          D +  ++VWD                   G++   S+ +       Y+GA+  ++V D+T        KSW   ++       P+  P ++L N  D   S + ++E   Q L +S+     G I  + +S KN   +       +  F ++ R  L +  A  EA
Sbjct:    9 LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV--------DGDKVATMQVWDTA-----------------GQERFQSLGVA-----FYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSL-----GDIPLFLTSAKNAINV-------DTAFEEIARSALQQNQADTEA 186          
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Match: GSP1 (Ran GTPase; GTP binding protein (mammalian Ranp homolog) involved in the maintenance of nuclear organization, RNA processing and transport; regulated by Srm1p, Rna1p, Yrb1p, Yrb2p, Yrp4p, Yrb30p, Cse1p and Kap95p; GSP1 has a paralog, GSP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004284])

HSP 1 Score: 49.6766 bits (117), Expect = 5.450e-7
Identity = 47/196 (23.98%), Postives = 89/196 (45.41%), Query Frame = 2
Query:  257 NMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYV---ERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQR 835
              K+V+ GD   GK+  + R    +F ++YI T  +EV  +  ++ +N   +K +VWD                   G++  G +  D  +++    A   II+ D+T   T   V    R+L  V +NIP+++  N  D      + E ++++  +++  ++   ++Y++ S K+ Y        F  PFL L R
Sbjct:   12 TFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPL--SFYTNFGEIKFDVWDTA-----------------GQEKFGGL-RDGYYIN----AQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVD------VKERKVKA--KTITFHRKKNLQYYDISAKSNYN-------FEKPFLWLAR 168          
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Match: GSP2 (GTP binding protein (mammalian Ranp homolog); involved in the maintenance of nuclear organization, RNA processing and transport; interacts with Kap121p, Kap123p and Pdr6p (karyophilin betas); not required for viability; protein abundance increases in response to DNA replication stress; GSP2 has a paralog, GSP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005711])

HSP 1 Score: 49.6766 bits (117), Expect = 5.667e-7
Identity = 47/196 (23.98%), Postives = 89/196 (45.41%), Query Frame = 2
Query:  257 NMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYV---ERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQR 835
              K+V+ GD   GK+  + R    +F ++YI T  +EV  +  ++ +N   +K +VWD                   G++  G +  D  +++    A   II+ D+T   T   V    R+L  V +NIP+++  N  D      + E ++++  +++  ++   ++Y++ S K+ Y        F  PFL L R
Sbjct:   13 TFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPL--SFYTNFGEIKFDVWDTA-----------------GQEKFGGL-RDGYYIN----AQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVD------VKERKVKA--KTITFHRKKNLQYYDISAKSNYN-------FEKPFLWLAR 169          
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 48.9062 bits (115), Expect = 8.471e-7
Identity = 45/181 (24.86%), Postives = 82/181 (45.30%), Query Frame = 2
Query:  257 NMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTL----NYVERELQGVPDNIPVLVLANHRDM---GSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            ++K+V+ G+  VGKS+++ R    DF+E   PT  I  A +      N+  VK E+WD                   G++   S+         Y+ A A ++V D+TK  +     ++V+   +    +I + ++ N  DM   G  R +  ++ + L E     + GL+ ++E+S K G
Sbjct:    7 SIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPT--IGAAFLTQRVTINEHTVKFEIWDTA-----------------GQERFASLA-----PMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAE-----EKGLL-FFETSAKTG 157          
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Match: EDO36925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHA4])

HSP 1 Score: 248.825 bits (634), Expect = 1.160e-75
Identity = 122/228 (53.51%), Postives = 164/228 (71.93%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPS-YKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEM 877
            S +K++G  LQ++F+RGV YNMKIVI+GDRN GK+ +  RL G  F+EQYIPT+EI+V  + W+Y++ DD+VKV++WD+VD   K K +   L+ +N ED+ G+  LDA F+DVYKG + V+++LDITK WT  YV REL  VP +IPVLVLAN RDM  HR +  ++I S + S+    +S  I Y ESSMKNG+GL YIH F + PFL LQR+TLL+QL  N  +M
Sbjct:   22 SGVKAMGQALQRKFARGVHYNMKIVIKGDRNTGKTCMFHRLHGKPFNEQYIPTNEIQVGSIQWSYRATDDVVKVDIWDIVD-VGKSKKARDSLKFENDEDDDGNAVLDAGFVDVYKGTHGVLMLLDITKPWTFTYVRRELPKVPPHIPVLVLANRRDMEEHRLVDAEEITSFINSLERPDRSPPIHYAESSMKNGFGLKYIHTFLSFPFLMLQRETLLQQLQVNAVDM 248          
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Match: EDO29122 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4J1])

HSP 1 Score: 126.331 bits (316), Expect = 4.070e-34
Identity = 63/114 (55.26%), Postives = 79/114 (69.30%), Query Frame = 2
Query:  494 DNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSY-KSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQ 832
            D+ G+  LDA F+DVYKG + V+++LDITK WT  YV REL  VP +IPVLVLAN RDM  HR +  ++I S + S+    +S  I Y ESSMKNG+GL YIH F + PFL LQ
Sbjct:    2 DDDGNAVLDAGFVDVYKGTHGVLMLLDITKPWTFTYVRRELPKVPPHIPVLVLANRRDMEEHRLVDAEEITSFINSLERPDRSPPIHYAESSMKNGFGLKYIHTFLSFPFLMLQ 115          
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Match: EDO38178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK4])

HSP 1 Score: 82.8037 bits (203), Expect = 2.644e-19
Identity = 37/61 (60.66%), Postives = 49/61 (80.33%), Query Frame = 2
Query:  197 SNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACV 379
            S +K++G  LQ++F+RGV YNMKIVI+GDRN GK+ +  RL G  F+EQYIPT+EI+V CV
Sbjct:   22 SGVKAMGQALQRKFARGVHYNMKIVIKGDRNTGKTCMFHRLHGKPFNEQYIPTNEIQV-CV 81          
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Match: EDO44462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW7])

HSP 1 Score: 52.7582 bits (125), Expect = 8.710e-8
Identity = 50/196 (25.51%), Postives = 80/196 (40.82%), Query Frame = 2
Query:  257 NMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHW--NYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVES--MPSYKSGLIKYWESSMKNGYGLIYIHKFF 808
              KI+I GD NVGK+ L  RL    F E+     E  +    W  + + N + VK+++WD   + R                    +C        Y+  NAV+ + DIT+        +W + Y      G   ++P +++ N  D+G  RT++ +  +   +S  MP         WE S+KN   L  I   F
Sbjct:    3 TFKIIIIGDSNVGKTCLAYRLCTGKFPER----TETTIGVDFWEKSLELNGEFVKLQLWDTAGQERF---------------RKSMVC------HYYRNVNAVVFMYDITRKCSFEALTTWIVEYRHHAYSG---DVPKILIGNKCDLGLERTVSSNIARKFADSHNMP--------LWEISIKNDAELEQIEAIF 162          
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Match: EDO40409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D9])

HSP 1 Score: 50.447 bits (119), Expect = 7.307e-7
Identity = 47/180 (26.11%), Postives = 77/180 (42.78%), Query Frame = 2
Query:  263 KIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGV-----PDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGL 787
            KI I GD  VGKS + A L G  FS  Y+ T E  +A    +   N    K+++WD                       PG+           +    VI+V D++   T   V   ++ +      D++P++V+AN  D   +R + E+Q+Q L       + GL+ + E+S K+G  +
Sbjct:   11 KIAIVGDSGVGKSTIFALLTGERFSSYYVKTKERAIATKLVSL-PNGTQEKLQLWDT----------------------PGADETRTYTSHSIRDVKGVILVFDVSNEDTYLNVNNWIEVINTYSNEDSVPIIVIANKIDKVRNRKVKEEQVQQL-----GIQKGLL-FLETSAKSGLNI 161          
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Match: rabl6b (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:101159360])

HSP 1 Score: 239.58 bits (610), Expect = 1.163e-66
Identity = 131/271 (48.34%), Postives = 174/271 (64.21%), Query Frame = 2
Query:  164 QPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYK------SNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLK 955
            +P   +     + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK      ++D +       V     K++   LKLEN+  E +   + LDAEFLDVYK  N VI++ DITK WT +Y+ REL  VP ++PV VL NHRDMG HR I  D I+ L+  +     S  I Y ESSM+NG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ +M    +EL   +   D  YD F+  L+
Sbjct:   12 EPGQLREKTIPAGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKMAPYQATDDVVKVEVWDVVDKGKGKRRGDNLKLENEPQESD--EVALDAEFLDVYKNCNGVIMMFDITKQWTFSYIMRELPKVPTHVPVCVLGNHRDMGEHRVILPDDIRDLIAGLNRPMGSSYIHYAESSMRNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYDIFLENLE 280          
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Match: rabl6b (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:101159360])

HSP 1 Score: 239.195 bits (609), Expect = 1.839e-66
Identity = 139/274 (50.73%), Postives = 179/274 (65.33%), Query Frame = 2
Query:  164 QPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDN---------PGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLK 955
            +P   +     + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK+ DD+VKVEVWDVVDKG+K        +     DN            + LDAEFLDVYK  N VI++ DITK WT +Y+ REL  VP ++PV VL NHRDMG HR I  D I+ L+  +     S  I Y ESSM+NG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ +M    +EL   +   D  YD F+  L+
Sbjct:   12 EPGQLREKTIPAGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKTTDDVVKVEVWDVVDKGQKHLFPEGVGKGKRRGDNLKLENEPQESDEVALDAEFLDVYKNCNGVIMMFDITKQWTFSYIMRELPKVPTHVPVCVLGNHRDMGEHRVILPDDIRDLIAGLNRPMGSSYIHYAESSMRNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYDIFLENLE 285          
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Match: rabl6b (RAB, member RAS oncogene family like 6 [Source:NCBI gene;Acc:101159360])

HSP 1 Score: 237.269 bits (604), Expect = 7.109e-66
Identity = 131/279 (46.95%), Postives = 174/279 (62.37%), Query Frame = 2
Query:  164 QPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYK--------------SNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESM-PSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLK 955
            +P   +     + ++S+  +LQ+RF++GVQYNMKIVIRGDRN GKS L  RL+G  F E+YIPT EI+V  +HWNYK                D + K +     +   K++   LKLEN+  E +   + LDAEFLDVYK  N VI++ DITK WT +Y+ REL  VP ++PV VL NHRDMG HR I  D I+ L+  +     S  I Y ESSM+NG+GL Y+H+FFNIPFLQLQR+TLL+QL TN+ +M    +EL   +   D  YD F+  L+
Sbjct:   12 EPGQLREKTIPAGLQSMNQSLQRRFAKGVQYNMKIVIRGDRNTGKSTLWHRLQGKKFVEEYIPTQEIQVTSIHWNYKMAPYQATDDVVKVEVWDVVDKGQKHLFPEGKGKRRGDNLKLENEPQESD--EVALDAEFLDVYKNCNGVIMMFDITKQWTFSYIMRELPKVPTHVPVCVLGNHRDMGEHRVILPDDIRDLIAGLNRPMGSSYIHYAESSMRNGFGLKYLHRFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYDIFLENLE 288          
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Match: rab7a (ras-related protein rab7 [Source:NCBI gene;Acc:101157689])

HSP 1 Score: 51.9878 bits (123), Expect = 6.433e-7
Identity = 44/181 (24.31%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITK--------SWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            +K++I GD  VGK++L+ +     FS QY  T  I    +      +D +V +++WD                   G++   S+ +       Y+GA+  ++V D+T         SW   ++ +     P+N P +VL N  D+  +R +T  + Q+  +S  +     I Y+E+S K  
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFSNQYKAT--IGADFLTKEVMVDDRLVTMQIWDTA-----------------GQERFQSLGVA-----FYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDL-ENRQVTTKRAQAWCQSKNN-----IPYFETSAKEA 159          
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 51.9878 bits (123), Expect = 7.533e-7
Identity = 45/180 (25.00%), Postives = 82/180 (45.56%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIE--VACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVP----DNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKN 775
            Y  K+++ GD  VGKS LL R     ++E YI T  ++  +  +  + K+    VK+++WD                   G++   +I         Y+GA+ +IIV D+T+  + N V + L+ +     +N+  L++ N  D+ S + +     Q L  S+       I + E+S K+
Sbjct:    7 YLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKT----VKLQIWDTA-----------------GQERFRTITSS-----YYRGAHGIIIVYDVTEQESFNNVRQWLEEIDRYACENVSRLLVGNKSDLVSKKVVDAATAQDLASSLK------IPFLETSAKS 154          
BLAST of Rab-like protein 6 vs. Planmine SMEST
Match: SMESG000037136.1 (SMESG000037136.1)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 665/686 (96.94%), Postives = 668/686 (97.38%), Query Frame = 2
Query:  113 MSIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQXXXXXXXXXXXXYDNFISTLKHPKINISQAQKXXXXXXXXXXXXXXXXXXXXVGSSQLLSKPLAEHVPADRNVFHPPQARPIPGMEKLGLYPLPVPCNDIKARSDEVPISIASEPNNFNNITSQIENLSLIKLSSYIDKKNIEEFVPEDQPELSSFLDDLSSGRPSNFVPVGNVNALFSSSXXXXXXXXXXXXXXXXXXXXLKRQNPMVSSFQXXXXXXXXXXXXXXXXASEYDNATSSSDENVGDNKSTYRVTATTGAQSSSNAHKKTFVVPKSIIESPRHLTKSDSVLVSHDLAPSTKSHIELNSSDIDFLEQITSRKELGVEPSNEVDPINSCASTTXXXXXXXXXESAXXXXXXXXXXXXXXXXXXXXXPKENNSKAIPQISSTSSKPLKEIDDRVVVSSVQKTXXXXXXXXXXXLERFLND 2170
            MSIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDKGRKKKSSGLKLENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQELEDLESDSDSLYDNFISTLKHPKINISQAQKPSSLTITSSPSSQINSPSTPVGSSQLLSKPLAEHVPA+RNVFHPPQARPIPGMEKLGLYPLPVPCNDIKARSDEVPISIASEPNNFNNIT               +KKNIEEFVPEDQPELSSFLDDLSSGRPSNFVPVGNVNALFSSSGNDEEDDDDDDHGDDGGKGDLKRQNPMVSSFQDDIDINDVTNVDNCNVASEYDNATSSSDENVGDN STYRVTATTGAQSSSNAHKKTFVVPKSIIESPRHLTKSDSVLVSHDLAPSTKSHIELNSSDIDFLEQITSRKELGVEPSNEVD INSCASTTKKKKKKHHKESANKDQQSNKKKRKSKMRSRDSSPKENNSKAIPQISSTSSKP+KEIDDRVVVSSVQKTSIS RSDRSDSLERFLND
Sbjct:    1 MSIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDKGRKKKSSGLKLENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLATNEAEMCLASQELEDLESDSDSLYDNFISTLKHPKINISQAQKPSSLTITSSPSSQINSPSTPVGSSQLLSKPLAEHVPAERNVFHPPQARPIPGMEKLGLYPLPVPCNDIKARSDEVPISIASEPNNFNNIT---------------NKKNIEEFVPEDQPELSSFLDDLSSGRPSNFVPVGNVNALFSSSGNDEEDDDDDDHGDDGGKGDLKRQNPMVSSFQDDIDINDVTNVDNCNVASEYDNATSSSDENVGDNNSTYRVTATTGAQSSSNAHKKTFVVPKSIIESPRHLTKSDSVLVSHDLAPSTKSHIELNSSDIDFLEQITSRKELGVEPSNEVDLINSCASTTKKKKKKHHKESANKDQQSNKKKRKSKMRSRDSSPKENNSKAIPQISSTSSKPMKEIDDRVVVSSVQKTSISCRSDRSDSLERFLND 671          
BLAST of Rab-like protein 6 vs. Planmine SMEST
Match: SMESG000076066.1 (SMESG000076066.1)

HSP 1 Score: 52.373 bits (124), Expect = 3.195e-7
Identity = 49/183 (26.78%), Postives = 86/183 (46.99%), Query Frame = 2
Query:  242 RGVQYNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDIT--KSWT-LNYVERELQGVPDNIPV-LVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMKNG 778
            R   +  KIVI GD +VGK++LL+R     F+E Y+ T  ++        K ND +VK+ +WD                   GE+   S  L   F   Y+G +  ++V  +T  KS+T L++  +E+    ++  V L++ N  D+   R ++ +Q +   +S        ++Y E+S K+ 
Sbjct:    4 RDYDFIFKIVIIGDAHVGKTSLLSRFTDDKFNENYLNTLGVDFKLK--TVKVNDHVVKLNIWDTA-----------------GEELYNS--LTTAF---YRGCHGFVLVFSLTEKKSFTNLSHWLKEIDKNANSTNVRLLVGNKLDLNDERVVSFEQAKIFADSRK------LQYIETSAKSS 156          
BLAST of Rab-like protein 6 vs. Planmine SMEST
Match: SMESG000068863.1 (SMESG000068863.1)

HSP 1 Score: 51.2174 bits (121), Expect = 7.579e-7
Identity = 45/179 (25.14%), Postives = 79/179 (44.13%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDIT--------KSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSLVESMPSYKSGLIKYWESSMK 772
            +K++I GD  VGK++L+ +     F+ QY  T  I    +  +   +D +V +++WD                   G++   S  L   F   Y+GA+  ++V D+T        +SW   ++ +     PD+ P +V+ N  D+G  R +   + Q   +S      G I Y+E S K
Sbjct:    9 LKVIILGDSGVGKTSLMNQYVNKKFTNQYKAT--IGADFLTKDVIVDDRVVTMQIWDTA-----------------GQERFQS--LGVAF---YRGADCCVLVYDVTMPKTFTNLESWRDEFLIQSSPRDPDHFPFVVIGNKVDLG-ERNVASRRAQQWCQS-----KGDIAYFECSAK 157          
BLAST of Rab-like protein 6 vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 49.6766 bits (117), Expect = 2.593e-6
Identity = 34/152 (22.37%), Postives = 68/152 (44.74%), Query Frame = 2
Query:  254 YNMKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPD----NIPVLVLANHRDMGSHRTITED 697
            Y  K+++ GD  VGK++LL R     FS  +I T  I+      + +     VK++VWD                   G++   +I         Y+GA  +++V D+T + + N + + +Q + +    ++  +++ N  D+   R I+ +
Sbjct:    7 YLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKK--VKLQVWDTA-----------------GQERFRTITTS-----YYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRE 134          
BLAST of Rab-like protein 6 vs. Planmine SMEST
Match: SMESG000076068.1 (SMESG000076068.1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.767e-6
Identity = 42/157 (26.75%), Postives = 70/157 (44.59%), Query Frame = 2
Query:  260 MKIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIVKVEVWDVVDXXXXXXXXXXXXENDNGEDNPGSICLDAEFLDVYKGANAVIIVLDITKSWTLNYVERELQGVPDNIPV----LVLANHRDMGSHRTITEDQIQSLVE 718
            +KI+I GD  VGKS+LLAR     F+E YI T  ++        K N+  VK+++WD                   G +   S  L + F   Y+G++ +IIV ++    T   V   ++ V  +  V    L++ N  D+   R ++ +  +   E
Sbjct:   11 LKIIIVGDPGVGKSSLLARFADDTFNESYIQTLGVDFKL--RTIKINESKVKIQIWDTA-----------------GTEKYAS--LTSSF---YRGSHGIIIVYNLIDQNTFQNVSYWIKEVNRSTGVRNKRLLVGNKLDLSDKRAVSTETAKEFAE 143          
The following BLAST results are available for this feature:
BLAST of Rab-like protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RABL67.027e-7855.70RAB, member RAS oncogene family like 6 [Source:HGN... [more]
RABL69.424e-7755.70RAB, member RAS oncogene family like 6 [Source:HGN... [more]
RABL61.047e-7655.90RAB, member RAS oncogene family like 6 [Source:HGN... [more]
RABL61.092e-7555.70RAB, member RAS oncogene family like 6 [Source:HGN... [more]
RABL61.321e-7355.00RAB, member RAS oncogene family like 6 [Source:HGN... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F08G12.18.678e-6046.18pep chromosome:WBcel235:X:11302074:11305873:-1 gen... [more]
rab-73.595e-923.30RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-73.595e-923.30RAB family [Source:UniProtKB/TrEMBL;Acc:Q23146][more]
rab-351.497e-724.86RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3][more]
rab-11.026e-624.44RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RabX22.387e-724.84gene:FBgn0030200 transcript:FBtr0071448[more]
Rab76.707e-725.97gene:FBgn0015795 transcript:FBtr0084503[more]
Rab76.707e-725.97gene:FBgn0015795 transcript:FBtr0308612[more]
Rab76.707e-725.97gene:FBgn0015795 transcript:FBtr0308611[more]
Rab355.195e-623.61gene:FBgn0031090 transcript:FBtr0333549[more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl6b5.697e-6755.78RAB, member RAS oncogene family-like 6b [Source:ZF... [more]
rabl6b7.898e-6654.00RAB, member RAS oncogene family-like 6b [Source:ZF... [more]
rabl6a1.231e-4052.17RAB, member RAS oncogene family-like 6a [Source:ZF... [more]
rabl6b3.933e-2460.27RAB, member RAS oncogene family-like 6b [Source:ZF... [more]
CABZ01075628.16.152e-2461.97pep chromosome:GRCz11:5:5666864:5669879:-1 gene:EN... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl64.031e-7252.05RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rabl61.509e-7152.05RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rabl62.403e-6955.87RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rabl64.775e-6955.87RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rab1a2.441e-623.33RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rabl62.418e-6556.89RAB, member RAS oncogene family-like 6 [Source:MGI... [more]
Rab171.037e-827.44RAB17, member RAS oncogene family [Source:MGI Symb... [more]
Rab171.037e-827.44RAB17, member RAS oncogene family [Source:MGI Symb... [more]
Rab177.032e-827.27RAB17, member RAS oncogene family [Source:MGI Symb... [more]
Rab135.727e-723.38RAB13, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Rab-like protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3YEC7|RABL6_HUMAN5.242e-7555.70Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL... [more]
sp|Q5U3K5|RABL6_MOUSE1.691e-6456.89Rab-like protein 6 OS=Mus musculus OX=10090 GN=Rab... [more]
sp|Q08DA0|RABL6_BOVIN4.767e-6351.18Rab-like protein 6 OS=Bos taurus OX=9913 GN=RABL6 ... [more]
sp|P34143|RABC_DICDI2.795e-926.37Ras-related protein RabC OS=Dictyostelium discoide... [more]
sp|Q9S810|RAA1I_ARATH7.118e-927.44Ras-related protein RABA1i OS=Arabidopsis thaliana... [more]
back to top
BLAST of Rab-like protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1G0041.915e-8358.22Uncharacterized protein OS=Helobdella robusta OX=6... [more]
V9IGB62.738e-8353.38Putative GTP-binding protein Parf OS=Apis cerana O... [more]
T1K7M94.103e-8348.82Uncharacterized protein OS=Tetranychus urticae OX=... [more]
A0A443SP374.924e-8253.20Rab-like protein 6 isoform X1 OS=Leptotrombidium d... [more]
A0A2L2Y3V51.724e-8156.32Rab-like protein 1 OS=Parasteatoda tepidariorum OX... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl6a2.400e-6653.67RAB, member RAS oncogene family-like 6a [Source:ZF... [more]
rabl6b9.892e-6252.57RAB, member RAS oncogene family-like 6b [Source:ZF... [more]
zgc:1719273.331e-725.70ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
rab1ba4.640e-723.88zRAB1B, member RAS oncogene family a [Source:ZFIN;... [more]
rab25a4.912e-725.77RAB25, member RAS oncogene family a [Source:ZFIN;A... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rab1aa3.583e-723.33RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab11ba4.390e-725.81RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
ENSPMAT00000006572.14.594e-625.70pep scaffold:Pmarinus_7.0:GL495441:238:797:1 gene:... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC41.355e-728.09Rab family GTPase; essential for vesicle-mediated ... [more]
YPT74.436e-723.18Rab family GTPase; GTP-binding protein of the rab ... [more]
GSP15.450e-723.98Ran GTPase; GTP binding protein (mammalian Ranp ho... [more]
GSP25.667e-723.98GTP binding protein (mammalian Ranp homolog); invo... [more]
VPS218.471e-724.86Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO369251.160e-7553.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291224.070e-3455.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381782.644e-1960.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444628.710e-825.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404097.307e-726.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rab-like protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rabl6b1.163e-6648.34RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rabl6b1.839e-6650.73RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rabl6b7.109e-6646.95RAB, member RAS oncogene family like 6 [Source:NCB... [more]
rab7a6.433e-724.31ras-related protein rab7 [Source:NCBI gene;Acc:101... [more]
zgc:1719277.533e-725.00ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
back to top
BLAST of Rab-like protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037136.10.000e+096.94SMESG000037136.1[more]
SMESG000076066.13.195e-726.78SMESG000076066.1[more]
SMESG000068863.17.579e-725.14SMESG000068863.1[more]
SMESG000030619.12.593e-622.37SMESG000030619.1[more]
SMESG000076068.13.767e-626.75SMESG000076068.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034858 ID=SMED30034858|Name=Rab-like protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=2968bp
ATATAATTCATATATTTTAAAATATTATTGTTTATGTATAATTATAGTTT
TGAAACAGATGTTATTGAATTTTAGAGAATTCTTATTTTTTAAGATTGAA
ATTTTAAATTAAATGTCGATTTTTAAACGTTTTTTCGGTGAAAAAGAAGA
TATCAACAATGTTCAACCGCAAGTTTTTAAAGCACATGTTAATAATTCTA
ACATAAAATCCATTGGATTTAATTTGCAAAAGCGATTTTCACGCGGAGTT
CAATATAATATGAAAATAGTGATTCGGGGAGACAGGAATGTTGGAAAATC
TGCTTTGTTAGCTCGGTTAAAAGGATTAGATTTCTCTGAGCAGTACATTC
CAACTGATGAAATTGAGGTCGCATGCGTCCACTGGAATTACAAGTCAAAT
GATGACATCGTCAAGGTCGAGGTCTGGGATGTCGTCGACAAAGGCAGGAA
AAAAAAGTCGAGCGGCTTGAAATTGGAAAACGACAATGGAGAGGACAATC
CAGGATCAATCTGTCTCGATGCGGAATTCCTCGATGTTTACAAAGGTGCC
AATGCGGTCATCATCGTGCTAGACATCACAAAATCCTGGACTCTCAACTA
CGTGGAGCGAGAGTTGCAAGGCGTGCCTGACAATATCCCAGTGCTGGTAT
TGGCTAATCATAGAGATATGGGATCACATCGAACCATTACTGAGGATCAG
ATCCAGTCATTGGTCGAGTCAATGCCCAGCTATAAAAGCGGTCTTATTAA
ATACTGGGAATCATCAATGAAGAACGGATACGGCCTGATCTATATTCATA
AATTTTTTAACATTCCTTTCCTGCAGCTGCAGAGAGATACGTTATTGAAG
CAGCTAGCGACAAATGAAGCTGAAATGTGCCTGGCTTCTCAGGAATTAGA
AGATCTAGAGTCTGATTCAGATAGTTTGTATGATAACTTCATTTCCACTC
TCAAGCACCCAAAAATCAATATTTCCCAGGCACAAAAACCTTCATCACTT
ACAATAACATCTAGTCCTTCATCACAGATCAATTCTCCATCAACTCCTGT
CGGCAGTTCCCAATTGCTAAGCAAGCCACTGGCTGAGCATGTGCCAGCTG
ATCGCAATGTATTTCATCCTCCTCAAGCTCGGCCTATCCCAGGCATGGAA
AAGCTTGGATTGTATCCTCTGCCGGTCCCATGCAATGATATCAAAGCAAG
GAGTGATGAAGTTCCAATTTCTATTGCTTCTGAACCGAATAATTTCAATA
ATATTACAAGTCAGATTGAAAATCTTTCATTGATCAAATTGTCTTCATAT
ATAGATAAGAAGAATATAGAAGAATTTGTGCCCGAAGATCAGCCAGAACT
TTCCTCCTTTCTCGACGATTTGAGTTCTGGTCGACCTTCGAATTTTGTGC
CTGTAGGGAATGTGAATGCCTTGTTTTCATCATCTGGTAATGATGAGGAG
GATGACGATGACGATGACCATGGTGATGATGGTGGCAAAGGGGATCTGAA
GAGACAAAATCCGATGGTGTCGTCATTCCAGGATGATATCGATATCAATG
ATGTTACAAATGTTGACAATTGCAATGTTGCATCTGAATATGACAATGCT
ACCAGCTCGTCTGATGAAAATGTCGGGGACAATAAGTCAACCTATCGAGT
GACAGCAACAACTGGCGCCCAATCATCTAGCAATGCTCATAAGAAAACAT
TTGTTGTACCGAAATCAATTATTGAGTCGCCCCGACACTTGACTAAATCA
GATTCAGTTCTGGTCAGCCATGATCTAGCACCATCAACAAAATCTCATAT
TGAGCTCAACTCGTCCGATATTGATTTCCTTGAACAAATCACATCTAGAA
AAGAATTGGGAGTGGAACCGAGTAACGAGGTTGATCCGATCAATTCTTGC
GCCAGTACAACAAAAAAGAAAAAGAAAAAGCACCACAAGGAGTCAGCGAA
CAAAGATCAGCAGTCAAATAAAAAGAAAAGGAAATCTAAAATGAGATCGC
GAGATTCATCCCCGAAAGAGAACAATTCGAAAGCTATTCCTCAAATTTCT
AGCACCTCATCGAAACCGTTGAAGGAAATAGATGATCGAGTCGTCGTGAG
CTCAGTACAGAAAACGTCTATTTCTAGCAGATCCGACAGATCTGATTCGT
TGGAAAGGTTCCTGAATGATTGATTATATTACATGCAATGAATACTCATT
CGGTTATGCTTGTGATATTGATTATTATTATTATTATTGTCGGTTTTATT
TAATCATAATATGTTGCCATGGAATCATAAATATATGGGTAAGTGGAAAT
TTTAGTGTTGTTAATTCATATTTAGGTTAAAATCGGAATTTAAATTGGAA
TTATGGATTGTCAAGTTGTAAGTAATATGAATTGATACAAACGGTTTTAT
ACAAAGGTAAACATTTATTGTTTAAAAATTTATAATCTTACAACCCGGAA
TGCTAAAAATATATCATTAAAAATCTATATTATTTTTTTCTTTAAAAAAT
CAAGGTAATGCTTTAATATAAAAATAAAAAAAATAAATAATTATTAGAAC
TTACAATTGGAAAAATGTTTTTCAAAATATTGAATGGCTGCGATCTGTAA
ACAACAGGGAATGTAGAGTAGTTATCAATGTATCATACTATAAATGTACT
AATTGCATTGGAGAAATCATTTCCAAGACATATAATATCAATTAAGAAGC
ACAAGTCTCGCTGGAAGTCATGAAAGATTTTTCATTCGTTGACTCGATAT
TTTACTATGTGAATGATCCTAATGAAATTTTATTGCGTCAACAAATTACA
TCTGCAGGTACACAAAGAACAACAGTGAAACGACGATTTTCAACACCGAT
TGTCGTCTTATCAACATCCGATGAATCGTTATGTTCGGCTCTAAATTTGG
AAGGCTTTTCAAAAGTTACAAGGACCTCATCCGTGTTTCTTGTATTCTGA
AGTGAATAATTATCCTTG
back to top

protein sequence of SMED30034858-orf-1

>SMED30034858-orf-1 ID=SMED30034858-orf-1|Name=SMED30034858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=687bp
MSIFKRFFGEKEDINNVQPQVFKAHVNNSNIKSIGFNLQKRFSRGVQYNM
KIVIRGDRNVGKSALLARLKGLDFSEQYIPTDEIEVACVHWNYKSNDDIV
KVEVWDVVDKGRKKKSSGLKLENDNGEDNPGSICLDAEFLDVYKGANAVI
IVLDITKSWTLNYVERELQGVPDNIPVLVLANHRDMGSHRTITEDQIQSL
VESMPSYKSGLIKYWESSMKNGYGLIYIHKFFNIPFLQLQRDTLLKQLAT
NEAEMCLASQELEDLESDSDSLYDNFISTLKHPKINISQAQKPSSLTITS
SPSSQINSPSTPVGSSQLLSKPLAEHVPADRNVFHPPQARPIPGMEKLGL
YPLPVPCNDIKARSDEVPISIASEPNNFNNITSQIENLSLIKLSSYIDKK
NIEEFVPEDQPELSSFLDDLSSGRPSNFVPVGNVNALFSSSGNDEEDDDD
DDHGDDGGKGDLKRQNPMVSSFQDDIDINDVTNVDNCNVASEYDNATSSS
DENVGDNKSTYRVTATTGAQSSSNAHKKTFVVPKSIIESPRHLTKSDSVL
VSHDLAPSTKSHIELNSSDIDFLEQITSRKELGVEPSNEVDPINSCASTT
KKKKKKHHKESANKDQQSNKKKRKSKMRSRDSSPKENNSKAIPQISSTSS
KPLKEIDDRVVVSSVQKTSISSRSDRSDSLERFLND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR040385RABL6
IPR027417P-loop_NTPase
IPR013684MIRO-like
IPR001849PH_domain
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 50..71
score: 42.16
coord: 93..115
score: 15.88
coord: 173..186
score: 27.48
coord: 73..89
score: 25.25
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 50..246
e-value: 6.8E-5
score: -48.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 44..271
e-value: 8.7E-32
score: 111.9
NoneNo IPR availablePFAMPF08477Roccoord: 51..108
e-value: 1.8E-6
score: 28.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 441..477
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 636..651
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 291..318
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 598..686
NoneNo IPR availablePROSITEPS51419RABcoord: 45..288
score: 12.205
IPR040385Rab-like protein 6PANTHERPTHR14932RAS GTPASE-RELATEDcoord: 24..527
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 47..225