5-hydroxytryptamine receptor

Overview
Name5-hydroxytryptamine receptor
Smed IDSMED30034855
Length (bp)1863
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor (SMED30034855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor (SMED30034855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034855SMESG000008878.1 SmedASXL_019353SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034855SMESG000008878.1 dd_Smed_v6_33009_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30034855SMESG000008878.1 SMED30034855smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 174.096 bits (440), Expect = 1.242e-47
Identity = 93/218 (42.66%), Postives = 139/218 (63.76%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXX---XXXXXXXXXXXXXSQHHVSKRSQP 1002
            ITS +L  LI C V+GN+ V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++   W LG   CDL++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R   +I++ WL+  +IS+P        +     R   D  C I+ + G+T++STFGAFY+P+  ++ +Y RI++ AR    +  ++  +    ++H  S   QP
Sbjct:   38 ITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPML----GWRTPEDRSDPDA-CTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQP 250          

HSP 2 Score: 98.9821 bits (245), Expect = 1.881e-21
Identity = 50/98 (51.02%), Postives = 67/98 (68.37%), Query Frame = 1
Query: 1441 PSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            P+    ++ER    ++K+   RERK V+TL II G FI+CW PFFI A ++PFC   C +P LL + + WLGY NSLLNPVIY  F+ DF++AF KI+
Sbjct:  318 PASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 155.992 bits (393), Expect = 1.617e-41
Identity = 83/189 (43.92%), Postives = 123/189 (65.08%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            + S  L  L L T   NS VIAAI++ + L + +NYLI SLAV D +VA LVM  S+ + + E+W +G  +CD+W+  D+ CC+ SILHL AIA+DRY A+T   +Y R RT K   IMI I+W++S+ IS+P  F  ++  ++       D +C+I +D I  T++STFGAFY+P+  I+ +Y +IY+
Sbjct:   25 LVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSR-------DDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYR 206          

HSP 2 Score: 87.4261 bits (215), Expect = 6.476e-18
Identity = 37/76 (48.68%), Postives = 54/76 (71.05%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            A  TL +I G F++CW PFF++  +V  C K C++   +S+F+ WLGY NSL+NP+IYTIF+ DF+ AF K++  R
Sbjct:  291 AATTLGLILGAFVICWLPFFVKELVVNVCDK-CKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCR 365          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 155.221 bits (391), Expect = 4.129e-41
Identity = 80/184 (43.48%), Postives = 115/184 (62.50%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            +L ++ L T + N+FVIA +   + L   +NYLI SLAV DL+V+ LVM +S  + ++  W LG  +CD W+  D+ CC+ASILHL  IA+DRY A+T   +Y   RT KR  +MIA++W+ SI IS+P  F       +E+       +C++N D I +TV+ST GAFY P   +I +Y RIY
Sbjct:   55 LLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEV------SECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIY 232          

HSP 2 Score: 84.7297 bits (208), Expect = 6.001e-17
Identity = 37/73 (50.68%), Postives = 49/73 (67.12%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TL II G FIVCW PFFI + ++P C   C     +  F  WLGY NSL+NP+IYT+ + DF+ AFHK++
Sbjct:  312 ATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLI 384          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1D (5-hydroxytryptamine receptor 1D [Source:HGNC Symbol;Acc:HGNC:5289])

HSP 1 Score: 154.066 bits (388), Expect = 9.271e-41
Identity = 83/186 (44.62%), Postives = 117/186 (62.90%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            VL V+ L TV+ N+FV+  ILL + L   +NYLI SLA  DL+V+ LVM +S+ + I+  W  G  +CD+W+  D+ CC+ASILHL  IA+DRY A+T   +Y + RTA     MIAI+W +SI IS+P  F       +EM        CL+N  +I +T++ST GAFY+P   +I +Y RIY+ 
Sbjct:   44 VLSVITLATVLSNAFVLTTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEM------SDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRA 223          

HSP 2 Score: 90.1225 bits (222), Expect = 9.579e-19
Identity = 37/73 (50.68%), Postives = 50/73 (68.49%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A + L II G FI+CW PFF+ + ++P C   C + P L  F  WLGY NSL+NP+IYT+F+ +FR AF KI+
Sbjct:  299 ATKILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKIV 371          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Match: HTR1E (5-hydroxytryptamine receptor 1E [Source:HGNC Symbol;Acc:HGNC:5291])

HSP 1 Score: 137.117 bits (344), Expect = 8.470e-35
Identity = 80/195 (41.03%), Postives = 116/195 (59.49%), Query Frame = 1
Query:  418 VIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRS 996
            VI AI   K L   +NYLI SLAV DL+VA LVM LS+ + + + W LG  +C++W+  D+ CC+ SILHL  IA+DRY A+T   +Y R RTAKR  +MI  +W +SI IS+P  F     +    +      +C I +D + +T++ST GAFY+P+  I+ +Y RIY         ++  ++  S  H+S RS
Sbjct:   43 VIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLF-----WRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHA------AKSLYQKRGSSRHLSNRS 226          

HSP 2 Score: 64.6994 bits (156), Expect = 1.554e-10
Identity = 33/76 (43.42%), Postives = 47/76 (61.84%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            A R L +I G FI+ W PFFI+  IV        +   ++ F+ WLGY NSL+NP++YT F+ DF+ AF K++  R
Sbjct:  289 AARILGLILGAFILSWLPFFIKELIVGL--SIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCR 362          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 156.762 bits (395), Expect = 1.295e-41
Identity = 87/189 (46.03%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNY-LIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISV-PTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            I + VL+VLIL   IGN FVI AI++E++L     Y LI SLAVADL+V  +V  L  +  ++  W LG+ +CD W+  DVL C+ASILHLVAIA+DRY ++T   YV+ RT KRI +M+A+IW  S++IS+ P     +  ++    RV+    CLI+ +I + VFST  AFY+P+  II +Y +I +
Sbjct:   53 ILASVLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFS---DRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMR 238          

HSP 2 Score: 96.2857 bits (238), Expect = 6.791e-21
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A RTLAIITG F+ CW PFF+ +   P CG  CQ+ P+L    LWLGY NS LNP+IYT+FS DFR AF +I+
Sbjct:  366 AWRTLAIITGTFVACWTPFFLVSIYRPICG--CQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: ser-4 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:G5EGH0])

HSP 1 Score: 156.762 bits (395), Expect = 1.295e-41
Identity = 87/189 (46.03%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNY-LIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISV-PTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            I + VL+VLIL   IGN FVI AI++E++L     Y LI SLAVADL+V  +V  L  +  ++  W LG+ +CD W+  DVL C+ASILHLVAIA+DRY ++T   YV+ RT KRI +M+A+IW  S++IS+ P     +  ++    RV+    CLI+ +I + VFST  AFY+P+  II +Y +I +
Sbjct:   53 ILASVLLVLILSCFIGNLFVILAIIMERDLRGRPQYYLIFSLAVADLLVGMIVTPLGAWFTVTGTWNLGVVVCDFWISVDVLVCTASILHLVAIALDRYWSITDICYVQNRTPKRITLMLAVIWFTSLLISLAPFAGWKDEGFS---DRVLKSHVCLISQQISYQVFSTATAFYIPLIAIICVYWKIMR 238          

HSP 2 Score: 96.2857 bits (238), Expect = 6.791e-21
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A RTLAIITG F+ CW PFF+ +   P CG  CQ+ P+L    LWLGY NS LNP+IYT+FS DFR AF +I+
Sbjct:  366 AWRTLAIITGTFVACWTPFFLVSIYRPICG--CQISPVLEQVTLWLGYLNSALNPIIYTVFSQDFRAAFKRII 436          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: dop-4 (Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;Acc:Q18775])

HSP 1 Score: 156.762 bits (395), Expect = 4.131e-41
Identity = 129/480 (26.88%), Postives = 208/480 (43.33%), Query Frame = 1
Query:  346 WTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEIS-EAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAK-RIYIMIAIIWLLSIMISVPT--RFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDT---HIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKM---NNSSI-------ALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            W H  +   +  + +L TV GN  V+ A+  +K L N + YLIISLA+ADL+V  +VM ++   EI+   W  GL +CD++   D+L  +ASI +L  I++DRYMA   P   R + +K RI + I  +W+LS ++S P    +  +  +  E Q      +CL  D   +  FS+  +FY+P+F I+  Y ++Y +A    +      +  S    + +      ++   +    T   H   G        N       ++             D+    NN+++          CH DS         IS S  R     N     N     + ++   +  L  +  + +   L++   +    K+R M     HE R +R +S                         I+ G FI+CW PFF+   +  FC         + +FV W G+ NS+LNP+IY+ FS DFR AF +IL
Sbjct:   40 WRHPLLAIALFSICLL-TVAGNCLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGIIWWRTSSPHLYEDQ-----SQCLFTDSKMYVSFSSLVSFYIPLFLILFAYGKVYIIATRHSKGMRMGIKTVSIKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRFHARESTRLLLKQVSCKSLNDRGEHNNNNTVRQPLLRGTEGCHSDS---------ISRSSQRNFRGRNVTIGSNCSSTLLQVDQPDRMSLSSNSQMVMTSPLSTRRKLNVREKSRQMMRY-VHEQRAARTLS-------------------------IVVGAFILCWTPFFVFTPLTAFCESCFSNKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL 478          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 133.265 bits (334), Expect = 1.346e-33
Identity = 66/190 (34.74%), Postives = 119/190 (62.63%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNL-LNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            +T   ++ ++L  + GN  V+  +  ++ L +   N+LI+SLAVAD++V  LVM L++ +EI   W +G  +C++W+  DVL  +ASILH+ AI++DRY +VT P  Y  TRT  R++I I + W++S++I +P  F               +G+C ++ ++G+ ++S+ G+FY+P+  +I +Y +IY +
Sbjct:   23 LTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA--------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSI 204          

HSP 2 Score: 65.4698 bits (158), Expect = 4.068e-11
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL--FGRYL 1749
            A   L II   FI+ W PFF+   I  F     + PPL+  F  WLGYCNS +NPVIYT+F+ +F+    K L  F R++
Sbjct:  322 ATLLLGIILSAFILSWLPFFLIYVIGAFGH---EAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFERFI 398          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 133.265 bits (334), Expect = 1.432e-33
Identity = 66/190 (34.74%), Postives = 119/190 (62.63%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNL-LNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            +T   ++ ++L  + GN  V+  +  ++ L +   N+LI+SLAVAD++V  LVM L++ +EI   W +G  +C++W+  DVL  +ASILH+ AI++DRY +VT P  Y  TRT  R++I I + W++S++I +P  F               +G+C ++ ++G+ ++S+ G+FY+P+  +I +Y +IY +
Sbjct:   23 LTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERA--------EGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSI 204          

HSP 2 Score: 65.855 bits (159), Expect = 3.720e-11
Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL--FGRYL 1749
            A   L II   FI+ W PFF+   I  F     + PPL+  F  WLGYCNS +NPVIYT+F+ +F+    K L  F R++
Sbjct:  324 ATLLLGIILSAFILSWLPFFLIYVIGAFGH---EAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFERFI 400          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0086577)

HSP 1 Score: 196.438 bits (498), Expect = 2.580e-53
Identity = 94/192 (48.96%), Postives = 139/192 (72.40%), Query Frame = 1
Query:  352 HIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFH-LNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
             + +TS +L ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS+ W LG E+CD+W   DVLCC+ASILHLVAIA+DRY AVT  DY+ +RT+ R+++MI  +W  ++++S+  +F   + +Y   +QR+    KC+++ ++ + VF+T   FY+P+  I+ +Y +IYQ 
Sbjct:  225 RMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDY---LQRIEQQ-KCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQT 412          

HSP 2 Score: 107.071 bits (266), Expect = 1.100e-23
Identity = 47/77 (61.04%), Postives = 57/77 (74.03%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A +TLAIITG F+VCW PFF+ A  +P C   CQ+   ++S  LWLGY NS LNPVIYTIFSP+FR AF +ILFG +
Sbjct:  749 AAKTLAIITGAFVVCWLPFFVMALTMPLCAA-CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1A (gene:FBgn0004168 transcript:FBtr0474126)

HSP 1 Score: 196.438 bits (498), Expect = 2.967e-53
Identity = 94/192 (48.96%), Postives = 139/192 (72.40%), Query Frame = 1
Query:  352 HIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFH-LNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
             + +TS +L ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS+ W LG E+CD+W   DVLCC+ASILHLVAIA+DRY AVT  DY+ +RT+ R+++MI  +W  ++++S+  +F   + +Y   +QR+    KC+++ ++ + VF+T   FY+P+  I+ +Y +IYQ 
Sbjct:  225 RMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDY---LQRIEQQ-KCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQT 412          

HSP 2 Score: 106.686 bits (265), Expect = 1.218e-23
Identity = 47/77 (61.04%), Postives = 57/77 (74.03%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A +TLAIITG F+VCW PFF+ A  +P C   CQ+   ++S  LWLGY NS LNPVIYTIFSP+FR AF +ILFG +
Sbjct:  749 AAKTLAIITGAFVVCWLPFFVMALTMPLCAA-CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330055)

HSP 1 Score: 182.185 bits (461), Expect = 9.358e-50
Identity = 89/183 (48.63%), Postives = 129/183 (70.49%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHL-NRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            VL ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS  W LG E+CD+W   DVLCC+ASILHLVAIA DRY  VT  DY   RT +R+++MI  +W  ++++S+  +F   + +Y K ++    +  C+++ ++G+ +F+T   FY+P+  I+ +Y +IY
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIE----EQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIY 274          

HSP 2 Score: 100.523 bits (249), Expect = 7.065e-22
Identity = 44/75 (58.67%), Postives = 57/75 (76.00%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFG 1740
            A +TLAIITG F++CW PFF+ A  +  C K+C++   ++S  LWLGY NS LNPVIYTIF+P+FR AF +ILFG
Sbjct:  477 AAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 550          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0086599)

HSP 1 Score: 182.57 bits (462), Expect = 1.731e-49
Identity = 89/183 (48.63%), Postives = 129/183 (70.49%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHL-NRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            VL ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS  W LG E+CD+W   DVLCC+ASILHLVAIA DRY  VT  DY   RT +R+++MI  +W  ++++S+  +F   + +Y K ++    +  C+++ ++G+ +F+T   FY+P+  I+ +Y +IY
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIE----EQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIY 274          

HSP 2 Score: 101.293 bits (251), Expect = 4.433e-22
Identity = 44/75 (58.67%), Postives = 57/75 (76.00%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFG 1740
            A +TLAIITG F++CW PFF+ A  +  C K+C++   ++S  LWLGY NS LNPVIYTIF+P+FR AF +ILFG
Sbjct:  532 AAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330056)

HSP 1 Score: 182.57 bits (462), Expect = 1.967e-49
Identity = 89/183 (48.63%), Postives = 129/183 (70.49%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHL-NRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            VL ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS  W LG E+CD+W   DVLCC+ASILHLVAIA DRY  VT  DY   RT +R+++MI  +W  ++++S+  +F   + +Y K ++    +  C+++ ++G+ +F+T   FY+P+  I+ +Y +IY
Sbjct:   96 VLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIE----EQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIY 274          

HSP 2 Score: 101.293 bits (251), Expect = 4.667e-22
Identity = 44/75 (58.67%), Postives = 57/75 (76.00%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFG 1740
            A +TLAIITG F++CW PFF+ A  +  C K+C++   ++S  LWLGY NS LNPVIYTIF+P+FR AF +ILFG
Sbjct:  532 AAQTLAIITGAFVICWLPFFVMALTMSLC-KECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFKRILFG 605          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 177.178 bits (448), Expect = 3.448e-49
Identity = 92/227 (40.53%), Postives = 145/227 (63.88%), Query Frame = 1
Query:  247 YNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            YN   ++ +++ ++ S+S++ +            ++  I S  L  LIL  ++GN+ VIAAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++   W LG E+CD+++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R  I+I++ WL+   IS+P        + K   R   D  C I+ + G+T++STFGAFY+P+  ++ +Y RI++ 
Sbjct:    4 YNNTTESQDWSGNATSVSEVAL------------SYQIIGSLFLAALILFAILGNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIPPML----GWRKPEDRADPDA-CTISQDHGYTIYSTFGAFYIPLILMLVLYGRIFRA 213          

HSP 2 Score: 90.5077 bits (223), Expect = 5.056e-19
Identity = 42/72 (58.33%), Postives = 52/72 (72.22%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            V+TL II G FI CW PFFI A ++PFC + C +P  L + + WLGY NSLLNPVIY  F+ DF++AF KIL
Sbjct:  321 VKTLGIIMGTFIFCWLPFFIVALVLPFC-QDCFMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKIL 391          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 176.022 bits (445), Expect = 1.927e-48
Identity = 123/461 (26.68%), Postives = 218/461 (47.29%), Query Frame = 1
Query:  376 LVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGK--CLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSD-DRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVI-KGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            + +++L T+ GN  VI A+L  ++L    N  ++SLA AD++VA+LV+  S+  E+   W+     C++ +  DVL C++SI+HL AI++DRY+++++P  Y   RT ++I   I ++WL+S +IS P    +++      Q+   D +  C +N++  + ++ST G+F+ P   +I +Y RI                    + ++K+   C       +S     ++ G +G                           +D  NN +IA +  +      ++T++   +   R+   +      +     +   H          A   N N+  +  + K P +++   NI           +++      R+K    RE++    LA++ G FI+CW PFF   ++   C   C++P  L +F  W+GYCNS LNP+IYTIF+ DFR AF KIL  R
Sbjct:   25 MTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKP-----QQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRI--------------------YQIAKKHTRCPPGEPRKDSAVGRELQNGKDGG--------------------------VDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGH---------DANGTNSNMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKILCKR 425          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 176.022 bits (445), Expect = 1.927e-48
Identity = 123/461 (26.68%), Postives = 218/461 (47.29%), Query Frame = 1
Query:  376 LVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGK--CLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSD-DRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVI-KGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            + +++L T+ GN  VI A+L  ++L    N  ++SLA AD++VA+LV+  S+  E+   W+     C++ +  DVL C++SI+HL AI++DRY+++++P  Y   RT ++I   I ++WL+S +IS P    +++      Q+   D +  C +N++  + ++ST G+F+ P   +I +Y RI                    + ++K+   C       +S     ++ G +G                           +D  NN +IA +  +      ++T++   +   R+   +      +     +   H          A   N N+  +  + K P +++   NI           +++      R+K    RE++    LA++ G FI+CW PFF   ++   C   C++P  L +F  W+GYCNS LNP+IYTIF+ DFR AF KIL  R
Sbjct:   25 MTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVSMDKP-----QQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRI--------------------YQIAKKHTRCPPGEPRKDSAVGRELQNGKDGG--------------------------VDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGH---------DANGTNSNMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMIVREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPDMCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFKKILCKR 425          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 167.162 bits (422), Expect = 2.026e-45
Identity = 78/188 (41.49%), Postives = 126/188 (67.02%), Query Frame = 1
Query:  364 TSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            TS ++  LILC++ GN+ V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++ + W LG   CD+++  D+LCC++SILHL AIA+DRY A+T P DY++ RT KR  ++I + W +   IS+P    +        + +     C+I+ +  +T++STF AFY+P+  ++ +Y RI++ 
Sbjct:   38 TSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQPKSRAEDMANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKA 225          

HSP 2 Score: 87.8113 bits (216), Expect = 4.776e-18
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            V+TL II G FI+CW PFFI+A ++PFC   C +P  L   + WLGY NSLLNP+IY  F+ DF+ AF KI+
Sbjct:  336 VKTLGIIMGTFILCWLPFFIKALVMPFC-PTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 406          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 160.614 bits (405), Expect = 4.254e-43
Identity = 78/188 (41.49%), Postives = 124/188 (65.96%), Query Frame = 1
Query:  364 TSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            TS ++  LILC++ GN+ V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++ + W LG   CD+++  D+LCC++SILHL AIA+DRY A+T P DY++ RT KR  ++I + W +   IS+P    +                C+I+ +  +T++STF AFY+P+  ++ +Y RI++ 
Sbjct:   38 TSLLIGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLDKWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGFSISIPPMLIMKSQ----------PKTCMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKA 215          

HSP 2 Score: 87.8113 bits (216), Expect = 4.734e-18
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            V+TL II G FI+CW PFFI+A ++PFC   C +P  L   + WLGY NSLLNP+IY  F+ DF+ AF KI+
Sbjct:  326 VKTLGIIMGTFILCWLPFFIKALVMPFC-PTCVMPLWLQDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 182.57 bits (462), Expect = 1.246e-50
Identity = 157/503 (31.21%), Postives = 236/503 (46.92%), Query Frame = 1
Query:  262 DTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTR--TAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTH-IECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMM---------SQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            DT N +  +  I+    G     +P Y +  + +T     +LI   V GN  V  A+  EK L   +NYLI+SLAVADL+VA+LVM   V+ E+   W      CD++V  DV+ C+ASIL+L AI+IDRY AV  P    TR  + +R+ +MI+++W+LS  IS P  F LN   +K          C+I D   F ++S+  +FY+P    + +Y +IY V                   + KR +        +N+K ++H +E   + +K  H  D K       ++    +    DK    S A N  +D  +  M     S S   K           + +K+   NH +  +   S       N N  S +  P K    N       +P+++          +++      ++KL Q +E+KA + LAI+ G FI+CW PFFI   +   C   C +P  L S   WLGY NS +NP+IYT F+ +FR AF KIL
Sbjct:    2 DTHNLSMYNDDINNGTNGTAVDQKPHYNYYAMLLT-----LLIFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTASKV---------CII-DNPAFVIYSSIVSFYVPFIVTLLVYVQIYIV-------------------LRKRRK-------RVNTKRNSHGVEVNAHKDKCTHPEDVKLCAVFVKSNGSFPT----DKKKVVSEAGNHPEDMDVEMMS----STSPPEK-----------TKHKSASPNHHQLAVPATSNQC---NNANLPSPVDSPYKAE-KNGHPKDSTKPAKVFEIQTMPNGKTRTSIKTMSKRKLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCN--CNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKIL 438          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 167.548 bits (423), Expect = 2.063e-45
Identity = 90/222 (40.54%), Postives = 137/222 (61.71%), Query Frame = 1
Query:  262 DTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            D +N T SS    +   GNV+    +   ++  +TS  L  LILC + GN+ VIAAI LE+ L  V+NYLI SLAV DLMV+ LV+ ++  +++   W LG   CD+++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R  ++I+I W++   IS+P          +          C I+++ G+T++STFGAFY+P+  ++ +Y +I++ 
Sbjct:    2 DALNNTTSSDHTPET--GNVT--EEEVALSYQIVTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPNA-----CKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKA 214          

HSP 2 Score: 90.1225 bits (222), Expect = 1.073e-18
Identity = 54/129 (41.86%), Postives = 71/129 (55.04%), Query Frame = 1
Query: 1348 LKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            ++V+  +NS S +  P     M      E R  R      ++          RERK V+TL II G FI CW PFFI A ++PFC + C +P LL   + WLGY NSLLNP+IY  F+ DF+ AF KI+
Sbjct:  283 IEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRNDRATDAKRKV-------ALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFC-ETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 162.54 bits (410), Expect = 4.201e-44
Identity = 89/204 (43.63%), Postives = 129/204 (63.24%), Query Frame = 1
Query:  316 NVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            N ++   + G T   + S  L +L L T   NS VIAAI++ + L + +NYLI SLAV D +VA LVM  S+ + + E W +G  ICD+W+  D+ CC+ SILHL AIA+DRY A+T   +Y R RT K    MIA++W++SI IS+P  F  ++   KE        +C+I +D I FT++STFGAFY+P+  I+ +Y +IY+
Sbjct:   10 NCTSEHLQKGITPKILISLTLSILTLMTTAINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIMYIMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPPLFWRHQALNKE-------DECIIKHDHIVFTIYSTFGAFYIPLALILILYYKIYK 206          

HSP 2 Score: 87.0409 bits (214), Expect = 7.524e-18
Identity = 47/103 (45.63%), Postives = 71/103 (68.93%), Query Frame = 1
Query: 1438 RPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            R +R+  + E+  Y++QK+   RERKA  TL +I G F++CW PFF++  IV  C + C +   +S+F+ WLGY NSL+NP+IYTIF+ DF+ AF K++  R+
Sbjct:  258 RNARVEMKQEK-AYRKQKISSTRERKAATTLGLILGAFVICWLPFFVKEVIVNIC-ESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLMRCRH 358          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1E (5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [Source:NCBI gene;Acc:100380026])

HSP 1 Score: 144.821 bits (364), Expect = 1.000e-37
Identity = 82/193 (42.49%), Postives = 117/193 (60.62%), Query Frame = 1
Query:  349 THIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            T   + S  L ++ + T + NS VI AI   K L   +NYLI SLAV D +VA LVM LS+ + + + W LG  IC++W+  D+ CC+ SILHL  IA+DRY A+T   +Y R RT KR  IMI  +W +S+ IS+P  F  N +       +    KC+I +D + +T++ST GAFY+P+  I+ +Y RIY 
Sbjct:   14 TEKMLISLTLAIITILTTVLNSAVILAICTTKKLHQPANYLICSLAVTDFLVAILVMPLSITYIVMDTWTLGYVICEIWLSVDMTCCTCSILHLCVIALDRYWAITDAIEYARKRTVKRAGIMILTVWTISVFISIPPLFWRNHH------NINIPSKCIIQHDHLIYTIYSTCGAFYIPLTLILILYYRIYH 200          

HSP 2 Score: 72.7886 bits (177), Expect = 3.337e-13
Identity = 40/107 (37.38%), Postives = 59/107 (55.14%), Query Frame = 1
Query: 1414 NNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            N+I     R  ++ S  ER              KA R L +I G FI+ W PFFI+  +V    + C + P ++ F+ WLGY NSL+NP++YT F+ DF+ AF K++
Sbjct:  263 NDIDIFGDRQQQISSSRER--------------KAARILGLILGAFILSWLPFFIKELVVGI--QLCTVSPEVADFLTWLGYVNSLVNPLLYTSFNDDFKLAFKKLI 353          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 142.51 bits (358), Expect = 7.919e-37
Identity = 74/173 (42.77%), Postives = 110/173 (63.58%), Query Frame = 1
Query:  406 GNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
             N+FVI  +   + L   +NYLI SLA  DL+V+ LV+ +++ + ++  W LG  ICD+W+  D+ CC+ASILHL  IA+DRY A+T   +Y + RT KR  +MIA++W+ SI IS+P  F   ++  +E+        C +N D I +TV+ST GAFY+P   +I +Y RIY
Sbjct:   35 SNAFVITTVYQTRKLHTPANYLIASLAFTDLLVSILVLPIAIVYTVTGKWTLGQIICDMWLSSDITCCTASILHLCVIALDRYWAITDAVEYTKKRTPKRAVVMIALVWVFSISISMPPLF-WRQSKAEEI------AVCAVNTDHILYTVYSTVGAFYIPTLLLIALYGRIY 200          

HSP 2 Score: 87.8113 bits (216), Expect = 4.360e-18
Identity = 36/73 (49.32%), Postives = 50/73 (68.49%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TL +I G +IVCW PFFI + ++P C   C   P +  F  WLGY NSL+NP+IYT+ + DF+ AFHK++
Sbjct:  279 ATKTLGVILGAYIVCWLPFFIISLVMPICKDACWFHPAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 351          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 176.407 bits (446), Expect = 1.247e-48
Identity = 93/227 (40.97%), Postives = 140/227 (61.67%), Query Frame = 1
Query:  259 FDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPT----RFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            F      N++ S+     G   T      +++  ITS +L  LI C V+GN+ V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++   W LG   CDL++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R   +I++ WL+  +IS+P     R   +R+   E         C I+ + G+T++STFGAFY+P+  ++ +Y RI++ 
Sbjct:    4 FSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSNPNE---------CTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRA 221          

HSP 2 Score: 99.7525 bits (247), Expect = 6.440e-22
Identity = 50/98 (51.02%), Postives = 68/98 (69.39%), Query Frame = 1
Query: 1441 PSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            P+ +  ++ER    ++K+   RERK V+TL II G FI+CW PFFI A ++PFC   C +P LL + + WLGY NSLLNPVIY  F+ DF++AF KI+
Sbjct:  318 PACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1f (5-hydroxytryptamine (serotonin) receptor 1F [Source:MGI Symbol;Acc:MGI:99842])

HSP 1 Score: 155.221 bits (391), Expect = 1.923e-41
Identity = 82/189 (43.39%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            + S  L  L L T   NS VIAAI++ + L + +NYLI SLAV D +VA LVM  S+ + + E+W +G  +CD+W+  D++CC+ SILHL AIA+DRY A+T   +Y R RT +   IMI I+W++S+ IS+P  F  ++  ++       D +C+I +D I  T++STFGAFY+P+  I+ +Y +IY+
Sbjct:   25 LVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHAGIMITIVWVISVFISMPPLFWRHQGTSR-------DDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYR 206          

HSP 2 Score: 90.5077 bits (223), Expect = 4.861e-19
Identity = 38/77 (49.35%), Postives = 56/77 (72.73%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A  TL +I G F++CW PFF++  +V  C +KC++   +S+F+ WLGY NSL+NP+IYTIF+ DF+ AF K++  RY
Sbjct:  291 AATTLGLILGAFVICWLPFFVKELVVNVC-EKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRY 366          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 147.902 bits (372), Expect = 1.123e-38
Identity = 77/173 (44.51%), Postives = 106/173 (61.27%), Query Frame = 1
Query:  406 GNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
             N+FVIA +   + L   +NYLI SLAV DL+V+ LVM +S  + ++  W LG  +CD W+  D+ CC+ASI+HL  IA+DRY A+T   +Y   RT KR  IMI ++W+ SI IS+P  F       +EM        C +N D + +TV+ST GAFYLP   +I +Y RIY
Sbjct:   62 SNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFFWRQAKAEEEML------DCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIY 228          

HSP 2 Score: 83.9593 bits (206), Expect = 8.086e-17
Identity = 37/73 (50.68%), Postives = 49/73 (67.12%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TL II G FIVCW PFFI + ++P C   C     +  F  WLGY NSL+NP+IYT+ + DF+ AFHK++
Sbjct:  308 ATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 147.902 bits (372), Expect = 1.123e-38
Identity = 77/173 (44.51%), Postives = 106/173 (61.27%), Query Frame = 1
Query:  406 GNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
             N+FVIA +   + L   +NYLI SLAV DL+V+ LVM +S  + ++  W LG  +CD W+  D+ CC+ASI+HL  IA+DRY A+T   +Y   RT KR  IMI ++W+ SI IS+P  F       +EM        C +N D + +TV+ST GAFYLP   +I +Y RIY
Sbjct:   62 SNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPPFFWRQAKAEEEML------DCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIY 228          

HSP 2 Score: 83.9593 bits (206), Expect = 8.086e-17
Identity = 37/73 (50.68%), Postives = 49/73 (67.12%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TL II G FIVCW PFFI + ++P C   C     +  F  WLGY NSL+NP+IYT+ + DF+ AFHK++
Sbjct:  308 ATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLINPIIYTMSNEDFKQAFHKLI 380          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Match: Drd2 (dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94924])

HSP 1 Score: 133.265 bits (334), Expect = 4.911e-33
Identity = 82/200 (41.00%), Postives = 114/200 (57.00%), Query Frame = 1
Query:  331 RPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTR--TAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            RP Y +  + +T     +LI   V GN  V  A+  EK L   +NYLI+SLAVADL+VA+LVM   V+ E+   W      CD++V  DV+ C+ASIL+L AI+IDRY AV  P    TR  + +R+ +MIAI+W+LS  IS P  F LN     E         C+I +   F V+S+  +FY+P    + +Y +IY V
Sbjct:   31 RPHYNYYAMLLT-----LLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQNE---------CIIANP-AFVVYSSIVSFYVPFIVTLLVYIKIYIV 215          

HSP 2 Score: 78.9518 bits (193), Expect = 4.767e-15
Identity = 38/73 (52.05%), Postives = 48/73 (65.75%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A + LAI+ G FI+CW PFFI   +   C   C +PP+L S   WLGY NS +NP+IYT F+ +FR AF KIL
Sbjct:  372 ATQMLAIVLGVFIICWLPFFITHILNIHCD--CNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKIL 442          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q25414|5HTR_LYMST (5-hydroxytryptamine receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.308e-61
Identity = 106/195 (54.36%), Postives = 146/195 (74.87%), Query Frame = 1
Query:  340 YGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            Y   H+ +TS +L + +LC +IGN FVIAA++LE++L NV+NYLI+SLAVADLMVA LVM LSV  EIS+ WFL  E+CD+W+  DVLCC+ASILHLVAIA+DRY AVT  DY+R R+A+RI +MI ++W++++ IS+P  F   R+   +  +    G C+I+ + G+T+FST GAFYLPM  ++ IY RI+ V
Sbjct:   90 YSHEHLVLTSVILGLFVLCCIIGNCFVIAAVMLERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCTASILHLVAIAMDRYWAVTSIDYIRRRSARRILLMIMVVWIVALFISIPPLFGW-RDPNNDPDKT---GTCIISQDKGYTIFSTVGAFYLPMLVMMIIYIRIWLV 280          

HSP 2 Score: 115.546 bits (288), Expect = 6.346e-26
Identity = 53/77 (68.83%), Postives = 60/77 (77.92%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A RTLAIITG F++CW PFFI A I PF   +  +PP   SFVLWLGY NSLLNP+IYTIFSP+FR AF KILFG+Y
Sbjct:  429 AARTLAIITGAFLICWLPFFIIALIGPFVDPE-GIPPFARSFVLWLGYFNSLLNPIIYTIFSPEFRSAFQKILFGKY 504          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q25190|5HTR_HELVI (5-hydroxytryptamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 7.085e-53
Identity = 91/187 (48.66%), Postives = 130/187 (69.52%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            +TS VL ++IL T++GN FVIAAI++E+NL NV+NYL+ SLAVADLMVA LVM L   +E+S+ W LG E+CD+W   DVLC SASILHLVAIA DRY AVT  DY+  R  KRI+ MI ++W  ++++S+     L       + R+    KCL++ ++ + +F+T   FY+P+  I+ +Y +I+Q
Sbjct:   64 VTSVVLALIILATIVGNVFVIAAIIIERNLQNVANYLVASLAVADLMVACLVMPLGAVYEVSQGWILGPELCDMWTSSDVLCSSASILHLVAIATDRYWAVTDVDYIHIRNEKRIFTMIVLVWGAALVVSLAP--QLGWKDPDYLARITQQQKCLVSQDLAYQIFATMSTFYVPLAVILILYWKIFQ 248          

HSP 2 Score: 113.235 bits (282), Expect = 2.487e-25
Identity = 62/149 (41.61%), Postives = 82/149 (55.03%), Query Frame = 1
Query: 1336 KSKALKVNENL--------NSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            ++ A  +NE +        +S +V  G    R +    TH  +   + ++ ER              KA +TLAIITG F+ CW PFFI A ++P C + C +   L+SF LWLGY NS LNPVIYTIFSPDFR AF +ILFG +   R
Sbjct:  329 RTTAFTINEKVPPSVSPEKSSSTVTNGSKPERAIVPAPTHREKKESLEAKRER--------------KAAKTLAIITGAFVFCWLPFFIMALVMPIC-QTCVISDYLASFFLWLGYFNSTLNPVIYTIFSPDFRQAFARILFGTHRRRR 462          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|P28285|5HT2A_DROME (5-hydroxytryptamine receptor 2A OS=Drosophila melanogaster OX=7227 GN=5-HT1A PE=2 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 2.586e-52
Identity = 94/192 (48.96%), Postives = 139/192 (72.40%), Query Frame = 1
Query:  352 HIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFH-LNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
             + +TS +L ++IL T+IGN FVIAAI+LE+NL NV+NYL+ SLAVADL VA LVM L   +EIS+ W LG E+CD+W   DVLCC+ASILHLVAIA+DRY AVT  DY+ +RT+ R+++MI  +W  ++++S+  +F   + +Y   +QR+    KC+++ ++ + VF+T   FY+P+  I+ +Y +IYQ 
Sbjct:  225 RMAVTSVLLGLMILVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISQGWILGPELCDIWTSCDVLCCTASILHLVAIAVDRYWAVTNIDYIHSRTSNRVFMMIFCVWTAAVIVSLAPQFGWKDPDY---LQRIEQQ-KCMVSQDVSYQVFATCCTFYVPLLVILALYWKIYQT 412          

HSP 2 Score: 107.071 bits (266), Expect = 1.103e-22
Identity = 47/77 (61.04%), Postives = 57/77 (74.03%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A +TLAIITG F+VCW PFF+ A  +P C   CQ+   ++S  LWLGY NS LNPVIYTIFSP+FR AF +ILFG +
Sbjct:  749 AAKTLAIITGAFVVCWLPFFVMALTMPLCAA-CQISDSVASLFLWLGYFNSTLNPVIYTIFSPEFRQAFKRILFGGH 824          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|Q17239|5HTR_BOMMO (5-hydroxytryptamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 4.670e-50
Identity = 91/180 (50.56%), Postives = 127/180 (70.56%), Query Frame = 1
Query:  382 VLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            +LIL TV+GN FVIAAILLE++L + +N LI+SLAVADL+VA LVM L   +E+ + W LG E+CD+W   DVLCC+ASILHLVAIA+DRY AVT  DY+   TAKR+ +MIA +W +S  + +     L        QRV  D +C+++ ++G+ +F+T  +FY+P+  I+ +Y RIYQ
Sbjct:   70 LLILATVVGNVFVIAAILLERHLRSAANNLILSLAVADLLVACLVMPLGAVYEVVQRWTLGPELCDMWTSGDVLCCTASILHLVAIALDRYWAVTNIDYIHASTAKRVGMMIACVWTVSFFVCIAQL--LGWKDPDWNQRVSEDLRCVVSQDVGYQIFATASSFYVPVLIILILYWRIYQ 247          

HSP 2 Score: 100.523 bits (249), Expect = 3.021e-21
Identity = 45/75 (60.00%), Postives = 57/75 (76.00%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFG 1740
            A +TLAIITG F+ CW PFF+ A +VP C   C++ P+L+S  LWLGY NS LNPVIYT+FSP+FR AF ++L G
Sbjct:  364 AAKTLAIITGAFVACWLPFFVLAILVPTC--DCEVSPVLTSLSLWLGYFNSTLNPVIYTVFSPEFRHAFQRLLCG 436          
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Match: sp|O42385|5H1AA_TAKRU (5-hydroxytryptamine receptor 1A-alpha OS=Takifugu rubripes OX=31033 GN=htr1aa PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.276e-49
Identity = 89/189 (47.09%), Postives = 130/189 (68.78%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            ITS  L  LILC++ GNS V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++   W LG +ICDL++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R  ++I++ WL+   IS+P        +     R   D  C+I+ + G+T++STFGAFY+P+  ++ +Y RI++ 
Sbjct:   47 ITSLFLGALILCSIFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQDICDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISVTWLIGFSISIPPML----GWRSAEDRANPDA-CIISQDPGYTIYSTFGAFYIPLILMLVLYGRIFKA 230          

HSP 2 Score: 98.5969 bits (244), Expect = 1.279e-20
Identity = 62/149 (41.61%), Postives = 84/149 (56.38%), Query Frame = 1
Query: 1318 RKYILKKSK-----ALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQS-----ERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            R Y  K S      A++  E + S+ +I+      + +N  TH   P+   S S     E+    R+K+   RERK V+TL II G FI CW PFFI A ++PFC + C +P  L + + WLGY NSLLNP+IY  F+ DF+ AF KIL
Sbjct:  274 RGYKFKPSSPCANGAVRHGEEMESLEIIE------VNSNSKTHLPLPNTPQSSSHENINEKTTGTRRKIALARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCAENCYMPEWLGAVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIL 416          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A433UE96 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_000169 PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.561e-93
Identity = 191/476 (40.13%), Postives = 268/476 (56.30%), Query Frame = 1
Query:  340 YGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTH----IECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALN---CHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            Y   H+ +TS +L + +LC +IGN FVIAA++LE++L NV+NYLI+SLAVADLMVA LVM LSV  EIS+ WFL  E+CD+W+  DVLCC+ASILHLV IA+DRY AVT  DY+R R+A+RI +MI ++W++++ IS+P  F     +          G+C+I+ + G+T+FST GAFYLPM  ++ IYTRI+QV          R R+R       +S+P   +T  + S    +      C   G     N  +K S     +   S       K   + +      C  + ++    T+    S    + +  +   L    K  H+  L    ++        E+  S+++++   +T   NN S+     +      E++E        KRERKA RTLAIITG F++CW PFF+ A I PF      +P    SFVLWLGY NSLLNP+IYTIFSP+FR AF KILFG+Y
Sbjct:   95 YSQEHLILTSVILGLFVLCCIIGNCFVIAAVILERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCTASILHLVVIAMDRYWAVTSIDYIRRRSARRILLMITLVWIMALFISIPPLF----GWRDPDNDPDATGQCIISQDKGYTIFSTVGAFYLPMLVMMIIYTRIWQV---------ARSRIRKDKFQGGKSRPKTEETTLVASPKTEYSMVSANCNGCGSPESVNGGKKKSRIRLKSYGCSPRPERKKKGQVAKVQQQHSRCPSNVSVDLETTNGAQGSLGGSVASVPSMPSLPPTPKCEHLKQLPPVAIEPDPFTNGCEDEQSIAMLERHERTN-GNNGSSATANYTPYSRTREKLEL-------KRERKAARTLAIITGAFLICWLPFFVIALIGPFIDNPGNIPDFARSFVLWLGYFNSLLNPIIYTIFSPEFRSAFQKILFGKY 549          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A193KUQ4 (GCR083 OS=Schmidtea mediterranea OX=79327 GN=gcr083 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.452e-82
Identity = 138/202 (68.32%), Postives = 166/202 (82.18%), Query Frame = 1
Query:  319 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            V+ F PK+GW H+Y+TS VL  LILCT+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVASLVMS+S+  EIS+ WFLG+E+CD WVCFDVLCCSASILHLVAIA DRY AVT  DY+R RTAKRI IMI I+W LSI+IS+P+RF+ +R +    + VV DG C INDE  +T+FST GAFY+PMF +IGIY +IYQ 
Sbjct:   19 VARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQT 220          

HSP 2 Score: 135.191 bits (339), Expect = 1.326e-29
Identity = 58/77 (75.32%), Postives = 67/77 (87.01%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A RTLAIITGCFI+CW PFFIQA  +PFCG++C    + SSF LWLGYCNSLLNP+IYTIFSP+FR+AF+KILFGRY
Sbjct:  533 AARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 609          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A210PW26 (5-hydroxytryptamine receptor OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19223 PE=3 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 3.993e-82
Identity = 171/475 (36.00%), Postives = 243/475 (51.16%), Query Frame = 1
Query:  334 PKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            P+Y +        +L  +I+ T+IGN FVIAAIL+EK+L  VSNYLI+SLAV DLMVA LVM +S+ +++S  W+LG  +CD+W+CFDVLCC+ASILHLVAI++DR+ AV+  DY+R R AK+I IMIAI+W+++ +IS+P  F     +          G C+I+ ++ +TVFST GAFY PM  +I +  +IY             +    + H S  S+P  C T    +K++      ++G  V H  DE                 +     N   A+N  + +                                T+ +N   KY+   S    VN+ L   +        + +        R +++  + ER              KA R L IITG F+ CW PFF  A + PFCG+ C L   L S  LWLGY NSLLNP+IYTIF+P FR AF K+++ +Y   R
Sbjct:   62 PRYSFPIFLFIVILLGFMIISTIIGNVFVIAAILMEKSLQGVSNYLILSLAVTDLMVAVLVMPISLVNQVSIFWYLGAHLCDMWICFDVLCCTASILHLVAISLDRFWAVSNIDYIRRRCAKQICIMIAIVWVVAAIISIPPIF----GWKDPGNDPDVLGVCMISQDLAYTVFSTVGAFYFPMTLMIILNLKIYMA----------ARSRIRRKHFSGISRPVGCPT---ITKAEATTRNNSSGSDVSH--DE--------------YTVYNGSCVNEETAMNVSETN-------------------------------GTVTVNGGEKYLAVPSAVYIVNKPLTVSNSKVNNNNHKRIRQRDRERTRKAKVEMKRER--------------KAARVLGIITGAFLACWLPFFFGALVGPFCGENCFLTADLMSTFLWLGYFNSLLNPIIYTIFNPSFRTAFRKLIYRKYRYRR 458          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A481S9X3 (Serotonin receptor 1A OS=Nephotettix cincticeps OX=94400 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 4.728e-80
Identity = 189/495 (38.18%), Postives = 271/495 (54.75%), Query Frame = 1
Query:  259 FDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHL-NRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFG 1740
            FD ++  NSS         N + F        + I S VL ++IL TVIGN FVIAAILLE+NL NV+NYL++SLAVADLMVA LVM L   +EIS  W LG E+CD+W   DVLCC+ASILHLVAIA+DRY AVT  DY+ TR   RI  MI ++W +++++S+  +F   + +Y   + R+    +CLI+ ++G+ +F+TF  FY+P+  I+ +Y +IYQ AR RIRR+  ++    +   S+       K GF+  K    ++ G++                      + S   I+  +  S      +D +      D    +    I ++++     ++      N+   +    SK    N   +S S++  P        +    H P R   ++  +E        KRE+KA +TLAIITG F+VCW PFFI A ++P C   C++ P L+SF LWLGY NS LNPVIYTIFSP+FR AF +IL G
Sbjct:  156 FDNVSLVNSS------LGANTTIFDDDSNAIVMGIMSVVLGIIILVTVIGNVFVIAAILLERNLQNVANYLVMSLAVADLMVACLVMPLGAVYEISRGWILGPELCDMWTSSDVLCCTASILHLVAIAVDRYWAVTNIDYIHTRNGGRIIGMIVVVWSVALVVSLAPQFGWKDPDY---LDRINNQQRCLISQDVGYQIFATFSTFYVPLLVILVLYWKIYQTARKRIRRRRAQRNAVLESCKSREVTQEKSKLGFLKKKRFLRMKSGDSKSTT---------------EGLAASLVLIEGQSTCSTVDAVEEDVSRRPSNVDVPEATTAFTISSNHDATTPRTESPEKSANNGSAHPSDPSKQTLTNTKDSSTSLVPTPV-------LKPANHPPKR--DKARDLE-------AKREKKAAKTLAIITGAFVVCWLPFFIMALLMPLC-DSCEINPYLASFFLWLGYFNSTLNPVIYTIFSPEFRMAFKRILCG 609          
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Match: A0A1A9WA30 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Glossina brevipalpis OX=37001 PE=3 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.682e-77
Identity = 165/465 (35.48%), Postives = 254/465 (54.62%), Query Frame = 1
Query:  373 VLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSD-DRKIXXXXXXXXXXXDYKTIHINHLR-------KYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
             L ++IL T+IGN FVIAAI+LE+NL NV+NYL++SLAVADL VA LVM L   +EIS+ W LG E+CD+W   DVLCC+ASILHLVAIA DRY  VT  DY   RT +RI+ MI  +W  ++++S+  +F       + M R+  + KC+++ ++ + +F+T  +FY+P+  I+ +Y +IY++               ++  + +R+Q           + D   +      K+C   +                    +K   SS A N    S ++       S S+ D K     +   ++ +  TI+ N  R         + ++  A       +  +++      R    +   E   SR  +  +++  +RQ++E KRERKA +TLAIITG F+VCW PFF+ A ++  C K C++   ++SF LWLGY NS LNP+IYTIF+P+FR AF ++LFG+
Sbjct:  119 ALGLMILITIIGNVFVIAAIILERNLQNVANYLVVSLAVADLFVACLVMPLGAVYEISKGWILGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTNIDYHNLRTPRRIFCMIFTVWFFAVIVSLAPQFGWKD--PEYMDRIEKE-KCMVSQDVAYQIFATCCSFYVPLLVILVLYWKIYKI---------------ARKRIKRRTQRLRIAAAAKAKEPDLVSKNEKKRLKICFTKN-----------------VSTEKATGSSNAFNYAGSSNLNVREETEFSTSNYDSKSHAGTDLTTVSDENTTINANEERSPMPMEVSTVSQQVAATTSKFQQHITAIVLNSVSPRPSATVDNKEQISSRSTNPHQKLAKRRQQIEAKRERKAAQTLAIITGAFVVCWLPFFVMALLLSLC-KTCEINETVASFFLWLGYLNSTLNPIIYTIFNPEFRRAFQRLLFGK 547          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 171.785 bits (434), Expect = 4.550e-47
Identity = 81/188 (43.09%), Postives = 128/188 (68.09%), Query Frame = 1
Query:  364 TSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            TS ++  LILC+V GNS V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++ + W LG   CD+++  D+LCC++SILHL AIA+DRY A+T P DY++ RT KR  ++I + WL+   IS+P    +      + + +     C+I+ +  +T++STF AFY+P+  ++ +Y RI++ 
Sbjct:   40 TSVLIGALILCSVFGNSCVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMACLYQVLDRWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAAVLIGVTWLVGFSISIPPMLIMKSQPKSKAEDIANPEACMISHDPWYTIYSTFCAFYIPLILMLVLYGRIFKA 227          

HSP 2 Score: 90.1225 bits (222), Expect = 7.554e-19
Identity = 41/72 (56.94%), Postives = 52/72 (72.22%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            V+TL II G FI+CW PFFI+A ++PFC   CQ+P  L   + WLGY NSLLNP+IY  F+ DF+ AF KI+
Sbjct:  338 VKTLGIIMGTFILCWLPFFIKALVMPFC-PSCQMPVWLMDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 408          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000047213.1 (5-hydroxytryptamine receptor 1E [Source:NCBI gene;Acc:103023646])

HSP 1 Score: 157.147 bits (396), Expect = 3.472e-42
Identity = 92/220 (41.82%), Postives = 129/220 (58.64%), Query Frame = 1
Query:  403 IGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIEC 1056
            I NS VIAAI   + L   +NYLI SLAV D +VA LVM LS+ + I++ W LG  +C++W+  D+ CC+ SILHL  IA+DRY A+TK  +Y R RT +R  +M+  +W +SI ISVP  F  NR+             C I +D++G+T++STFGAFY+PM  I+ +Y+RIY         +   ++  S  H+S RS     +   IN    TH  C
Sbjct:   52 IMNSAVIAAIFTTRKLQLPANYLICSLAVTDCLVAVLVMPLSILYIITDKWCLGKVVCEVWLSVDMTCCTCSILHLCVIALDRYWAITKAIEYARKRTPRRAIVMVTCVWAISIFISVPPLFWRNRSAGSNGT-----TDCFIEHDQVGYTIYSTFGAFYIPMTLILILYSRIYSA------AKTLYQKRGSSRHLSSRSTD--SQNSHINHCRVTHAFC 258          

HSP 2 Score: 72.7886 bits (177), Expect = 2.440e-13
Identity = 38/77 (49.35%), Postives = 50/77 (64.94%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPL-LSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            A R L +I G FI CW PFFI+  ++   G K   P   +S F+ WLGY NSL+NP++YT F+ DF+ AF K+L GR
Sbjct:  294 AARILGLILGAFIACWLPFFIKELLM---GLKLLNPSRKVSDFLTWLGYVNSLINPLLYTSFNEDFKQAFKKLL-GR 366          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000026144.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14357937:14360657:1 gene:ENSAMXG00000025418.2 transcript:ENSAMXT00000026144.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 3.687e-42
Identity = 80/186 (43.01%), Postives = 124/186 (66.67%), Query Frame = 1
Query:  367 SGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            S +L V+ L T++ N+FVIA I L + L   +N+LI SLA+ DL+V+ LVM +S+ + +S+ W LG  +CD+W+  D+  C+ASILHL  IA+DRY A+T   +Y + RT +R  +MI ++W++SI IS+P  F       +E+       +CL+N D+I +T++STFGAFY+P   ++ +Y RIY
Sbjct:   29 SALLAVVTLATMLSNAFVIATIFLTRKLHTPANFLIGSLALTDLLVSILVMPISIVYTVSKTWTLGQIMCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYSKRRTTRRAALMIGVVWVISISISIPPLFWRQAKAHEELT------ECLVNTDQISYTLYSTFGAFYVPTILLVILYGRIY 208          

HSP 2 Score: 84.7297 bits (208), Expect = 2.850e-17
Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TL II G FIVCW PFF+   ++  C K C   P+L  F  WLGY NSL+NPVIYT F+ +F+ AF K++
Sbjct:  293 ATKTLGIILGAFIVCWLPFFVVTLVMAIC-KDCWFHPVLFDFFTWLGYLNSLINPVIYTAFNDEFKQAFQKLI 364          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: HTR1F (5-hydroxytryptamine receptor 1F-like [Source:NCBI gene;Acc:103023679])

HSP 1 Score: 154.836 bits (390), Expect = 2.404e-41
Identity = 97/225 (43.11%), Postives = 136/225 (60.44%), Query Frame = 1
Query:  268 MNFTN-SSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPT----RFHLNRNYTKEMQRVVYDGKCLI-NDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQ 921
            M+  N S+  +S +  G +S  +         + S +L VL + T I NS VI AIL+ + L   +NYLI SLAV DL+VA LVM +S+ +   E W LG  +C LW+  DV CC+ SILHL AIA DRY A+T    Y + RT++R    I ++W+LSI++S+P     RF   R    +  RVV D  CLI +D + FTV+STFGAFY+P+  I+ +Y +IY+
Sbjct:    1 MDLQNCSAPDLSDVLDGRISPGK--------ILLSLMLSVLAVATTIINSLVITAILVTRKLHQPANYLICSLAVTDLLVAVLVMPVSIIYIAEEEWVLGPIVCHLWLGVDVTCCTCSILHLAAIAHDRYRAITDAVAYSQKRTSRRAAATIIVLWVLSILVSLPPLMWRRFPNIREQIGD--RVVMD--CLIEHDHVAFTVYSTFGAFYIPLTLILVLYYKIYR 213          

HSP 2 Score: 82.0333 bits (201), Expect = 1.971e-16
Identity = 37/73 (50.68%), Postives = 49/73 (67.12%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A  TL +I G F++CW PFF++  IV  C   C     L+ F+ WLGY NSL+NP+IYTIF+ DF+ AF K+L
Sbjct:  290 AALTLGLILGAFVICWLPFFLKEVIVNSC-PSCSTSAFLADFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLL 361          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000006138.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27993956:27999385:-1 gene:ENSAMXG00000005992.2 transcript:ENSAMXT00000006138.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 7.958e-40
Identity = 78/183 (42.62%), Postives = 120/183 (65.57%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIY 906
            +TS +L  LIL +++GN+ VIAAI LE++L  ++NYLI SLAV DL+V+ LV+ ++  +++ + W LG   CDL++  DVLCC++SILHL AIA+DRY A+T P  Y+  RT  R   +I++ WL+   IS+P          +         +C I+ + G+T+FSTFGAFY+P+  ++ +Y
Sbjct:   35 LTSLLLGALILMSIVGNACVIAAIALERSLQTINNYLIGSLAVTDLLVSVLVLPMAALYQVLQRWTLGQVACDLFIALDVLCCTSSILHLCAIALDRYWAITDPVAYMTRRTLCRAATLISLTWLVGFSISIPPMLGWRTPEDRANPL-----ECTISQDPGYTIFSTFGAFYIPLALMLVLY 212          

HSP 2 Score: 102.064 bits (253), Expect = 6.767e-23
Identity = 44/76 (57.89%), Postives = 56/76 (73.68%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            V+TL II G FI+CW PFFI A ++PFCG  C +PP L + + WLGY NSLLNPVIY  F+ DF++AF K+L  R+
Sbjct:  329 VKTLGIIMGTFILCWLPFFIVALVLPFCGSSCPMPPWLGAVINWLGYANSLLNPVIYAYFNRDFQNAFRKMLRCRF 404          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.94 bits (437), Expect = 1.573e-48
Identity = 85/189 (44.97%), Postives = 126/189 (66.67%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            I+S  L  LILC + GNS VIAAI LE+ L NV+NYLI SLAV DL+V+ LV+ ++  +++ + W LG  +CD+++  DVLCC++SILHL  IA+DRY A+T P DYV  RT +R  IMI++ WL+   IS+P          +  +       C I+ + G+T++STFGAFY+P+  ++ +Y+RI++ 
Sbjct:   38 ISSLCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGW-----RTPEDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRA 221          

HSP 2 Score: 68.9366 bits (167), Expect = 8.003e-13
Identity = 28/49 (57.14%), Postives = 38/49 (77.55%), Query Frame = 1
Query: 1588 IVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            I PFCG++C LPP + + + WLGY NSLLNP+IY  F+ DF++AF KI+
Sbjct:  333 ISPFCGERCHLPPGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 381          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 4.797e-45
Identity = 84/188 (44.68%), Postives = 125/188 (66.49%), Query Frame = 1
Query:  364 TSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            TS  L  LI C++ GN+FV+AAI LE++L  V+NYLI SLAV DL+V+ LV+ ++  +++   W LG  +CD ++  DVLCC++SILHL AIA+DRY A+T P DYV  RT +R  +MIAI W++   IS+P        + +   R   D  C I+  +G+T++STFGAFY+P+  ++ +Y +I+  
Sbjct:    5 TSSALGALIACSIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPML----GWRQAEDRADPDA-CNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSA 187          

HSP 2 Score: 56.9954 bits (136), Expect = 5.325e-9
Identity = 21/32 (65.62%), Postives = 26/32 (81.25%), Query Frame = 1
Query: 1588 IVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPV 1683
            +VPFCG  C+LPP+L + + WLGY NSLLNPV
Sbjct:  334 VVPFCGPPCELPPILMALITWLGYSNSLLNPV 365          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 155.221 bits (391), Expect = 1.156e-41
Identity = 79/174 (45.40%), Postives = 112/174 (64.37%), Query Frame = 1
Query:  409 NSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVT-KPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            N+ VIAAI   + L   +NYLI SLAVADL+VA+LVM ++  + ++  W LG  +CDLW+  DV CC+ASILHL AIA+DR+ A+T   +Y   RT  R  +MIA  WLL+  ISVP  F   R+  K         +C+I  D + +T++STFGAFY+P+  ++ +Y RI++ 
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRRDPAKP--------RCIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRA 230          

HSP 2 Score: 85.8853 bits (211), Expect = 3.972e-18
Identity = 50/134 (37.31%), Postives = 79/134 (58.96%), Query Frame = 1
Query: 1339 SKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQ--SERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            ++A +  ++  SVS +   +K  L         R  R MS    +R    ++++   RER+A +TL +I G F+VCW PFFI+  +V  C K C + P ++  + WLGY NSL+NP+IYT+F+ DF+ AF K++
Sbjct:  295 AQAERSGQHQQSVSAVARRSKRSL------RPPRSVRFMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVNLC-KSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 133.65 bits (335), Expect = 7.599e-34
Identity = 69/201 (34.33%), Postives = 120/201 (59.70%), Query Frame = 1
Query:  337 KYGWTHIYIT----SGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            K GW +  +     S ++++L+  TV GN  VI A+L   +L    N  ++SLA AD++VA+LV+  S+F+E+   W+ G   C++++  DVL C++SI+HL AI++DRY +V++  +Y   RT +RI  +I I+W ++I IS+P    +N+   ++ Q  V    C +N    + + S  G+F+ P   ++ +Y RIY +
Sbjct:   41 KLGWEYSVLAGLGLSSLVLILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQK-NRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHL 240          

HSP 2 Score: 81.6481 bits (200), Expect = 1.179e-16
Identity = 35/70 (50.00%), Postives = 46/70 (65.71%), Query Frame = 1
Query: 1528 LAIITGCFIVCWQPFFIQATIVPFCG-KKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            L+++ G F++CW PFF   ++   C  + C +P  L  F  W GYCNS LNPVIYT+F+ DFR AF KIL
Sbjct:  385 LSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKIL 454          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006411.1 (pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 gene:ENSPMAG00000005791.1 transcript:ENSPMAT00000006411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 2.815e-31
Identity = 74/175 (42.29%), Postives = 107/175 (61.14%), Query Frame = 1
Query:  409 NSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEA-WFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIY-IMIAIIWLLSIMISVPTRFHLNRN-YTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            N  VI  IL  K    V + L+ S+AV+D++VA+LVM LS+  E+ E  W LG  +CD+W+  DVLCC+ASI ++ AIA+DR+ ++T+     TR  K I  +MIA+ WLLS  IS+   F      Y+ E QR      C ++    +TVFST GAFYLP+  ++ +Y +IY+ 
Sbjct:   50 NVLVIVTILRVKTFHRVPHNLVASMAVSDVLVAALVMPLSLVSEVHERRWRLGPVMCDVWISCDVLCCTASIWNVTAIALDRFWSITRHLEYTTRARKCISNLMIALTWLLSATISLSPLFGWGEGYYSAESQR------CHLSQGPSYTVFSTVGAFYLPLCVVLFVYWKIYKA 218          

HSP 2 Score: 75.8702 bits (185), Expect = 4.015e-15
Identity = 33/76 (43.42%), Postives = 46/76 (60.53%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            A   + I+   F++CW PFFI+  I P C   C +PP+  S  LWLGY NS  NP+IYT F+ ++ +AF  I F +
Sbjct:  276 AALMVGILIAVFVLCWIPFFIKELISPLCS--CDVPPVWKSIFLWLGYSNSFFNPLIYTAFNKNYNNAFRNIFFTK 349          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 103.99 bits (258), Expect = 1.322e-24
Identity = 70/189 (37.04%), Postives = 110/189 (58.20%), Query Frame = 1
Query:  364 TSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEI-SEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
             S V+ +LIL  V GN  V  AIL  + L  V+NY IISLAV+DL+VA L M   + H + S  W LG+ +C+ W+  D++C SASI +L  I++DR++A++ P  Y    T +R  + IA++W  S++IS    F L  +    MQ +     C + D+  +T   T G F+LP+  ++  Y+ +++V
Sbjct:   13 ASFVIFILIL-DVCGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLISA-LSFTLPWSPDGLMQDI---PACSLKDKYYYTFVITVG-FFLPLVVLVIAYSLVFKV 195          

HSP 2 Score: 59.3066 bits (142), Expect = 1.435e-9
Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGK----------KCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A +TLAI+ G FIVCW PFF+    V FC +          K QL  + + FV  L   NS +NP+IY+ F+ +FR AF  IL
Sbjct:  221 ATKTLAIVVGSFIVCWLPFFVIMFTVQFCPECFQDHRSLPVKAQL-AIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAFKDIL 302          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 103.605 bits (257), Expect = 1.769e-24
Identity = 62/191 (32.46%), Postives = 105/191 (54.97%), Query Frame = 1
Query:  355 IYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            + + SG+L +LI+ T+ GNS V AA  L ++L  V+NY ++SLA+ADL+V  + M L   + + +      EI  LW+CFD+   +ASI++L  I++DR+ A+T P  Y +  T KR  + I  +WL +  +S           ++ +   +   +       G+T F    +F++P+  +I  YTRI+ V
Sbjct:    1 VVLASGLLALLIVGTIFGNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLVFQWPPQNSEIYALWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLAIVFVWLYAFAVSS----------SRAISFAIPSRESRAQFSFGYTFFVATASFFVPLPVMIYCYTRIFSV 181          

HSP 2 Score: 63.1586 bits (152), Expect = 6.534e-11
Identity = 49/149 (32.89%), Postives = 72/149 (48.32%), Query Frame = 1
Query: 1312 HLRKYILKKSKALKVNENLNSV-SVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATI-------VPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            + R + + + +A K+ E L+SV S I+ P              RP      S R++    +     + KA +TLAI+ G F++CW P+ I   +       VPF  K       L+  V WL Y NS LNP+IYT  +  FRDAF ++L
Sbjct:  175 YTRIFSVARVQAAKIRE-LDSVRSFIESPRN---------GNSRPVLTSQSSFRLQ----RRALSTDIKAAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKYT-----LAKAVKWLVYSNSALNPIIYTALNRAFRDAFKRVL 304          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 96.2857 bits (238), Expect = 5.182e-22
Identity = 57/185 (30.81%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  379 VVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISE--AWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            + ++L T  GN  V+ A++L   +  ++NY ++SLAV+DL+VA+L +   + H+ +   AW LGLE C  W+  D++CC ASI +L  I++DR++A+  P  Y    T      +I  +W+LS+ + + +  +     +        + +C   D + +TV S  G F+LP+F ++ +Y +++ V
Sbjct:    6 IFILLVTFYGNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRI-HQTTHNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELGSPHFH---IEVQCRKFDPVYYTVVSVVG-FFLPLFIVLLMYGQVFVV 185          

HSP 2 Score: 56.9954 bits (136), Expect = 6.105e-9
Identity = 34/82 (41.46%), Postives = 44/82 (53.66%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLS---------SFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            A + LAI+ GCF+VCW PFF+  T+V            +S         +FV  L   NS LNP+IY +F+ DFR AF KI 
Sbjct:  217 AAKILAIVVGCFVVCWFPFFV-LTLVSLWEPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAFGKIF 297          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 96.6709 bits (239), Expect = 9.118e-22
Identity = 63/188 (33.51%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  367 SGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEIS-EAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAK-RIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            +G +VV++   + GN  V  AI   + L +V+NYLI SLAV+DL+VA L M   ++H +    W LGL +C  W+  D LC  ASI +L  IAIDRY+ ++ P   R +  K R +I I  +WL + +I+      L   ++ +     +   C   D+  +  F+   +F+LP+  +I  Y+ +++V
Sbjct:   23 AGFVVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA---SLSLTEPWSPDGFNASFPA-CAKMDKY-YYAFAITMSFFLPLVVLIIAYSMVFKV 205          

HSP 2 Score: 61.6178 bits (148), Expect = 3.303e-10
Identity = 37/90 (41.11%), Postives = 50/90 (55.56%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFC---------GKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            A +TL+I+ G FI CW PFFI   IV FC          K+ Q+  + + FV  L   NS  NP+IY+ F+ DFR AF  IL   + ++R
Sbjct:  260 ATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQM-TIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMFRLHR 348          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 96.2857 bits (238), Expect = 1.500e-21
Identity = 63/188 (33.51%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  367 SGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEIS-EAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAK-RIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            +G +VV++   + GN  V  AI   + L +V+NYLI SLAV+DL+VA L M   ++H +    W LGL +C  W+  D LC  ASI +L  IAIDRY+ ++ P   R +  K R +I I  +WL + +I+      L   ++ +     +   C   D+  +  F+   +F+LP+  +I  Y+ +++V
Sbjct:   34 AGFVVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA---SLSLTEPWSPDGFNASFPA-CAKMDKY-YYAFAITMSFFLPLVVLIIAYSMVFKV 216          

HSP 2 Score: 61.6178 bits (148), Expect = 3.288e-10
Identity = 37/90 (41.11%), Postives = 50/90 (55.56%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFC---------GKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            A +TL+I+ G FI CW PFFI   IV FC          K+ Q+  + + FV  L   NS  NP+IY+ F+ DFR AF  IL   + ++R
Sbjct:  271 ATKTLSIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQM-TIGTVFVYVLPLLNSAANPIIYSKFNADFRLAFKDILMSMFRLHR 359          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: drd2a (dopamine receptor D2 [Source:NCBI gene;Acc:101164579])

HSP 1 Score: 183.341 bits (464), Expect = 7.975e-51
Identity = 148/523 (28.30%), Postives = 246/523 (47.04%), Query Frame = 1
Query:  229 VFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTR--TAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGE-KVCHNLDE--------KXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPT-------KTRLMNNISTH---EHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            VFT + YN  F    + N + S       N +   PK+ + +  +   +L +LI   V GN  V  A+  EK L   +NYLI+SLAVADL+VA+LVM   V+ E+   W      CD++V  DV+ C+ASIL+L AI+IDRY AV  P    TR  + +R+ +MI+++W++S  IS P  F LN   T++      +  C+I +   F V+S+  +FY+P    + +Y +IY V              + +  V+ + +  IC+    +  +    +C +  + ++C  + +        K  +    + ++      +D++NNS  +    Q      +L DT + S  + + +              + +          +  K  +N ++  V+  P        +T+ + N  T    +    R +SQ +  +             A + LAI+ G FI+CW PFFI   +   C  KC++P  + +   WLGY NS +NP+IYT F+ +FR AF KIL
Sbjct:    3 VFTHYAYNDSF----YDNGTWSF------NNTEPLPKHTYNYYAM---LLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVTVMISVVWVMSFAISCPLLFGLNNTATRD------ESLCVIANP-AFVVYSSIVSFYVPFIITLLVYVQIYVV------------LRKRRKRVNTKPKQRICQAADTDGATSLKDKCTHPEDVRLCTMIVKSNGSFPVNKKKVIFIKDVANDGEDLELDELNNSGSSQ--KQKQLTQSVLGDTPATSHQQLMPSKA------------NASPTSTPPTPPEEGQKAEKNEDTTDVLTDPAPIVAKAFQTQALPNGKTQTSVKTMSKRKISQQKEKK-------------ATQMLAIVLGVFIICWLPFFITHILNTHC-TKCKVPAEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKIL 465          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 1.124e-50
Identity = 107/280 (38.21%), Postives = 161/280 (57.50%), Query Frame = 1
Query:  265 TMNFTNSSKSISQIFIGNV----STFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCIC-KTGFINSKSDTHIECGNNGEKVCHN 1086
            T  F+N  K +   F+G      S  +P    ++  ITS +L  LILC++ GN+ V+AAI LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++   W LG EICDL++  DVLCC++SILHL AIA+DRY A+T P DYV  RT  R  ++I   WL+   IS+P        +     R   D  C+I+ + G+T++STFGAFY+P+  ++ +Y RI++        +   ++   +   +K S  C+     F + KS+   + G  G K C  
Sbjct:    8 TFMFSNFCKDVVGDFLGRENGTGSGSQPGLMLSYQIITSLLLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPML----GWRSAEDRANPDA-CMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRA------ARFRIRKTVKKIETAKVSDKCLAVSPAFFHKKSNG--QSGGRGWKRCDG 274          

HSP 2 Score: 93.5893 bits (231), Expect = 5.878e-20
Identity = 54/117 (46.15%), Postives = 72/117 (61.54%), Query Frame = 1
Query: 1405 RLMNNISTHEHRPSRMMSQS-------ERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
             +++N  TH   P+   S S       ER    ++KL   RERK V+TL II G FI CW PFFI A ++PFC + C +P  L + + WLGY NSLLNP+IY  F+ DF++AF KI+
Sbjct:  299 EVISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRKLALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPESCFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKII 415          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 177.178 bits (448), Expect = 3.980e-49
Identity = 131/459 (28.54%), Postives = 203/459 (44.23%), Query Frame = 1
Query:  370 GVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDR---KIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            GV++ LI   V GN  V+ A+   + L    N  ++SLA AD++VA+LVM  S+ +E+   W+ G   C++++  DVL C+ASI HL AI++DRY ++T+  +Y   RT +RI  +I I+W+++ +IS P    + +    E         C INDE  + + S  G+F+LP   ++ +Y RIYQ+            + R++     R Q  +   G   +        G   + +CH                                LN  QD      L + +    D    ++   +     +SD+K  H   + K      K+ K    L+ V       + R     S    R     ++ +R  +                LA++ G F+VCW PFF    +   C   C +P  L +F  W GYCNS LNP+IYTIF+ DFR AF KIL
Sbjct:   24 GVMISLI---VFGNVLVVIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGFWYFGKVWCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFPPLITMEKENGSE------SPVCKINDEKWYVISSCIGSFFLPCIIMVLVYVRIYQI-----------AKKRTRAPPGDRQQKGLSGPG-AAAAGQRENGVGEPDDGLCHE------------------------------KLNGEQDVE----LKEGVERGADEAKVEVNGGDMEESSSSDHKADHPCSIPK------KSAKGKTRLSQVKPGDADPQRRAQ---SAKASRWKGRQNREKRFTF---------------VLAVVIGVFVVCWFPFFFTYMLKTLC-SSCYVPTALFNFFFWFGYCNSALNPIIYTIFNHDFRRAFKKIL 402          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 172.94 bits (437), Expect = 1.075e-47
Identity = 82/189 (43.39%), Postives = 129/189 (68.25%), Query Frame = 1
Query:  361 ITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            +TS +L  LILC + GN+ V+AAI+LE++L NV+NYLI SLAV DLMV+ LV+ ++  +++  +W LG   CD+++  DVLCC++SILHL AIA+DRY A+T+P DY++ RT +R  ++I++ WL+   ISVP    +        +      +C I  +  +T++STFGAFY+P+  ++ +Y RI++ 
Sbjct:   20 VTSFLLGALILCAIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPMLVMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKA 208          

HSP 2 Score: 92.0485 bits (227), Expect = 1.427e-19
Identity = 40/72 (55.56%), Postives = 51/72 (70.83%), Query Frame = 1
Query: 1519 VRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKIL 1734
            V+TL II G FI+CW PFFI A ++PFC + C +P  L   + WLGY NSLLNP+IY  F+ DF+ AF KI+
Sbjct:  325 VKTLGIIMGTFILCWLPFFIVALVMPFCQESCYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 396          
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Match: ENSORLT00000018283.2 (pep primary_assembly:ASM223467v1:22:9799933:9805173:-1 gene:ENSORLG00000014581.2 transcript:ENSORLT00000018283.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 9.592e-41
Identity = 79/186 (42.47%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  367 SGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKP-DYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLIN-DEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            S +L ++ L TV+ N+FVI  I L + L   +N+LI SLAV DL+V+ LVM +S+ + +S+ W LG  +CD+W+  D+  C+ASILHL  IA+DRY A+T   +Y + RT +R  +M+ ++W++SI IS+P  F       +E+       +C++N D+I +T++STFGAFY+P   +I +Y RIY
Sbjct:   38 SVLLALVTLATVLSNAFVITTIFLTRKLHTPANFLIGSLAVTDLLVSILVMPISILYTVSKTWSLGQIVCDIWLSSDITFCTASILHLCVIALDRYWAITDALEYPKRRTMRRAAMMVGVVWVISISISMPPLFWRQAKAHEELT------ECVVNTDQISYTLYSTFGAFYVPTVLLIILYGRIY 217          

HSP 2 Score: 83.1889 bits (204), Expect = 9.024e-17
Identity = 38/76 (50.00%), Postives = 50/76 (65.79%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGR 1743
            A +TL II G FIVCW PFF+   ++  C K+C   P+L     WLGY NSL+NPVIYT F+ +F+ AF K++  R
Sbjct:  301 ATKTLGIILGAFIVCWLPFFVGTLVLAIC-KECWFHPILFDLFTWLGYLNSLINPVIYTAFNDEFKQAFQKLIKCR 375          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 510/511 (99.80%), Postives = 510/511 (99.80%), Query Frame = 1
Query:  226 MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPC CKTGFINSKSDTHIECGNNGEKVCHNLDEKNSLNSCNNSSDSDSCCFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKILNSNNRRLLNSDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR
Sbjct:    1 MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPCTCKTGFINSKSDTHIECGNNGEKVCHNLDEKNSLNSCNNSSDSDSCCFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKILNSNNRRLLNSDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 511          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 496/497 (99.80%), Postives = 496/497 (99.80%), Query Frame = 1
Query:  268 MNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVXXXXXXXXXXXXXXXSQHHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKXXXXXXXXXXXXXXXXFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKIXXXXXXXXXXXDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            MNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPC CKTGFINSKSDTHIECGNNGEKVCHNLDEKNSLNSCNNSSDSDSCCFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKILNSNNRRLLNSDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR
Sbjct:    1 MNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQHHVSKRSQPCTCKTGFINSKSDTHIECGNNGEKVCHNLDEKNSLNSCNNSSDSDSCCFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKILNSNNRRLLNSDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 497          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000004643.1 (SMESG000004643.1)

HSP 1 Score: 281.182 bits (718), Expect = 4.300e-86
Identity = 138/202 (68.32%), Postives = 166/202 (82.18%), Query Frame = 1
Query:  319 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQV 924
            V+ F PK+GW H+Y+TS VL  LILCT+IGN FV+AAI+LEKNL +VSNYLI+SLAVADLMVASLVMS+S+  EIS+ WFLG+E+CD WVCFDVLCCSASILHLVAIA DRY AVT  DY+R RTAKRI IMI I+W LSI+IS+P+RF+ +R +    + VV DG C INDE  +T+FST GAFY+PMF +IGIY +IYQ 
Sbjct:   19 VARFSPKHGWIHVYLTSAVLGSLILCTIIGNVFVVAAIILEKNLQSVSNYLILSLAVADLMVASLVMSVSLLSEISKQWFLGIELCDFWVCFDVLCCSASILHLVAIAFDRYWAVTNIDYIRMRTAKRIIIMIIIVWFLSIIISIPSRFYSSRTWENVYKSVVIDGLCNINDEYFYTIFSTVGAFYMPMFLLIGIYLKIYQT 220          

HSP 2 Score: 135.191 bits (339), Expect = 3.757e-33
Identity = 58/77 (75.32%), Postives = 67/77 (87.01%), Query Frame = 1
Query: 1516 AVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRY 1746
            A RTLAIITGCFI+CW PFFIQA  +PFCG++C    + SSF LWLGYCNSLLNP+IYTIFSP+FR+AF+KILFGRY
Sbjct:  533 AARTLAIITGCFILCWLPFFIQALYLPFCGRQCVPNDIFSSFFLWLGYCNSLLNPIIYTIFSPEFRNAFNKILFGRY 609          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000019254.1 (SMESG000019254.1)

HSP 1 Score: 241.506 bits (615), Expect = 4.093e-72
Identity = 117/200 (58.50%), Postives = 150/200 (75.00%), Query Frame = 1
Query:  319 VSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPDYVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCLINDEIGFTVFSTFGAFYLPMFFIIGIYTRIY 918
            ++ F P+  W   YIT+  L  +IL T+IGN FV+AAI+LE+ L NVSNYLI+SLAVADLMVA LVM +S   E+S  W+LG+E+CDLW CFDVL C+ASILHLV IAIDRY AVT  +Y+  RT+ RI +MI  +WL+S++ISVP+RFH +RN   E  RV+ +G C+IN+ + +TVFS  GAFYLPM F+  IY RIY
Sbjct:   15 IARFSPRLSWIQFYITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWLGIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTDINYLHRRTSSRIILMIIGVWLISVIISVPSRFHTHRN-NAEWLRVIVNGSCIINESVSYTVFSNLGAFYLPMAFMSVIYLRIY 213          

HSP 2 Score: 103.99 bits (258), Expect = 3.313e-23
Identity = 61/141 (43.26%), Postives = 74/141 (52.48%), Query Frame = 1
Query: 1336 KSKALKVNENLNSVSVIKGPTKTRLMNNISTHEHRPSRMMSQSERMEYXXXXXXXXXXXXAVRTLAIITGCFIVCWQPFFIQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFHKILFGRYLVNR 1758
            KS  L+ N++ +  S+     K   MN+ S      +++  + ER              KA RTLAIITGCFI+CW PF I      FC  +     L  S  LWLGY NS LNPVIYT+FSPDFR AF KIL G Y   R
Sbjct:  387 KSSELQFNDDRSQSSLSFKDNKFNAMNSASIR----NKVEQKRER--------------KAARTLAIITGCFIICWLPFGINNVAHAFCNTEPCGSALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLGHYHTRR 509          
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Match: SMESG000008878.1 (SMESG000008878.1)

HSP 1 Score: 224.942 bits (572), Expect = 6.412e-71
Identity = 113/113 (100.00%), Postives = 113/113 (100.00%), Query Frame = 1
Query:  226 MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLG 564
            MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLG
Sbjct:    1 MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGVLVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSLSVFHEISEAWFLG 113          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A1.242e-4742.665-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
HTR1F1.617e-4143.925-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
HTR1B4.129e-4143.485-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
HTR1D9.271e-4144.625-hydroxytryptamine receptor 1D [Source:HGNC Symbo... [more]
HTR1E8.470e-3541.035-hydroxytryptamine receptor 1E [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-41.295e-4146.03SERotonin/octopamine receptor family; Serotonin re... [more]
ser-41.295e-4146.03SERotonin/octopamine receptor family; Serotonin re... [more]
dop-44.131e-4126.88Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;... [more]
octr-11.346e-3334.74OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-11.432e-3334.74OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
5-HT1A2.580e-5348.96gene:FBgn0004168 transcript:FBtr0086577[more]
5-HT1A2.967e-5348.96gene:FBgn0004168 transcript:FBtr0474126[more]
5-HT1B9.358e-5048.63gene:FBgn0263116 transcript:FBtr0330055[more]
5-HT1B1.731e-4948.63gene:FBgn0263116 transcript:FBtr0086599[more]
5-HT1B1.967e-4948.63gene:FBgn0263116 transcript:FBtr0330056[more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1aa3.448e-4940.535-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
FP236542.11.927e-4826.68alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
FP236542.11.927e-4826.68alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
htr1ab2.026e-4541.495-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
htr1ab4.254e-4341.495-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD21.246e-5031.21dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
ENSXETT00000046867.12.063e-4540.545-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
HTR1F4.201e-4443.635-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
HTR1E1.000e-3742.495-hydroxytryptamine (serotonin) receptor 1E, G pro... [more]
HTR1B7.919e-3742.775-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr1a1.247e-4840.975-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Htr1f1.923e-4143.395-hydroxytryptamine (serotonin) receptor 1F [Sourc... [more]
Htr1b1.123e-3844.515-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1b1.123e-3844.515-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Drd24.911e-3341.00dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25414|5HTR_LYMST1.308e-6154.365-hydroxytryptamine receptor OS=Lymnaea stagnalis ... [more]
sp|Q25190|5HTR_HELVI7.085e-5348.665-hydroxytryptamine receptor OS=Heliothis virescen... [more]
sp|P28285|5HT2A_DROME2.586e-5248.965-hydroxytryptamine receptor 2A OS=Drosophila mela... [more]
sp|Q17239|5HTR_BOMMO4.670e-5050.565-hydroxytryptamine receptor OS=Bombyx mori OX=709... [more]
sp|O42385|5H1AA_TAKRU2.276e-4947.095-hydroxytryptamine receptor 1A-alpha OS=Takifugu ... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433UE961.561e-9340.13G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A193KUQ41.452e-8268.32GCR083 OS=Schmidtea mediterranea OX=79327 GN=gcr08... [more]
A0A210PW263.993e-8236.005-hydroxytryptamine receptor OS=Mizuhopecten yesso... [more]
A0A481S9X34.728e-8038.18Serotonin receptor 1A OS=Nephotettix cincticeps OX... [more]
A0A1A9WA301.682e-7735.48G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htr1ab4.550e-4743.095-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSAMXT00000047213.13.472e-4241.825-hydroxytryptamine receptor 1E [Source:NCBI gene;... [more]
ENSAMXT00000026144.23.687e-4243.01pep primary_assembly:Astyanax_mexicanus-2.0:9:1435... [more]
HTR1F2.404e-4143.115-hydroxytryptamine receptor 1F-like [Source:NCBI ... [more]
ENSAMXT00000006138.27.958e-4042.62pep primary_assembly:Astyanax_mexicanus-2.0:6:2799... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.11.573e-4844.97pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000001357.14.797e-4544.68pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
HTR1F1.156e-4145.405-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
adra2c7.599e-3434.33adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
ENSPMAT00000006411.12.815e-3142.29pep scaffold:Pmarinus_7.0:GL477077:14345:22367:-1 ... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354501.322e-2437.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352111.769e-2432.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366105.182e-2230.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286039.118e-2233.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409991.500e-2133.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a7.975e-5128.30dopamine receptor D2 [Source:NCBI gene;Acc:1011645... [more]
ENSORLT00000005282.21.124e-5038.21pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
adra2a3.980e-4928.54adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
htr1ab1.075e-4743.395-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSORLT00000018283.29.592e-4142.47pep primary_assembly:ASM223467v1:22:9799933:980517... [more]
back to top
BLAST of 5-hydroxytryptamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008878.10.000e+099.80SMESG000008878.1[more]
SMESG000008878.10.000e+099.80SMESG000008878.1[more]
SMESG000004643.14.300e-8668.32SMESG000004643.1[more]
SMESG000019254.14.093e-7258.50SMESG000019254.1[more]
SMESG000008878.16.412e-71100.00SMESG000008878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034855 ID=SMED30034855|Name=5-hydroxytryptamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1863bp
ACATTCGATTATTCAGACGAATTTCCGCAAAGATTTCTCGGGACCATCGG
GATTTTTCAGGTATTGAAAAAATGAAAAAGAAATTCAAAAATATTTTCCT
ACTAATTCCATTGATTTTTGGAGTTTTACATGATCCATAAAAATCAATCG
CAATTATTTGTAAATGTGAAATTTGATAACAGAGTCGATGACAATTGAAA
TGTTGAGAAACTTTTTCCTATAAAAATGGTTTTTACGATTTTCAAATATA
ATCAATATTTCGATACGATGAATTTCACAAACTCATCTAAATCGATCAGT
CAAATTTTTATCGGAAATGTGTCGACATTTCGTCCGAAATACGGTTGGAC
TCATATTTATATCACCTCGGGAGTTCTCGTTGTTTTAATACTATGCACTG
TGATTGGTAATTCATTCGTTATTGCTGCAATTTTGCTGGAAAAAAATCTT
CTGAATGTTTCAAATTATCTTATAATAAGCTTGGCAGTTGCCGATTTGAT
GGTAGCTAGTTTGGTAATGTCTCTCAGTGTCTTCCATGAGATATCAGAAG
CCTGGTTTTTAGGTCTGGAAATCTGTGATTTATGGGTTTGTTTCGATGTT
TTGTGCTGTTCTGCTTCCATTCTTCACTTAGTAGCCATAGCCATTGATCG
CTATATGGCTGTGACGAAACCCGATTACGTAAGAACGAGAACGGCTAAAA
GAATCTACATAATGATAGCAATAATATGGTTGTTATCAATAATGATTTCT
GTTCCGACACGGTTTCACTTGAATAGAAATTACACGAAAGAAATGCAAAG
AGTAGTTTACGATGGGAAATGTTTGATCAACGATGAAATAGGATTTACCG
TTTTTTCAACATTCGGTGCTTTTTATTTGCCCATGTTTTTTATAATTGGA
ATATACACTCGAATCTATCAGGTAGCTCGAGCTCGGATAAGACGGCAAGC
ATTTAGAAAACGTTTACGAAGTCAACATCATGTCTCCAAGCGATCACAAC
CTTGCATCTGTAAAACCGGTTTCATCAACTCAAAATCTGATACTCATATC
GAATGTGGAAATAACGGAGAGAAAGTATGTCATAATTTGGACGAAAAGAA
CTCACTAAACTCCTGCAACAATAGTTCGGATTCTGACAGTTGCTGCTTCA
TTGATAAAATGAATAATTCTTCAATAGCTCTGAATTGTCATCAAGACTCA
ACAATCTCATACATGTTGACAGATACCATATCAATGTCGGATGATCGTAA
AATTCTCAACTCAAACAATAGACGTCTTTTGAATTCAGATTATAAAACCA
TTCACATAAATCATCTTCGAAAATATATCCTCAAAAAGTCCAAAGCTCTA
AAAGTGAATGAAAATTTAAACAGCGTGTCAGTTATTAAAGGTCCAACAAA
AACTAGACTGATGAACAATATATCAACTCACGAACATCGGCCGTCGAGAA
TGATGTCACAATCAGAAAGGATGGAGTACAAACGACAGAAATTAGAACAA
AAACGTGAACGGAAAGCCGTTCGCACTCTTGCCATTATTACTGGTTGTTT
TATTGTTTGCTGGCAGCCATTTTTTATTCAAGCAACAATTGTTCCATTTT
GCGGGAAAAAATGCCAACTTCCACCATTATTGAGCTCTTTCGTTTTGTGG
CTTGGTTATTGCAATTCGCTTCTAAATCCAGTGATTTATACGATCTTTTC
CCCAGATTTCCGGGATGCTTTTCATAAGATTTTATTTGGCCGTTATTTGG
TGAATAGATAAATTTCCGACGTAAGAAAATTTAACACCATAGCATGATCA
TTATTCTTGTTATTTTTACCGTATAATAATTATTTTGTTTTTTTTATAAA
ATATCTAATCACA
back to top

protein sequence of SMED30034855-orf-1

>SMED30034855-orf-1 ID=SMED30034855-orf-1|Name=SMED30034855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=512bp
MVFTIFKYNQYFDTMNFTNSSKSISQIFIGNVSTFRPKYGWTHIYITSGV
LVVLILCTVIGNSFVIAAILLEKNLLNVSNYLIISLAVADLMVASLVMSL
SVFHEISEAWFLGLEICDLWVCFDVLCCSASILHLVAIAIDRYMAVTKPD
YVRTRTAKRIYIMIAIIWLLSIMISVPTRFHLNRNYTKEMQRVVYDGKCL
INDEIGFTVFSTFGAFYLPMFFIIGIYTRIYQVARARIRRQAFRKRLRSQ
HHVSKRSQPCICKTGFINSKSDTHIECGNNGEKVCHNLDEKNSLNSCNNS
SDSDSCCFIDKMNNSSIALNCHQDSTISYMLTDTISMSDDRKILNSNNRR
LLNSDYKTIHINHLRKYILKKSKALKVNENLNSVSVIKGPTKTRLMNNIS
THEHRPSRMMSQSERMEYKRQKLEQKRERKAVRTLAIITGCFIVCWQPFF
IQATIVPFCGKKCQLPPLLSSFVLWLGYCNSLLNPVIYTIFSPDFRDAFH
KILFGRYLVNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004993G-protein coupled serotonin receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0098664G-protein coupled serotonin receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 159..180
score: 25.95
coord: 208..231
score: 24.13
coord: 124..146
score: 39.17
coord: 470..496
score: 35.99
coord: 46..70
score: 25.78
coord: 79..100
score: 34.97
coord: 431..455
score: 32.62
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 55..503
e-value: 0.0056
score: -65.6
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 61..488
e-value: 3.0E-67
score: 226.7
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 130..146
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 378..419
e-value: 5.2E-35
score: 123.3
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 239..294
e-value: 9.2E-63
score: 214.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 53..238
e-value: 9.2E-63
score: 214.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 420..502
e-value: 5.2E-35
score: 123.3
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 43..506
NoneNo IPR availablePANTHERPTHR24247:SF1985-HYDROXYTRYPTAMINE RECEPTOR 2A-RELATEDcoord: 43..506
NoneNo IPR availableCDDcd153317tmA_5-HT1A_invertebratescoord: 45..499
e-value: 6.24047E-106
score: 315.062
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 12..507
NoneNo IPR availableTMHMMTMhelixcoord: 434..456
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 160..182
NoneNo IPR availableTMHMMTMhelixcoord: 78..100
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
NoneNo IPR availableTMHMMTMhelixcoord: 120..139
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 61..488
score: 39.449