Procollagen galactosyltransferase

Overview
NameProcollagen galactosyltransferase
Smed IDSMED30034851
Length (bp)1823
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Procollagen galactosyltransferase (SMED30034851) t-SNE clustered cells

Violin plots show distribution of expression levels for Procollagen galactosyltransferase (SMED30034851) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Procollagen galactosyltransferase (SMED30034851) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Procollagen galactosyltransferase (SMED30034851) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034851

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034851SMESG000037408.1 dd_Smed_v4_10276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034851SMESG000037408.1 dd_Smed_v4_10276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034851SMESG000037408.1 dd_Smed_v4_10276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Match: COLGALT1 (collagen beta(1-O)galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26182])

HSP 1 Score: 470.315 bits (1209), Expect = 7.917e-159
Identity = 244/545 (44.77%), Postives = 351/545 (64.40%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKS--KLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
             ++ +S    P++ IA   RN AH LP  LG LERL +P++   L++  DH+ DN+S ++  W++ ++S YH V+++ + E   +  E+    WS  RYEH+++LR  ALKSAR +WADY+L +DAD +I+N +T+  LI     VV+P+L+  + + YSNFW  MT  GYYKR+  Y  I+KR+++G F VPMVHS + IDL   ++ NL F P   D  +  DDII+FA S ++ E  MY+ N + YG+   P+  +  L  E E F H + ++M+     E       S++  IS P K+  K+GFD++++INL+RR DRR +M        IE +  EAVDGK +N + +++L ++ LPGY DPYH R L  GE+GCFLSHY IWK+++D   +K L+FEDD+RF   FKR L  +M++ E    DW+L Y+GRKRM     E  V    +LV  DY+YWTL+Y+I+ +G  K+LA  PLSKM+ VDEFLP+MFD+HP  ++K HF+ RNL A S EPLL+ PTHYTG+  Y+SDTE S +
Sbjct:   42 RWSPESPLQAPRVLIALLARNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLLIAENKTVVAPMLD--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAE------PSRF--ISAPTKTPDKMGFDEVFMINLRRRQDRRERMLRALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKAVPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAHFSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVV 576          
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Match: COLGALT2 (collagen beta(1-O)galactosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:16790])

HSP 1 Score: 445.662 bits (1145), Expect = 3.752e-149
Identity = 235/533 (44.09%), Postives = 337/533 (63.23%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEA--YVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + +A   RN AHTLP+FLG LERL+YPK  + ++   DH+ DN++ I   W+  +Q  YH+V+++  +E E + ++I    W   R+ H+++LR  AL++AR  W+DY+L +D D  + N  T+  LI     +V+P+L    L  YSNFW  +T  G+YKR+ DY  I++ ++ G F VPMVHS + IDL   ++  LTF P   D  +  DDII+FA S+ +    MY+ N + YGY   P++ +  L  +IE   H + + M+DR   E       S+Y+ +      K+GFD+I++INLKRR DRR +M     E  IE K  EAVDGK LN + L +LN++ LPGY DPY  R L  GEIGCFLSHY +WK+++D   EK L+ EDD+RF   FK+ L  +M   +    DWEL Y+GRKRM  KE    V + A+LV  DY+YWTL Y+I+ +G +K++  NP  KM+ VDEFLP+M+++HP  ++K ++  R+L A S+EPLL+ PTHYTG+P Y+SDTE STI
Sbjct:   53 PTVLVAVLARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRPMDEPESYPDEIGPKHWPTSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLLIAENKTIVAPMLESRGL--YSNFWCGITPKGFYKRTPDYVQIREWKRTGCFPVPMVHSTFLIDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPME------PSQYVSVVPKYPDKMGFDEIFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSVWKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEKAVPNVANLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAEYKEYYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTI 577          
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Match: CERCAM (cerebral endothelial cell adhesion molecule [Source:HGNC Symbol;Acc:HGNC:23723])

HSP 1 Score: 426.402 bits (1095), Expect = 4.495e-142
Identity = 215/542 (39.67%), Postives = 329/542 (60.70%), Query Frame = 1
Query:  196 SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF--GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDRED-QEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            +++ LP + +A   RN  H+LP++LG LERL+YP+  + L+   DH+ DN++ ++  W+  +  +Y  V ++   E  RF   E+    W+KER++ +++L+ +AL  AR   ADY+L  D D ++ N  T++ L+   +PVV+P+L+      YSNFW  +T  GYY+R+ +YF  + R+++G F+VPMVHS +   L       L F P   N  +P DDII+FA + +     +++ N   YGY + PV++  GL  E   F H   + ++D    Q    V + SK         SK+GFD++++I+L RRPDRR +M     E+ I  +  +AVDG  LN + + +L V  LPGY DPY  R L  GE+GCFLSHY IW++++     ++L+FEDD+RF   F+  L  +M++ E     W+L YLGRK+++ +KE  V     LV   Y+YWTL+Y +   G  K+LA  PL +M+ VDEFLPIMFD+HP + +K HF PR+LVA S++PLL  PTHY G+ +++SDTE S+  +D
Sbjct:   26 AESPLPAVVLAILARNAEHSLPHYLGALERLDYPRARMALWCATDHNVDNTTEMLQEWLAAVGDDYAAVVWRPEGE-PRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTY--YSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPRMQASAHVTRPSK-------RPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFESNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDD 557          
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Match: COLGALT2 (collagen beta(1-O)galactosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:16790])

HSP 1 Score: 396.741 bits (1018), Expect = 4.252e-131
Identity = 211/490 (43.06%), Postives = 304/490 (62.04%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEA--YVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHP 1665
            P + +A   RN AHTLP+FLG LERL+YPK  + ++   DH+ DN++ I   W+  +Q  YH+V+++  +E E + ++I    W   R+ H+++LR  AL++AR  W+DY+L +D D  + N  T+  LI     +V+P+L    L  YSNFW  +T  G+YKR+ DY  I++ ++ G F VPMVHS + IDL   ++  LTF P   D  +  DDII+FA S+ +    MY+ N + YGY   P++ +  L  +IE   H + + M+DR   E       S+Y+ +      K+GFD+I++INLKRR DRR +M     E  IE K  EAVDGK LN + L +LN++ LPGY DPY  R L  GEIGCFLSHY +WK+++D   EK L+ EDD+RF   FK+ L  +M   +    DWEL Y+GRKRM  KE    V + A+LV  DY+YWTL Y+I+ +G +K++  NP  KM+ VDEFLP+M+++HP
Sbjct:   53 PTVLVAVLARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEIFREWLKNVQRLYHYVEWRPMDEPESYPDEIGPKHWPTSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLLIAENKTIVAPMLESRGL--YSNFWCGITPKGFYKRTPDYVQIREWKRTGCFPVPMVHSTFLIDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPME------PSQYVSVVPKYPDKMGFDEIFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSVWKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQVKEPEKAVPNVANLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHP 534          
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Match: CERCAM (cerebral endothelial cell adhesion molecule [Source:HGNC Symbol;Acc:HGNC:23723])

HSP 1 Score: 375.17 bits (962), Expect = 3.836e-123
Identity = 194/489 (39.67%), Postives = 293/489 (59.92%), Query Frame = 1
Query:  355 IMDTWMLQIQSEYHHVDYKVSNEGERF--GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDRED-QEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            ++  W+  +  +Y  V ++   E  RF   E+    W+KER++ +++L+ +AL  AR   ADY+L  D D ++ N  T++ L+   +PVV+P+L+      YSNFW  +T  GYY+R+ +YF  + R+++G F+VPMVHS +   L       L F P   N  +P DDII+FA + +     +++ N   YGY + PV++  GL  E   F H   + ++D    Q    V + SK         SK+GFD++++I+L RRPDRR +M     E+ I  +  +AVDG  LN + + +L V  LPGY DPY  R L  GE+GCFLSHY IW++++     ++L+FEDD+RF   F+  L  +M++ E     W+L YLGRK+++ +KE  V     LV   Y+YWTL+Y +   G  K+LA  PL +M+ VDEFLPIMFD+HP + +K HF PR+LVA S++PLL  PTHY G+ +++SDTE S+  +D
Sbjct:    1 MLQEWLAAVGDDYAAVVWRPEGE-PRFYPDEEGPKHWTKERHQFLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTY--YSNFWCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPRMQASAHVTRPSK-------RPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLNSSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFESNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALRLAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDD 479          
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Match: D2045.9 (pep chromosome:WBcel235:III:10475960:10479758:1 gene:WBGene00008426.1 transcript:D2045.9.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2045.9)

HSP 1 Score: 285.034 bits (728), Expect = 1.250e-88
Identity = 196/536 (36.57%), Postives = 286/536 (53.36%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPV-VSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF----LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDL-FVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSD-KEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            P + I   +   AH +PYFLG LE L+YPK  I + I +   ED +   +  W+   +  +  V  K+  E E + E                     L++AR    +  L++  D +    N IQ L   K  V VSPL    + S  SN   + +ET   + +        RE+   F +P+      IDL  + ++ LTF    LP  +     D   +F  SA+     ++ DN   YG+F +P E D   R   I    ++QI     D+  L FV ++ +  P    E +K G DKIYL+NLKRR +R  +M+ IFD LGIE    EA DG+KL++   +  N + L GY DP  KR +K GEIGCFLSHY +W+D++ +NYEK+++FEDD+RF       +  V+++ +     W+L YLGRK+ S+ +E ++S   HL   +Y+YWTL Y+++  G  K+L  NPL KM+ VDE+LPIMF++HP  DW  HF P ++ A +  PL++ P  YT EP Y+SDTEDS IV
Sbjct:   36 PPVYIGVGLGEHAHAIPYFLGWLENLDYPKDRIKVEIFILSKEDATIHQVKWWLDSTKQYFKSV--KIIEESENWLE-------------------SGLRNARLQKVERCLLISGDTVPTEMNLIQFLFNEKTHVAVSPLFQSIDGS--SNI-DEPSETLINQNN-------VREEILSFSLPLA-----IDLTTIDSSYLTFDKDNLPNYEGA--DDPSEVFVVSAKNMGIQLWADNQVNYGFFVNP-EKDIEERRSTI----RYQIADFLADERPLPFVSRSVR--PWQ-SEATKQGVDKIYLVNLKRRQERLNRMQKIFDILGIEYSLLEATDGQKLDELPEELKNYQILEGYLDPISKRPMKNGEIGCFLSHYRVWQDVVQHNYEKVIVFEDDLRFSHDGLTRIREVLQDLDASHKPWDLIYLGRKKQSENEELWISQHRHLSSVEYSYWTLGYMLSLNGARKLLRPNPLKKMVPVDEYLPIMFNKHPNKDWSLHFEPLDVEAFTLYPLVVFPQKYTNEPGYVSDTEDSVIV 525          
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Match: D2045.9 (pep chromosome:WBcel235:III:10475970:10479753:1 gene:WBGene00008426.1 transcript:D2045.9.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2045.9)

HSP 1 Score: 285.034 bits (728), Expect = 1.250e-88
Identity = 196/536 (36.57%), Postives = 286/536 (53.36%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPV-VSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF----LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDL-FVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSD-KEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            P + I   +   AH +PYFLG LE L+YPK  I + I +   ED +   +  W+   +  +  V  K+  E E + E                     L++AR    +  L++  D +    N IQ L   K  V VSPL    + S  SN   + +ET   + +        RE+   F +P+      IDL  + ++ LTF    LP  +     D   +F  SA+     ++ DN   YG+F +P E D   R   I    ++QI     D+  L FV ++ +  P    E +K G DKIYL+NLKRR +R  +M+ IFD LGIE    EA DG+KL++   +  N + L GY DP  KR +K GEIGCFLSHY +W+D++ +NYEK+++FEDD+RF       +  V+++ +     W+L YLGRK+ S+ +E ++S   HL   +Y+YWTL Y+++  G  K+L  NPL KM+ VDE+LPIMF++HP  DW  HF P ++ A +  PL++ P  YT EP Y+SDTEDS IV
Sbjct:   36 PPVYIGVGLGEHAHAIPYFLGWLENLDYPKDRIKVEIFILSKEDATIHQVKWWLDSTKQYFKSV--KIIEESENWLE-------------------SGLRNARLQKVERCLLISGDTVPTEMNLIQFLFNEKTHVAVSPLFQSIDGS--SNI-DEPSETLINQNN-------VREEILSFSLPLA-----IDLTTIDSSYLTFDKDNLPNYEGA--DDPSEVFVVSAKNMGIQLWADNQVNYGFFVNP-EKDIEERRSTI----RYQIADFLADERPLPFVSRSVR--PWQ-SEATKQGVDKIYLVNLKRRQERLNRMQKIFDILGIEYSLLEATDGQKLDELPEELKNYQILEGYLDPISKRPMKNGEIGCFLSHYRVWQDVVQHNYEKVIVFEDDLRFSHDGLTRIREVLQDLDASHKPWDLIYLGRKKQSENEELWISQHRHLSSVEYSYWTLGYMLSLNGARKLLRPNPLKKMVPVDEYLPIMFNKHPNKDWSLHFEPLDVEAFTLYPLVVFPQKYTNEPGYVSDTEDSVIV 525          
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Match: D2045.9 (pep chromosome:WBcel235:III:10475245:10479758:1 gene:WBGene00008426.1 transcript:D2045.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2045.9)

HSP 1 Score: 285.034 bits (728), Expect = 1.250e-88
Identity = 196/536 (36.57%), Postives = 286/536 (53.36%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPV-VSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF----LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDL-FVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSD-KEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            P + I   +   AH +PYFLG LE L+YPK  I + I +   ED +   +  W+   +  +  V  K+  E E + E                     L++AR    +  L++  D +    N IQ L   K  V VSPL    + S  SN   + +ET   + +        RE+   F +P+      IDL  + ++ LTF    LP  +     D   +F  SA+     ++ DN   YG+F +P E D   R   I    ++QI     D+  L FV ++ +  P    E +K G DKIYL+NLKRR +R  +M+ IFD LGIE    EA DG+KL++   +  N + L GY DP  KR +K GEIGCFLSHY +W+D++ +NYEK+++FEDD+RF       +  V+++ +     W+L YLGRK+ S+ +E ++S   HL   +Y+YWTL Y+++  G  K+L  NPL KM+ VDE+LPIMF++HP  DW  HF P ++ A +  PL++ P  YT EP Y+SDTEDS IV
Sbjct:   36 PPVYIGVGLGEHAHAIPYFLGWLENLDYPKDRIKVEIFILSKEDATIHQVKWWLDSTKQYFKSV--KIIEESENWLE-------------------SGLRNARLQKVERCLLISGDTVPTEMNLIQFLFNEKTHVAVSPLFQSIDGS--SNI-DEPSETLINQNN-------VREEILSFSLPLA-----IDLTTIDSSYLTFDKDNLPNYEGA--DDPSEVFVVSAKNMGIQLWADNQVNYGFFVNP-EKDIEERRSTI----RYQIADFLADERPLPFVSRSVR--PWQ-SEATKQGVDKIYLVNLKRRQERLNRMQKIFDILGIEYSLLEATDGQKLDELPEELKNYQILEGYLDPISKRPMKNGEIGCFLSHYRVWQDVVQHNYEKVIVFEDDLRFSHDGLTRIREVLQDLDASHKPWDLIYLGRKKQSENEELWISQHRHLSSVEYSYWTLGYMLSLNGARKLLRPNPLKKMVPVDEYLPIMFNKHPNKDWSLHFEPLDVEAFTLYPLVVFPQKYTNEPGYVSDTEDSVIV 525          
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Match: let-268 (Multifunctional procollagen lysine hydroxylase and glycosyltransferase Procollagen-lysine,2-oxoglutarate 5-dioxygenase Procollagen glycosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q20679])

HSP 1 Score: 71.2478 bits (173), Expect = 1.058e-12
Identity = 69/272 (25.37%), Postives = 113/272 (41.54%), Query Frame = 1
Query:  157 GNPLGSDINFNEQSQTL---------LPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEY-HHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI----VHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYF 930
            GN LG+  N     +T          +P I +  FI      +   L  +   +YPK+ I LYI  ++   +   I D      +S Y   V   V+  G+R                  + R++A++  +A   ++  +MD D        I+DLI     + V +++P++       ++NFWG +   GYY RSEDY  I K  + G + VP + S    +   +      +   + NK  +D  +   K A  N   +YIDN K YG+ 
Sbjct:  255 GNYLGNRWNSQLGCRTCGLEVKESEEVPLIALNLFISKPIPFIEEVLQKIAEFDYPKEKIALYI-YNNQPFSIKNIQDFLQKHGKSYYTKRVINGVTEIGDR------------------EARNEAIEWNKARNVEFAFLMDGDAYFSEPKVIKDLIQYSKTYDVGIIAPMIGQPG-KLFTNFWGAIAANGYYARSEDYMAIVKGNRVGYWNVPFITSAVLFNKEKLEAMKDAY---SYNK-NLDPDMSMCKFARDNGHFLYIDNEKYYGFL 502          
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Match: let-268 (Multifunctional procollagen lysine hydroxylase and glycosyltransferase Procollagen-lysine,2-oxoglutarate 5-dioxygenase Procollagen glycosyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q20679])

HSP 1 Score: 71.2478 bits (173), Expect = 1.058e-12
Identity = 69/272 (25.37%), Postives = 113/272 (41.54%), Query Frame = 1
Query:  157 GNPLGSDINFNEQSQTL---------LPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEY-HHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI----VHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYF 930
            GN LG+  N     +T          +P I +  FI      +   L  +   +YPK+ I LYI  ++   +   I D      +S Y   V   V+  G+R                  + R++A++  +A   ++  +MD D        I+DLI     + V +++P++       ++NFWG +   GYY RSEDY  I K  + G + VP + S    +   +      +   + NK  +D  +   K A  N   +YIDN K YG+ 
Sbjct:  255 GNYLGNRWNSQLGCRTCGLEVKESEEVPLIALNLFISKPIPFIEEVLQKIAEFDYPKEKIALYI-YNNQPFSIKNIQDFLQKHGKSYYTKRVINGVTEIGDR------------------EARNEAIEWNKARNVEFAFLMDGDAYFSEPKVIKDLIQYSKTYDVGIIAPMIGQPG-KLFTNFWGAIAANGYYARSEDYMAIVKGNRVGYWNVPFITSAVLFNKEKLEAMKDAY---SYNK-NLDPDMSMCKFARDNGHFLYIDNEKYYGFL 502          
BLAST of Procollagen galactosyltransferase vs. Ensembl Fly
Match: CG31915 (gene:FBgn0051915 transcript:FBtr0079099)

HSP 1 Score: 434.876 bits (1117), Expect = 2.072e-145
Identity = 235/541 (43.44%), Postives = 343/541 (63.40%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTM-WSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF-------LPEADNKYPI-----DDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDK-EAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDS 1788
            P + IA  +RNKAH LP FL  LE+ +YPK+ I +++R DHS D+S  ++  W+      YH V Y+   E + F        W   R++H+I L+++A +  R +WADY+  +DADV++ ++++++ L   ++P+V+P+L   +L  YSNFW  MTE  YY+R+++Y +I   +K+G F VPMVH+   +++N  +  NLTF       L ++  + P+     DDII+FA SA  +   ++I N   +GY   P+E  D L  +++   + K  IM++ E      +L   K+L    PEKSKL  D+I++INLKRRP+RR KME +FDE+GIEA++F AVDGK+L+   L  + V+ LPGY DPYH R + MGEIGCFLSHY IW  M+    +++LI EDDIRF P F+++   ++ +A      ++L Y GRKR+ ++ E  V +  +LV+  Y+YWTL Y+I+ +G  K+LA  PL K+I VDEFLP+MFDRHP   W   F  RNLVA S+ PLLL P +YTGE  YISDTEDS
Sbjct:   30 PTVLIALLVRNKAHILPMFLSYLEQQDYPKERIAIWLRCDHSNDDSIELLRQWLDNSGDLYHSVSYEFKPEEQSFVNGTSPYEWPASRFKHLIALKEEAFQYGRDIWADYVFFLDADVLLTSKDSLKVLTRLQLPIVAPMLISESL--YSNFWCGMTEDYYYRRTDEYKEIYHVKKQGSFPVPMVHTAVLVNMNHRAVRNLTFDRNKLVELQKSRQQEPLYDGPADDIIVFAISANSSGIPLHICNDITFGYILQPLEPGDTLDHDVQQLVNLK-SIMVN-ELGAVPPLLDYYKHLEKK-PEKSKLSLDRIFMINLKRRPERREKMERLFDEIGIEAEHFPAVDGKELSTERLLEMGVRFLPGYEDPYHHRAMTMGEIGCFLSHYNIWVMMVRKQLKEVLILEDDIRFEPYFRQNAVRILNQAR-NAAQYDLIYFGRKRLKEESEPAVENADNLVHAGYSYWTLGYVISLQGALKLLAAKPLDKLIPVDEFLPLMFDRHPNKTWTEAFPKRNLVAFSASPLLLYPIYYTGESGYISDTEDS 564          
BLAST of Procollagen galactosyltransferase vs. Ensembl Fly
Match: Plod (gene:FBgn0036147 transcript:FBtr0076187)

HSP 1 Score: 87.0409 bits (214), Expect = 1.648e-17
Identity = 72/258 (27.91%), Postives = 114/258 (44.19%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLD---HSEDNSSVIMDTWMLQIQSEYHHVDYKVSNE--GERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFID---LNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYF 930
            N  +  +T LP I +A  +         FL  +E LNYPK+ + L I  +   H +D  S +      +   EY    + +S +   ER G                  R  AL  AR   +DY+  +DAD  I +   +++L+      V+P+ +  +   +SNFWG ++E GYY RS DY DI KRE  G+F VP V S+Y +     + +S  +  F P+          +   +S       MY  N +++G+ 
Sbjct:  274 NLLDLEETNLPVISLALMVTQPVPFFDQFLEGIESLNYPKEKLHLLIYSNVAFHDDDIKSFVN-----KHAKEYATAKFALSTDELDERQG------------------RQLALDKARLHQSDYIFFVDADAHIDDGEVLRELLRLNKQFVAPIFS-KHKELWSNFWGALSEGGYYARSHDYVDIVKRELIGMFNVPHVTSIYLVKKTAFDAISFKHKEFDPD----------MAMCESLRNAGIFMYASNLRIFGHL 497          
BLAST of Procollagen galactosyltransferase vs. Ensembl Fly
Match: Plod (gene:FBgn0036147 transcript:FBtr0076188)

HSP 1 Score: 87.0409 bits (214), Expect = 1.648e-17
Identity = 72/258 (27.91%), Postives = 114/258 (44.19%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLD---HSEDNSSVIMDTWMLQIQSEYHHVDYKVSNE--GERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFID---LNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYF 930
            N  +  +T LP I +A  +         FL  +E LNYPK+ + L I  +   H +D  S +      +   EY    + +S +   ER G                  R  AL  AR   +DY+  +DAD  I +   +++L+      V+P+ +  +   +SNFWG ++E GYY RS DY DI KRE  G+F VP V S+Y +     + +S  +  F P+          +   +S       MY  N +++G+ 
Sbjct:  274 NLLDLEETNLPVISLALMVTQPVPFFDQFLEGIESLNYPKEKLHLLIYSNVAFHDDDIKSFVN-----KHAKEYATAKFALSTDELDERQG------------------RQLALDKARLHQSDYIFFVDADAHIDDGEVLRELLRLNKQFVAPIFS-KHKELWSNFWGALSEGGYYARSHDYVDIVKRELIGMFNVPHVTSIYLVKKTAFDAISFKHKEFDPD----------MAMCESLRNAGIFMYASNLRIFGHL 497          
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-070222-1])

HSP 1 Score: 475.322 bits (1222), Expect = 4.621e-161
Identity = 242/575 (42.09%), Postives = 353/575 (61.39%), Query Frame = 1
Query:  106 AFICVNICPTNNGDII----DGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDA--HLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            A IC  +    +G+++    D NP+        +S  L PK+ IA   RN AH+LPY+L  ++RL+YPK  I ++   DH+ DNS+ ++  W+   QS YH+V+++   E   + ++     WS  R  H+++LR  ALK+ARA WADY+L +D+D ++ N   +  L+   + +V+P+L+  +L  YSNFW  +T  GYYKR+ DY  I++ ++ G F VPMVHS + +DL   +T ++ F P   D  +  DDI++FA SA +    MY+ N + YG+   P++    +  E E F H   + M+D   +   F+   SK        + K+ FD+I+LINLKRR DRR +M      LG+EA   +AVDGK LN + L +L ++ +PGY DPY  R L  GEIGCFLSH+F WK +++     +L+ EDD+RF P FKR L  +MK+ E    +W+L Y+GRKRM   +  VS +   +LV  DY+YWTL Y ++++G +K+LA  PL KM+ VDEFLP+MF++HP   + +HF PR+L A S EPLLL PTHYTGEP Y SDTE STI +D
Sbjct:   10 AVICAVMAQNCSGELMAHVQDPNPV-------PESSLLKPKVMIAILARNSAHSLPYYLDCIDRLDYPKDRIAIWAATDHNVDNSTAMLREWLKNRQSRYHYVEWRPMEEPRSYTDEWGPKHWSSSRVSHVMKLRQAALKAARARWADYILYVDSDNLLTNPRVLNLLMAENLTLVAPMLDSRSL--YSNFWCGITPQGYYKRTPDYQPIREWKRLGCFSVPMVHSTFLLDLRRSATLDMAFYPPHPDYSWAFDDIMVFAFSAREAGVQMYVCNREHYGFLPVPLKAQQSVEDEEESFTHTITEAMIDHNIKPSEFLFTPSK-------PQDKMSFDEIFLINLKRRFDRRERMLNTMAVLGLEATLVDAVDGKTLNTSQLQALGIEMMPGYKDPYSGRVLTRGEIGCFLSHHFTWKQVLERGLRHVLVLEDDVRFEPRFKRRLQTIMKDVEKTQLNWDLIYVGRKRMQVAQPEVSVEGVNNLVEADYSYWTLGYALSQQGAKKLLAAQPLGKMLPVDEFLPVMFNKHPNSAYMSHFDPRDLRAFSVEPLLLYPTHYTGEPGYFSDTETSTIWDD 568          
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Match: si:ch211-114l13.7 (si:ch211-114l13.7 [Source:NCBI gene;Acc:567859])

HSP 1 Score: 470.7 bits (1210), Expect = 2.445e-159
Identity = 232/552 (42.03%), Postives = 349/552 (63.22%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK*LND 1821
             ++ +S  L P++ +A   RN AH+LP+ LG ++RLNYPK  + +++  DH+ DN++ I+  W++ +Q+ YH+V+++  +E   + GE     W+  RYEH+++LR  AL++AR +WADY +++D D ++ N + +  L+     +V+P+L   + + YSNFW  MT  GYYKR+  Y  I+++E+KG F VPMVHS   +DL   ++  L F P   D  +  DDII+FA SA   E  MYI N + YGYF  P+ + + L  E E F H++ ++M+          ++ S YL +   +  K+GFD++++INL RR DRR +M     E  I  K   AVDGK LN + +++L +K LPGYSDPYH R L  GE+GCFLSHY IW +++D   +  L+ EDD+RF   FKR L  +M+E +    DW+L Y+GRKRM     E  V     LV  DY+YWTL Y+I+ +G +K+L   PL KM+ VDEFLP+M+++HP +++ +HF  R+L A S+EPLL+ PTHYTG+  YISDTE S++ ++   L D
Sbjct:   24 RWSPESALLAPRVLVALVCRNSAHSLPHVLGAIDRLNYPKDRMAVWVATDHNSDNTTEILREWLVNVQNFYHYVEWRPQDEPSVYEGESGPKHWTNLRYEHVMKLRQAALETAREMWADYFMLVDCDNLLTNRDVLWKLMRENKTIVAPMLE--SRAAYSNFWCGMTSQGYYKRTPAYMPIRRQERKGCFAVPMVHSTLLLDLRKEASRQLAFFPPHPDYTWAFDDIIIFAFSARMAEVQMYICNRETYGYFPVPLRSQNSLQDEAESFLHSQLEVMVRNPP------IEPSVYLSLMPKQTDKMGFDEVFMINLLRRSDRRERMLRTLYEQEIACKIITAVDGKALNASQVEALGIKMLPGYSDPYHGRPLTKGELGCFLSHYNIWNEIVDRGLQSSLVIEDDLRFEVFFKRRLQNLMQEVQSQQLDWDLIYIGRKRMQVERPEKSVPRIHSLVEADYSYWTLGYVISLRGAQKLLRAEPLKKMLPVDEFLPVMYNKHPIEEYMSHFPQRDLRAFSAEPLLIYPTHYTGDQGYISDTETSSVWDNESVLTD 567          
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Match: colgalt1 (collagen beta(1-O)galactosyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-070720-6])

HSP 1 Score: 467.618 bits (1202), Expect = 5.586e-158
Identity = 241/580 (41.55%), Postives = 357/580 (61.55%), Query Frame = 1
Query:   85 INCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFG-EDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF-LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 1809
            + C V F  +  + C  N+G          +  ++ +S  L P++ IA   RN  H+LP+FLG +ERLNYPK  I L++  DH+ DN++ ++  W++ +Q  YH+V+++   +  ++  E+    W+ ERY ++++LR  AL+SAR +WADYL+M+D D +++N++ +  LI     +V+P++   + + YSNFW  MT  GYYKR+  Y  I+K+ +KG F VPMVHS + +DL   ++  L F  P  D  +  DDII+FA SA   E  M+I N ++YG+   P+  +  L  E + F H   ++ +     E       S+YLP  + +  K+GFD++++INLKRR DRR +M     E  IE K   AVDGK +N + + +L +  LPGYSDPYH R L  GE+GCFLSHY IWK+++D   +  LI EDD+RF   FKR L  ++ E +    DW+L Y+GRKRM     E  V +  +LV  DY+YWTL Y+++ +G  K+L   PLSKM+ VDEFLP+MF++HP  D+   F  R+L A S+EPLL+ PTHYTGE  YISDTE ST+ ++ K
Sbjct:   10 MRCFVLFVSVLCS-CLINSGP---AQGYFHEERWSPESAILAPRVMIALICRNNQHSLPHFLGTIERLNYPKDRIALWVATDHNVDNTTYLLRDWLINVQKLYHYVEWRPKEQPSQYNDEEGPKDWTNERYAYVMKLRQAALESAREMWADYLMMIDCDNLLINQDVLWKLIKENKTIVAPMME--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKQVRKGCFAVPMVHSTFLVDLRKEASRQLAFHPPHPDYTWAFDDIIVFAFSARIAEVQMFICNREIYGHLPVPLRAHSTLQDEADSFIHTMLEVNVRNPPVE------PSRYLPKPVRKPDKMGFDEVFIINLKRRGDRRERMLRALTEQEIECKIIAAVDGKAMNVSEIHALGIHMLPGYSDPYHGRPLTKGELGCFLSHYNIWKEIVDRGLKTSLILEDDLRFEIFFKRRLQNLLLELQSQSLDWDLIYIGRKRMQVDRPEKAVPNIRNLVEADYSYWTLGYMMSLQGARKLLKAQPLSKMLPVDEFLPVMFNKHPVSDYMEQFETRDLKAFSAEPLLVFPTHYTGEAGYISDTETSTVWDNEK 577          
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Match: si:ch211-13f8.2 (si:ch211-13f8.2 [Source:ZFIN;Acc:ZDB-GENE-070705-32])

HSP 1 Score: 449.129 bits (1154), Expect = 4.439e-151
Identity = 229/543 (42.17%), Postives = 336/543 (61.88%), Query Frame = 1
Query:  193 QSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVD-YKVSNEGERFGEDIL-TMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNK-YPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDK--EAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            ++  L PK+ IA   RN  H+LPYFLG +ERL+YPK  I ++   DH+ DN++ ++  W+  ++  YH V  + +  E   + +++    W + R+ H+++LR  ALKSARA WADY+L  D+D ++ N   +  LI     +V+P+L+   L  YSNFW  MT  GYYKR+  Y  I+  ++ G   VPM+HS   IDL   ++  L F P   +  + +DDI+ FA SA +    M+I N + YGY   P++    L  E+E F+H   + ++D       F ++TS+YL I    K  + F+++YLINLKRR DRR +M    + LGI+    +AVDGK +N T L +L ++ LPG+ DPY  R L  GEIGCFLSHY IWK +++   +++L+ EDD+RF   FK  LN +M++ +     W+L Y+GRKR+  K  E +V    +LV PDY+YWTL Y ++ +G + +L   PLSKM+ VDEFLP+MF++HP+ ++ +HF  RNL A S +PLLL PTHYTGE  Y SDTE S+I +D
Sbjct:   35 ETSLLNPKVAIAILARNSEHSLPYFLGCIERLDYPKDRISIWAATDHNTDNTTGMLREWIAGVEDLYHSVQLHTMEQEKSSYVDELGPKHWPETRFTHVMKLRQAALKSARAQWADYVLFTDSDNLLTNTQVLNQLISENRTLVAPMLDSRTL--YSNFWCGMTSQGYYKRTPHYVPIRTWKRTGCHPVPMIHSTMLIDLRRRASELLAFYPVHHHYLWALDDIMAFAFSARQTGVQMFICNREHYGYLPQPLQMKQTLEEEVESFSHTVTEALVD-------FKMETSQYLHIVSKPKDTMAFNQVYLINLKRREDRRDRMLRSLEVLGIDVTLTDAVDGKAMNSTQLRTLGIEMLPGFKDPYSDRVLTKGEIGCFLSHYNIWKKVVELQQQQVLVLEDDVRFETNFKSRLNTIMEDVKRSGLQWDLIYVGRKRLQIKHPERWVEGVKNLVSPDYSYWTLGYALSLQGAKILLEAQPLSKMLPVDEFLPVMFNKHPKKEYMSHFQLRNLKAFSVQPLLLFPTHYTGEAGYFSDTETSSIWDD 568          
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Match: cercam (cerebral endothelial cell adhesion molecule [Source:ZFIN;Acc:ZDB-GENE-030131-9787])

HSP 1 Score: 447.203 bits (1149), Expect = 2.263e-150
Identity = 230/548 (41.97%), Postives = 353/548 (64.42%), Query Frame = 1
Query:  172 SDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF-LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEI-FNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            S+ N+ E+S+   P + IA   RN AH+LP++LG LERLNYPK+ I ++   DH+ DN++ ++  W+  +Q++YH+V+++ S++   + GE     W+  RYE+I++L+  AL  A+  WADY+L  D D ++ N +T+  L+     V++P+L+    S YSN+W  +T  GYY+R+ +YF  ++R++ G + VPMVHS   +DL    T  ++F  P  D  +P DDII+FA S   +E  MY+ N + YGY + P +      +  I F H   + ++          +  S+Y+ +   +   +GFD+IYLINL+RR DRR +M +   EL I+AK  +A+DG  LN + +  L V  LPGY DP+  R L  GE+GCFLSHY+IWK+M+D   +K LIFEDD+RF   FKR +  +M+E E    DW++ YLGRK+++  +E  V +  +LV+ DY+YWTLSY I+ +G +K+L   P+SKM+ VDEFLPIM+D+HP +D+K+HF  RNL+A S+ PLL++P HY G+ +++SDTE ST+ +D
Sbjct:   20 SEENYTEESKMQPPTVVIAIIARNAAHSLPHYLGALERLNYPKERISVWAATDHNIDNTTAMLREWLTVMQTQYHYVEWRPSDKPTSYAGELGPKHWTNSRYEYIMKLKQAALNFAKKRWADYILYSDTDNILTNPDTLHLLMAENKSVIAPMLDSQ--SAYSNYWCGITPQGYYRRTAEYFPTKQRQRLGCYPVPMVHSTVLLDLRKQGTRKVSFHPPHKDYSWPFDDIIVFAFSCRVSEVQMYLCNKERYGYLNVPAKPHQTVEDDRINFVHLYLESLIHGPP------MYVSRYVHVPPKQSDLMGFDEIYLINLRRRQDRRDRMLWSLYELEIDAKVVDAIDGAALNSSDIKILGVDLLPGYYDPFSGRTLTKGEVGCFLSHYYIWKEMVDMQLDKALIFEDDVRFQANFKRRMMRLMEEVEQVELDWDIIYLGRKKVNPGEEVPVENVRNLVFADYSYWTLSYAISLQGAQKLLNAEPVSKMLPVDEFLPIMYDKHPNEDYKSHFPNRNLMAYSTHPLLVQPCHYAGDAEWVSDTETSTLWDD 559          
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000013180.1 (collagen beta(1-O)galactosyltransferase 2 [Source:NCBI gene;Acc:100495682])

HSP 1 Score: 459.914 bits (1182), Expect = 7.763e-155
Identity = 236/576 (40.97%), Postives = 351/576 (60.94%), Query Frame = 1
Query:   94 LVSFAFICVNICPTNNGDIIDGNPLGSDINFNE----QSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            L+   F   N+C +             ++N  E    +S    P + IA   RN AHTLPYF+  +++L+YPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++   E + + +++    W   R+ H+++LR  AL++A+  W+DY+L +DAD  + N  T+  ++     +V+P+L    L  YSNFW  MT  GYYKR+ DY  I++ ++ G F VPMVHS   IDL   ++ NL F P + D  +  DDII+FA S+ +    MYI N + YGY + P++ +  L  +I+ F H + + M+DR        L+ S+Y+ +      K+GF++I++INLKRR DRR++M     E  I+ K F+AVDGK LN + L ++ ++ +PGY DPY  R L  GEIGCFLSHY+IWK+++D   EK L+ EDD+RF P FK  L  +M + E    +W+L Y+GRKRM     E  V    +LV  DY+YWTL Y I+R+G EK++A  P +KM+ VDEFLP+MF++HP   +  ++  RNL A S+EPLL+ PTHYTG+P Y SDTE STI
Sbjct:   11 LLLLPFCLTNLCAS-----------AEELNIEEAVLPESSLQKPSVLIAIIARNAAHTLPYFMDCIDKLDYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYADELGPKHWPASRFAHVMKLRQAALRTAKEKWSDYVLYIDADNFLTNPQTLNLMMKENKTIVAPMLESRTL--YSNFWCGMTPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTILIDLRKEASKNLQFYPPQEDYTWAFDDIIVFAFSSRQAGIQMYICNREHYGYLAVPMKPHQSLQDDIDYFVHVQTEAMIDRPP------LEPSRYVQVPPKHPDKMGFNEIFMINLKRRQDRRVRMLRSLYEQEIQVKIFDAVDGKALNASQLKAMKIEVIPGYHDPYSGRTLTSGEIGCFLSHYYIWKEVVDRGLEKSLVIEDDVRFEPLFKHKLMKLMNDIEEAEVEWDLIYIGRKRMQVERPEKAVPSVMNLVEADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVKKYLEYYESRNLKAFSAEPLLVYPTHYTGQPGYFSDTETSTI 567          
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000029164.1 (collagen beta(1-O)galactosyltransferase 2 [Source:NCBI gene;Acc:100495682])

HSP 1 Score: 457.603 bits (1176), Expect = 2.480e-154
Identity = 229/533 (42.96%), Postives = 338/533 (63.41%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + IA   RN AHTLPYF+  +++L+YPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++   E + + +++    W   R+ H+++LR  AL++A+  W+DY+L +DAD  + N  T+  ++     +V+P+L    L  YSNFW  MT  GYYKR+ DY  I++ ++ G F VPMVHS   IDL   ++ NL F P + D  +  DDII+FA S+ +    MYI N + YGY + P++ +  L  +I+ F H + + M+DR        L+ S+Y+ +      K+GF++I++INLKRR DRR++M     E  I+ K F+AVDGK LN + L ++ ++ +PGY DPY  R L  GEIGCFLSHY+IWK+++D   EK L+ EDD+RF P FK  L  +M + E    +W+L Y+GRKRM     E  V    +LV  DY+YWTL Y I+R+G EK++A  P +KM+ VDEFLP+MF++HP   +  ++  RNL A S+EPLL+ PTHYTG+P Y SDTE STI
Sbjct:   25 PSVLIAIIARNAAHTLPYFMDCIDKLDYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYADELGPKHWPASRFAHVMKLRQAALRTAKEKWSDYVLYIDADNFLTNPQTLNLMMKENKTIVAPMLESRTL--YSNFWCGMTPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTILIDLRKEASKNLQFYPPQEDYTWAFDDIIVFAFSSRQAGIQMYICNREHYGYLAVPMKPHQSLQDDIDYFVHVQTEAMIDRPP------LEPSRYVQVPPKHPDKMGFNEIFMINLKRRQDRRVRMLRSLYEQEIQVKIFDAVDGKALNASQLKAMKIEVIPGYHDPYSGRTLTSGEIGCFLSHYYIWKEVVDRGLEKSLVIEDDVRFEPLFKHKLMKLMNDIEEAEVEWDLIYIGRKRMQVERPEKAVPSVMNLVEADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVKKYLEYYESRNLKAFSAEPLLVYPTHYTGQPGYFSDTETSTI 549          
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000029234.1 (collagen beta(1-O)galactosyltransferase 2 [Source:NCBI gene;Acc:100495682])

HSP 1 Score: 457.603 bits (1176), Expect = 4.257e-154
Identity = 229/533 (42.96%), Postives = 338/533 (63.41%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + IA   RN AHTLPYF+  +++L+YPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++   E + + +++    W   R+ H+++LR  AL++A+  W+DY+L +DAD  + N  T+  ++     +V+P+L    L  YSNFW  MT  GYYKR+ DY  I++ ++ G F VPMVHS   IDL   ++ NL F P + D  +  DDII+FA S+ +    MYI N + YGY + P++ +  L  +I+ F H + + M+DR        L+ S+Y+ +      K+GF++I++INLKRR DRR++M     E  I+ K F+AVDGK LN + L ++ ++ +PGY DPY  R L  GEIGCFLSHY+IWK+++D   EK L+ EDD+RF P FK  L  +M + E    +W+L Y+GRKRM     E  V    +LV  DY+YWTL Y I+R+G EK++A  P +KM+ VDEFLP+MF++HP   +  ++  RNL A S+EPLL+ PTHYTG+P Y SDTE STI
Sbjct:   28 PSVLIAIIARNAAHTLPYFMDCIDKLDYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYADELGPKHWPASRFAHVMKLRQAALRTAKEKWSDYVLYIDADNFLTNPQTLNLMMKENKTIVAPMLESRTL--YSNFWCGMTPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTILIDLRKEASKNLQFYPPQEDYTWAFDDIIVFAFSSRQAGIQMYICNREHYGYLAVPMKPHQSLQDDIDYFVHVQTEAMIDRPP------LEPSRYVQVPPKHPDKMGFNEIFMINLKRRQDRRVRMLRSLYEQEIQVKIFDAVDGKALNASQLKAMKIEVIPGYHDPYSGRTLTSGEIGCFLSHYYIWKEVVDRGLEKSLVIEDDVRFEPLFKHKLMKLMNDIEEAEVEWDLIYIGRKRMQVERPEKAVPSVMNLVEADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVKKYLEYYESRNLKAFSAEPLLVYPTHYTGQPGYFSDTETSTI 552          
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000013230.1 (collagen beta(1-O)galactosyltransferase 2 [Source:NCBI gene;Acc:100495682])

HSP 1 Score: 457.218 bits (1175), Expect = 6.324e-154
Identity = 229/533 (42.96%), Postives = 338/533 (63.41%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + IA   RN AHTLPYF+  +++L+YPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++   E + + +++    W   R+ H+++LR  AL++A+  W+DY+L +DAD  + N  T+  ++     +V+P+L    L  YSNFW  MT  GYYKR+ DY  I++ ++ G F VPMVHS   IDL   ++ NL F P + D  +  DDII+FA S+ +    MYI N + YGY + P++ +  L  +I+ F H + + M+DR        L+ S+Y+ +      K+GF++I++INLKRR DRR++M     E  I+ K F+AVDGK LN + L ++ ++ +PGY DPY  R L  GEIGCFLSHY+IWK+++D   EK L+ EDD+RF P FK  L  +M + E    +W+L Y+GRKRM     E  V    +LV  DY+YWTL Y I+R+G EK++A  P +KM+ VDEFLP+MF++HP   +  ++  RNL A S+EPLL+ PTHYTG+P Y SDTE STI
Sbjct:   33 PSVLIAIIARNAAHTLPYFMDCIDKLDYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYADELGPKHWPASRFAHVMKLRQAALRTAKEKWSDYVLYIDADNFLTNPQTLNLMMKENKTIVAPMLESRTL--YSNFWCGMTPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTILIDLRKEASKNLQFYPPQEDYTWAFDDIIVFAFSSRQAGIQMYICNREHYGYLAVPMKPHQSLQDDIDYFVHVQTEAMIDRPP------LEPSRYVQVPPKHPDKMGFNEIFMINLKRRQDRRVRMLRSLYEQEIQVKIFDAVDGKALNASQLKAMKIEVIPGYHDPYSGRTLTSGEIGCFLSHYYIWKEVVDRGLEKSLVIEDDVRFEPLFKHKLMKLMNDIEEAEVEWDLIYIGRKRMQVERPEKAVPSVMNLVEADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVKKYLEYYESRNLKAFSAEPLLVYPTHYTGQPGYFSDTETSTI 557          
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000029220.1 (collagen beta(1-O)galactosyltransferase 2 [Source:NCBI gene;Acc:100495682])

HSP 1 Score: 457.218 bits (1175), Expect = 7.409e-154
Identity = 229/533 (42.96%), Postives = 338/533 (63.41%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + IA   RN AHTLPYF+  +++L+YPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++   E + + +++    W   R+ H+++LR  AL++A+  W+DY+L +DAD  + N  T+  ++     +V+P+L    L  YSNFW  MT  GYYKR+ DY  I++ ++ G F VPMVHS   IDL   ++ NL F P + D  +  DDII+FA S+ +    MYI N + YGY + P++ +  L  +I+ F H + + M+DR        L+ S+Y+ +      K+GF++I++INLKRR DRR++M     E  I+ K F+AVDGK LN + L ++ ++ +PGY DPY  R L  GEIGCFLSHY+IWK+++D   EK L+ EDD+RF P FK  L  +M + E    +W+L Y+GRKRM     E  V    +LV  DY+YWTL Y I+R+G EK++A  P +KM+ VDEFLP+MF++HP   +  ++  RNL A S+EPLL+ PTHYTG+P Y SDTE STI
Sbjct:   37 PSVLIAIIARNAAHTLPYFMDCIDKLDYPKSRIAIWAATDHNIDNTTAILREWLKSVQKLYHYVEWRPMAEPQSYADELGPKHWPASRFAHVMKLRQAALRTAKEKWSDYVLYIDADNFLTNPQTLNLMMKENKTIVAPMLESRTL--YSNFWCGMTPQGYYKRTPDYVLIREWKRLGCFPVPMVHSTILIDLRKEASKNLQFYPPQEDYTWAFDDIIVFAFSSRQAGIQMYICNREHYGYLAVPMKPHQSLQDDIDYFVHVQTEAMIDRPP------LEPSRYVQVPPKHPDKMGFNEIFMINLKRRQDRRVRMLRSLYEQEIQVKIFDAVDGKALNASQLKAMKIEVIPGYHDPYSGRTLTSGEIGCFLSHYYIWKEVVDRGLEKSLVIEDDVRFEPLFKHKLMKLMNDIEEAEVEWDLIYIGRKRMQVERPEKAVPSVMNLVEADYSYWTLGYAISRQGAEKLIAAEPFNKMLPVDEFLPVMFNKHPVKKYLEYYESRNLKAFSAEPLLVYPTHYTGQPGYFSDTETSTI 561          
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Match: Colgalt1 (collagen beta(1-O)galactosyltransferase 1 [Source:MGI Symbol;Acc:MGI:1924348])

HSP 1 Score: 470.7 bits (1210), Expect = 3.465e-159
Identity = 245/554 (44.22%), Postives = 356/554 (64.26%), Query Frame = 1
Query:  169 GSDINFNEQ-----SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKS--KLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            G+D  F E+     S    P++ IA   RN A  LP  LG LE+L +P++   L++  DH+ DN+S I+  W++ ++  YH V+++ + E   +  E+    WS  RYEH+++LR  ALKSAR +WADY+L MD D +I N +T+  LI     VV+P+L+  + + YSNFW  MT  GYYKR+  Y  I+KR+++G F VPMVHS + IDL   ++ NL F P   D  +  DDII+FA S ++ E  MY+ N ++YG+   P+  +  L  E E F H + ++M+          ++ S++  IS P K+  K+GFD++++INLKRR DRR +M     E  I+ +  EAVDGK +N + ++++ ++ LPGY DPYH R L  GE+GCFLSHY IWK+++D   +K L+FEDD+RF   FKR L  +M++ E    DW+L Y+GRKRM     E  V    +LV  DY+YWTL+Y+I+ +G +K+LA  PL+KM+ VDEFLP+MFD+HP  ++K+HF+PRNL A S EPLL+ PTHYTG+  Y+SDTE S +
Sbjct:   28 GADGYFPEERWSPESPLQAPRVLIALLARNAAPALPATLGALEQLRHPRERTALWVATDHNTDNTSAILREWLVAVKGLYHSVEWRPAEEPSSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFMDIDNLITNPDTLSLLIAENKTVVAPMLD--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPTHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEVYGFLPVPLRAHSSLQDEAESFMHVQLEVMVKHPP------VQLSRF--ISAPRKTSDKMGFDEVFMINLKRRRDRRERMLRALHEQEIDCQLVEAVDGKAMNTSQVEAMGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKAVPHVRNLVEADYSYWTLAYVISLQGAQKLLAAKPLAKMLPVDEFLPVMFDKHPMSEYKSHFSPRNLRAFSVEPLLIYPTHYTGDDGYVSDTETSVV 571          
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Match: Colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:MGI Symbol;Acc:MGI:2138232])

HSP 1 Score: 438.728 bits (1127), Expect = 1.593e-146
Identity = 233/534 (43.63%), Postives = 334/534 (62.55%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQE-DLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEA--YVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            P + +    RN AHTLPYFLG LERL+YPK  + ++   DH+ DN++ I+  W+  +Q  YH+V+++  NE E + ++I    W   R+ H+++LR  AL++AR  W+DY+L +D D  + N  T+  +IV    +V+P+L    L  YSNFW  +T  G+YKR+ DY  I++ ++ G F VPMVHS + IDL   ++  L F P   D  +  DDII+FA S+ +    MY+ N + YGY   P++ +  L  ++E   H + + M+D    E   FV    KY         K+GFD+I++INLKRR DRR +M     E  IE K  EAVDGK LN + L + N++ LPGY DPY  R L  GEIGCFLSH+ +WK+++D   EK L+ EDD+RF   FKR L  +M++ +    DWEL Y+GRKRM  KE    V +  +LV  DY+YWTL Y I+ +G +K++  +P  KM+ VDEFLPIM+++HP  ++K ++  R+L A S+EPLL+ PTHYTG+P Y+SDTE STI
Sbjct:   52 PTVFVVVLARNAAHTLPYFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKSVQRLYHYVEWRPMNEPESYPDEIGPKHWPNSRFSHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLMIVENKTIVAPMLESRGL--YSNFWCGITPQGFYKRTPDYLQIREWKRMGCFPVPMVHSTFLIDLRKEASDKLAFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNKEHYGYLPIPLKPHQTLQEDVENLIHVQIEAMIDHPPMEPSQFVSVVPKY-------PDKMGFDEIFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKAWNIEMLPGYRDPYSSRPLTRGEIGCFLSHFSVWKEVIDRELEKTLVIEDDVRFEHQFKRKLMKLMEDIDKAQLDWELIYIGRKRMQVKEPEKAVPNVVNLVEADYSYWTLGYAISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKEYYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTI 576          
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Match: Cercam (cerebral endothelial cell adhesion molecule [Source:MGI Symbol;Acc:MGI:2139134])

HSP 1 Score: 426.017 bits (1094), Expect = 4.672e-142
Identity = 215/542 (39.67%), Postives = 331/542 (61.07%), Query Frame = 1
Query:  196 SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEK--SKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            ++  LP + +A   RN  H+LP++LG LERL+YP+  + L+   DH+ DN++ ++  W+  +  +Y  V +K   E   +  E     W+KER++ +++LR +AL  AR   ADY+L  D D ++ N  T++ LI  ++PVV+P+L+      YSNFW  +T  GYY+R+ +YF  + R+++G F+VPMVHS + + L    TA L F P   N  +P DDII+FA + +     M++ N   YGY +  V+ +  L  E   F H   + ++D        +L ++    +S P K  SK+GFD++++I+L RRP RR +M     E+ I A+  +AVDG+ LN + L  L V  LPGY DPY    L  GE+GCFLSHY IW++++     ++++FEDD+RF   F+R L  +M++  I    W+L YLGRK+++ ++E  V     LV   Y+YWTL+Y ++  G  K+LA  PL +M+ VDEFLP+MFDRHP D +K +F PR+L A S+ PLL  PTHY+G+ +++SDTE S+  +D
Sbjct:   23 TEPTLPTVVLAILARNAEHSLPHYLGALERLDYPRARLALWCATDHNMDNTTGMLREWLAAVGRDYATVVWKPEEEARSYPDEQGPKHWTKERHQFLMELRQEALAFARDWGADYILFADTDNILTNNQTLKLLIDRQLPVVAPMLDSQTY--YSNFWCGITPQGYYRRTAEYFPTKNRQRQGCFRVPMVHSTFLLSLQTEETARLAFYPPHPNYSWPFDDIIVFAYACQAAGVSMHVCNDHRYGYMNVVVKPHQSLEEEKTNFIHLILEALVDGPP-----MLASAH---VSRPPKKLSKMGFDEVFVISLARRPQRRARMLSSLWEMEISAQVVDAVDGRTLNSSILKHLGVDLLPGYQDPYSGHTLTKGEVGCFLSHYSIWEEVVARGLARVVVFEDDVRFKDNFRRRLERLMEDVLIQKLSWDLIYLGRKQVNPEEEVAVEGLPGLVVAGYSYWTLAYTLSLAGARKLLASQPLHRMLPVDEFLPVMFDRHPNDQYKAYFWPRDLQAFSARPLLASPTHYSGDAEWLSDTETSSPWDD 554          
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Match: Colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:MGI Symbol;Acc:MGI:2138232])

HSP 1 Score: 322.398 bits (825), Expect = 1.540e-103
Identity = 179/443 (40.41%), Postives = 260/443 (58.69%), Query Frame = 1
Query:  154 DGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQE-DLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFY 1470
            D +  G +     +S    P + +    RN AHTLPYFLG LERL+YPK  + ++   DH+ DN++ I+  W+  +Q  YH+V+++  NE E + ++I    W   R+ H+++LR  AL++AR  W+DY+L +D D  + N  T+  +IV    +V+P+L    L  YSNFW  +T  G+YKR+ DY  I++ ++ G F VPMVHS + IDL   ++  L F P   D  +  DDII+FA S+ +    MY+ N + YGY   P++ +  L  ++E   H + + M+D    E   FV    KY         K+GFD+I++INLKRR DRR +M     E  IE K  EAVDGK LN + L + N++ LPGY DPY  R L  GEIGCFLSH+ +WK+++D   EK L+ EDD+RF   FKR L  +M++ +    DWEL Y
Sbjct:   33 DSDEDGEETVAFPESPPQKPTVFVVVLARNAAHTLPYFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKSVQRLYHYVEWRPMNEPESYPDEIGPKHWPNSRFSHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNLMIVENKTIVAPMLESRGL--YSNFWCGITPQGFYKRTPDYLQIREWKRMGCFPVPMVHSTFLIDLRKEASDKLAFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNKEHYGYLPIPLKPHQTLQEDVENLIHVQIEAMIDHPPMEPSQFVSVVPKY-------PDKMGFDEIFMINLKRRKDRRDRMLRTLYEQEIEVKIVEAVDGKALNTSQLKAWNIEMLPGYRDPYSSRPLTRGEIGCFLSHFSVWKEVIDRELEKTLVIEDDVRFEHQFKRKLMKLMEDIDKAQLDWELIY 466          
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Match: Plod3 (procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 [Source:MGI Symbol;Acc:MGI:1347008])

HSP 1 Score: 86.2705 bits (212), Expect = 4.046e-17
Identity = 67/246 (27.24%), Postives = 109/246 (44.31%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSV-----IMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARA-VWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEAD--NKYPIDDIILFAKSAEKNEAHMYIDNSKLYG 924
            P++ +A F+      LP FL  L  L+YP   I L++       NS V     I D W  Q+Q  +  V      E    GE                 RD A+ S R     ++   +DAD ++ N  T++ LI     V++P+L+  +   +SNFWG ++   YY RSEDY ++ +R++ G++ VP +   Y I    + T     LP+ +  +    D  + F KS       +++ N   +G
Sbjct:  299 PRVLLAVFVEQPTPFLPRFLQRLLLLDYPPDRISLFLH------NSEVYHEPHIADAWP-QLQDHFSAVKLVGPEEALSAGE----------------ARDMAMDSCRQNPECEFYFSLDADAVLTNPETLRVLIEQNRKVIAPMLS-RHGKLWSNFWGALSPNEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGETLRTE----LPQKEVFSSSDTDPDMAFCKSVRDKGIFLHLSNQHEFG 516          
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Match: sp|A5PK45|GT251_BOVIN (Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.908e-167
Identity = 242/543 (44.57%), Postives = 350/543 (64.46%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDG-LSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
             ++ +S    P++ IA   RN AH LP  LG LERL +P++   L++  DH+ DN+S ++  W++ ++  YH V+++ S E   +  E+    WS  RYEH+++LR  ALKSAR +WADY+L +DAD +I+N +T+  LI     VV+P+L+  + + YSNFW  MT  GYYKR+  Y  I+KRE++G F VPMVHS + IDL   ++ NL F P   D  +  DDII+FA S ++ E  MY+ N ++YG+   P+ +   L  E E F H + ++M+     E       S+++ +      K+GFD++++INLKRR DRR +M    +E  I  +  EAVDGK +N + +++L ++ LPGY DPYH R L  GE+GCFLSHY IWK+++D   +K L+FEDD+RF   FKR L  +M++ E    DW+L Y+GRKRM     E  V    +LV  DY+YWTL+Y+I+ +G  K+LA  PLSKM+ VDEFLP+MFD+HP  ++K HF+PR+L A S EPLL+ PTHYTG+  Y+SDTE S +
Sbjct:   43 RWSPESPLQAPRVLIALLARNAAHALPATLGALERLRHPRERTALWVATDHNADNTSAVLREWLVAVKGLYHSVEWRPSEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLTLLIAENKTVVAPMLD--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKRERRGCFAVPMVHSTFLIDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEVYGFLPVPLRSHSTLQDEAESFMHVQLEVMVKHPPSE------PSRFISVPTKTPDKMGFDEVFMINLKRRQDRRERMLRALEEQEIACRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMQDVEREGLDWDLIYVGRKRMQVEHPEKAVPRVRNLVEADYSYWTLAYVISLQGARKLLAARPLSKMLPVDEFLPVMFDKHPVSEYKAHFSPRDLRAFSVEPLLIYPTHYTGDDGYVSDTETSVV 577          
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Match: sp|Q17FB8|GLT25_AEDAE (Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1)

HSP 1 Score: 474.167 bits (1219), Expect = 7.002e-160
Identity = 253/548 (46.17%), Postives = 350/548 (63.87%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKV-SNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF----LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDRED---QEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDL-K*LND 1821
            PK+ I   IRNK HTLPYF   LE   YPK  I L+ R DH+ED S  I+  W+ ++  +YH VD+   S+  +R+ E   T WS++R+  +I+L+ +AL   R +WAD++L +DADV++ N NTI  L+   +P+V+P+L    L  YSNFW  MT   YY R+++Y +I   EK G F VPMVHS   +++N+  + NL+F    LP      P+DDII+FA SA  +   MYI NS  YGY   P+E  D L +++E   + K  I+ +      +EDL      K+    +P K K+G   IY+INL+RRP+RR KM   FDELG++ ++F AVDG++L+   L  + VK LPGY+DPYHKR + MGEIGCFLSHY+IW+ M+  N E++L+ EDDIRF P FKR +  V+ +A   I  W+L Y GRKR+  D E +V     LV   Y+YWTL Y+I+ +G +K+L + PL K++ VDE++PIMF+ HP + W  HF  RNLVA S+ PLLL PTHYTG+  YISDTEDS  +++  K LND
Sbjct:   29 PKVLIVSLIRNKEHTLPYFFSYLEDQEYPKDRISLWFRSDHNEDRSIDIIKAWLKRVTKKYHSVDFGYRSDAAKRYDEKSSTHWSEDRFADVIRLKQEALDKGRKMWADFVLFLDADVLLTNPNTIAKLVSLNLPIVAPMLLSDGL--YSNFWCGMTADYYYHRTDEYKEILNYEKTGEFPVPMVHSAVMVNINVQQSLNLSFDKRRLPPGHYTGPVDDIIIFAMSANYSSIPMYISNSASYGYILVPLEQGDPLEKDLEQLTNTKVYIINEHGAINLKEDL------KHFVPKVP-KDKMGVSHIYMINLERRPERRNKMFNNFDELGLDVEFFPAVDGRQLSDDKLRDIGVKFLPGYADPYHKRPMTMGEIGCFLSHYYIWEKMVAMNQEEVLVLEDDIRFEPYFKRRVAQVLDDAR-RIGGWDLIYFGRKRLQEDDEKWVVGSETLVVAGYSYWTLGYLISLQGAKKLLEEKPLEKLVPVDEYIPIMFNNHPNESWVNHFKNRNLVAWSAAPLLLYPTHYTGDDGYISDTEDSARIDNFNKVLND 566          
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Match: sp|A5PMF6|GT251_DANRE (Procollagen galactosyltransferase 1 OS=Danio rerio OX=7955 GN=colgalt1 PE=3 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.846e-158
Identity = 232/552 (42.03%), Postives = 349/552 (63.22%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK*LND 1821
             ++ +S  L P++ +A   RN AH+LP+ LG ++RLNYPK  + +++  DH+ DN++ I+  W++ +Q+ YH+V+++  +E   + GE     W+  RYEH+++LR  AL++AR +WADY +++D D ++ N + +  L+     +V+P+L   + + YSNFW  MT  GYYKR+  Y  I+++E+KG F VPMVHS   +DL   ++  L F P   D  +  DDII+FA SA   E  MYI N + YGYF  P+ + + L  E E F H++ ++M+          ++ S YL +   +  K+GFD++++INL RR DRR +M     E  I  K   AVDGK LN + +++L +K LPGYSDPYH R L  GE+GCFLSHY IW +++D   +  L+ EDD+RF   FKR L  +M+E +    DW+L Y+GRKRM     E  V     LV  DY+YWTL Y+I+ +G +K+L   PL KM+ VDEFLP+M+++HP +++ +HF  R+L A S+EPLL+ PTHYTG+  YISDTE S++ ++   L D
Sbjct:   24 RWSPESALLAPRVLVALVCRNSAHSLPHVLGAIDRLNYPKDRMAVWVATDHNSDNTTEILREWLVNVQNFYHYVEWRPQDEPSVYEGESGPKHWTNLRYEHVMKLRQAALETAREMWADYFMLVDCDNLLTNRDVLWKLMRENKTIVAPMLE--SRAAYSNFWCGMTSQGYYKRTPAYMPIRRQERKGCFAVPMVHSTLLLDLRKEASRQLAFFPPHPDYTWAFDDIIIFAFSARMAEVQMYICNRETYGYFPVPLRSQNSLQDEAESFLHSQLEVMVRNPP------IEPSVYLSLMPKQTDKMGFDEVFMINLLRRSDRRERMLRTLYEQEIACKIITAVDGKALNASQVEALGIKMLPGYSDPYHGRPLTKGELGCFLSHYNIWNEIVDRGLQSSLVIEDDLRFEVFFKRRLQNLMQEVQSQQLDWDLIYIGRKRMQVERPEKSVPRIHSLVEADYSYWTLGYVISLRGAQKLLRAEPLKKMLPVDEFLPVMYNKHPIEEYMSHFPQRDLRAFSAEPLLIYPTHYTGDQGYISDTETSSVWDNESVLTD 567          
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Match: sp|Q8K297|GT251_MOUSE (Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2)

HSP 1 Score: 470.7 bits (1210), Expect = 2.424e-158
Identity = 245/554 (44.22%), Postives = 356/554 (64.26%), Query Frame = 1
Query:  169 GSDINFNEQ-----SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKS--KLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            G+D  F E+     S    P++ IA   RN A  LP  LG LE+L +P++   L++  DH+ DN+S I+  W++ ++  YH V+++ + E   +  E+    WS  RYEH+++LR  ALKSAR +WADY+L MD D +I N +T+  LI     VV+P+L+  + + YSNFW  MT  GYYKR+  Y  I+KR+++G F VPMVHS + IDL   ++ NL F P   D  +  DDII+FA S ++ E  MY+ N ++YG+   P+  +  L  E E F H + ++M+          ++ S++  IS P K+  K+GFD++++INLKRR DRR +M     E  I+ +  EAVDGK +N + ++++ ++ LPGY DPYH R L  GE+GCFLSHY IWK+++D   +K L+FEDD+RF   FKR L  +M++ E    DW+L Y+GRKRM     E  V    +LV  DY+YWTL+Y+I+ +G +K+LA  PL+KM+ VDEFLP+MFD+HP  ++K+HF+PRNL A S EPLL+ PTHYTG+  Y+SDTE S +
Sbjct:   28 GADGYFPEERWSPESPLQAPRVLIALLARNAAPALPATLGALEQLRHPRERTALWVATDHNTDNTSAILREWLVAVKGLYHSVEWRPAEEPSSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFMDIDNLITNPDTLSLLIAENKTVVAPMLD--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPTHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEVYGFLPVPLRAHSSLQDEAESFMHVQLEVMVKHPP------VQLSRF--ISAPRKTSDKMGFDEVFMINLKRRRDRRERMLRALHEQEIDCQLVEAVDGKAMNTSQVEAMGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKAVPHVRNLVEADYSYWTLAYVISLQGAQKLLAAKPLAKMLPVDEFLPVMFDKHPMSEYKSHFSPRNLRAFSVEPLLIYPTHYTGDDGYVSDTETSVV 571          
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Match: sp|Q8NBJ5|GT251_HUMAN (Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 3.802e-158
Identity = 244/545 (44.77%), Postives = 351/545 (64.40%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKS--KLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
             ++ +S    P++ IA   RN AH LP  LG LERL +P++   L++  DH+ DN+S ++  W++ ++S YH V+++ + E   +  E+    WS  RYEH+++LR  ALKSAR +WADY+L +DAD +I+N +T+  LI     VV+P+L+  + + YSNFW  MT  GYYKR+  Y  I+KR+++G F VPMVHS + IDL   ++ NL F P   D  +  DDII+FA S ++ E  MY+ N + YG+   P+  +  L  E E F H + ++M+     E       S++  IS P K+  K+GFD++++INL+RR DRR +M        IE +  EAVDGK +N + +++L ++ LPGY DPYH R L  GE+GCFLSHY IWK+++D   +K L+FEDD+RF   FKR L  +M++ E    DW+L Y+GRKRM     E  V    +LV  DY+YWTL+Y+I+ +G  K+LA  PLSKM+ VDEFLP+MFD+HP  ++K HF+ RNL A S EPLL+ PTHYTG+  Y+SDTE S +
Sbjct:   42 RWSPESPLQAPRVLIALLARNAAHALPTTLGALERLRHPRERTALWVATDHNMDNTSTVLREWLVAVKSLYHSVEWRPAEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSLLIAENKTVVAPMLD--SRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRRGCFAVPMVHSTFLIDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAE------PSRF--ISAPTKTPDKMGFDEVFMINLRRRQDRRERMLRALQAQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNIWKEVVDRGLQKSLVFEDDLRFEIFFKRRLMNLMRDVEREGLDWDLIYVGRKRMQVEHPEKAVPRVRNLVEADYSYWTLAYVISLQGARKLLAAEPLSKMLPVDEFLPVMFDKHPVSEYKAHFSLRNLHAFSVEPLLIYPTHYTGDDGYVSDTETSVV 576          
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Match: A0A5J4NR85 (Collagen beta-1,O-galactosyltransferase OS=Paragonimus westermani OX=34504 GN=DEA37_0015175 PE=4 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 277/585 (47.35%), Postives = 372/585 (63.59%), Query Frame = 1
Query:  121 NICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI-------------VHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN---DG--------LSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLP-ISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            N    N    + G    SD   +   + + P + +   +RNKAH+LPYFL  LE   YP   I L+   D+S DNS  ++  W+  ++ +YH +   +   G+   +   TMWSKE YEH+IQ R   L S+R  WAD+   +DADV+++N NT+  L+                V VV+PL+NCT    YSNFWG M+E GYYKRS++YFDIQ+R+  GI  V M+HSVY ++L    T  L + P  +    P+DD+I+FA+SA+      Y+DN+  YGY  SPVE    DG        L RE E+F H + Q +LD ED+  +   K  + L    LP  SKLGFD++Y INL RR DRR KMEY  D+LGI A++  AVDGK LN   + S+ +KQL GY+DPYHKR LK GEIGCFLSH+++W++M+++ Y++ILI EDD+RF P F R+L  +M EA+  +P+W+L Y+GRKRMS  E  V     L YPDYTYWTL Y++ RKG EK+LAQ PL K++AVDE+LPIMF+RHPQ DW   F PRNL+A+S+EPLL+EP  YTGE  Y+SDTEDS ++
Sbjct:   86 NDSTVNETVAVSGKQSRSDEVHSSDDREIRPSVYLGILVRNKAHSLPYFLRGLEMQAYPTDRITLHFVCDNSIDNSLFLLSHWVNAVRDKYHQITTDIG--GDELEQT--TMWSKEHYEHVIQSRQYLLNSSRLSWADFFFSIDADVILMNPNTLDRLVNVSWKPVEVDSGLRADVSVVAPLINCTTSEYYSNFWGAMSEEGYYKRSQNYFDIQRRQTVGIHSVAMIHSVYLVNLRHRITQKLAYFPVPEGYAGPLDDLIIFARSAQAAGVTFYLDNTCFYGYLPSPVEEGDMDGHGTFVEQWLRREQELFVHLRLQALLDHEDRMRVLASKHLEMLAEAQLPTPSKLGFDEVYFINLLRRSDRRAKMEYFLDQLGIAARHVTAVDGKDLNADVIASMGIKQLKGYADPYHKRSLKFGEIGCFLSHFYLWQEMIEHGYQRILILEDDVRFAPAFVRNLAELMVEADTHVPEWDLIYVGRKRMSKNETRVPHTTRLAYPDYTYWTLGYVLKRKGAEKLLAQEPLKKLVAVDEYLPIMFNRHPQRDWLEQFQPRNLIALSAEPLLVEPQRYTGERYYVSDTEDSKVL 666          
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Match: A0A0X3P397 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS6918 PE=4 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 271/582 (46.56%), Postives = 386/582 (66.32%), Query Frame = 1
Query:  142 GDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILT--MWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVP---------VVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSR------------EIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLP--EKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV-EDL 1806
            G  ++  P+ SD    ++   + P + +   +RNKAH+LP+FLG+LERL+YPK+ + LYI++D++ DNS  I++ W+ +++  YH VD ++ +E     ED +T   W++E Y  +I+LR +AL+ AR+VWA++   +DADV+++N+ T++ L+   V          ++ P+LNC++   YSNFWG+MT  GYY+RS++YFDIQ+R+ +G+  V M+H+ + ++L L  +  L + P       P+DDII+FA+S +    + Y+DN + +GYF  P++   L +            E E F H + Q  +D +    L     S   P+ LP  E SK+GFD+IYLINL RRPDR  KM++   ELG+ AK  EAVDGK+L K  +  +N+ QL GY+DPYHKR LK GEIGCFLSHY IW DM++NNY++ILI EDD+RF PGF R L   +KEA+   P+WEL Y+GRKRMS  E  V    +L YP YTYWTL+Y +   G  K+LAQ PL +++AVDEFLPIMF+RHP   W + F PR+LVAIS+EPLL+EPT YTGEP YISDTEDS+++ EDL
Sbjct:   36 GQPLEPPPILSDA---KRRTYMAPTVSVGILVRNKAHSLPFFLGHLERLDYPKQRMHLYIKIDNTFDNSQSIIEEWLRKVRHLYHAVDLELQDE-----EDTVTEPHWTEEHYRQLIRLRQKALERARSVWAEFFFSLDADVILLNKATLRHLVETSVASETSAQPTVILGPMLNCSSSEVYSNFWGEMTPAGYYRRSKNYFDIQRRKTQGVIPVAMLHTAFLVNLRLTESQRLRYDPPPKGYDGPVDDIIIFARSVQATGLNFYLDNREFFGYFPLPLDEHDLRQLQLTSKENWTALEAEYFVHLRIQSEID-DATTSLIQPSPSLNSPVFLPVTEASKVGFDQIYLINLARRPDRLKKMKFALRELGVTAKLIEAVDGKRLTKEIIKEMNITQLSGYADPYHKRALKFGEIGCFLSHYGIWMDMLNNNYQRILILEDDLRFVPGFTRRLLATVKEADSARPEWELLYVGRKRMSSDEKVVPGTRYLAYPSYTYWTLAYALTNSGARKLLAQRPLERLVAVDEFLPIMFNRHPNKGWLSAFGPRDLVAISAEPLLVEPTQYTGEPNYISDTEDSSVIPEDL 608          
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Match: A0A4E0RDJ1 (Procollagen galactosyltransferase OS=Fasciola hepatica OX=6192 GN=D915_004556 PE=4 SV=1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 277/563 (49.20%), Postives = 377/563 (66.96%), Query Frame = 1
Query:  196 SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDIL---TMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI--VHK---------VPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGL-----------SREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPIS---LPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            S  L P + I   +RNK H+LPYFL  LE  +YP   + L   +D+S D+S +++ TW+  ++S+YH ++ +V N       D+L     WS+E + H +QLR + L +AR  WAD+ L +DADV++VN  +I  L+   H          +PVV+PLLNCTN   YSNFWGDMTE GYYKRS+DYFDIQ+R K G+F V MVH+++ ++L+   T  L F P  D    PIDD+IL A+SA+      YIDN++ YGY ++PVE   L           +R++E+F H + Q ++D+E+     +L +     I+   LP +SKLG D+IY INL RRPDRR+K EY  D+LG+ A++  AVDGK+L+   +  + V+QL GY+DPYHKR LK GEIGCFLSHY +WK+M++  +++ILI EDD+RF PGF R+L  V++EA++  P+WEL Y+GRKRMS  E  V     L YPDYTYWTL Y++ + G EK+LAQNPL KM+AVDEFLPIMF+RHPQ  W   F PR+L+A+S+EPLLLEP  YTGE  Y+SDTEDS +V
Sbjct:  153 SYELPPTVFIGVPVRNKGHSLPYFLHGLEIQDYPTDRLHLSFIVDNSIDDSLLVLSTWIEAVRSKYHGIELEVGN-------DLLENTKQWSEEHHRHFVQLRQKLLDAARHSWADFYLSIDADVILVNPKSILHLVEVSHNPDSSELPPILPVVAPLLNCTNSEYYSNFWGDMTEQGYYKRSDDYFDIQRRFKLGVFPVAMVHTMFLVNLHHFLTPLLQFYPPTDGYTGPIDDLILLARSAQVASVQYYIDNTQFYGYIAAPVEETDLEEIGSFVENWINRDVELFTHLRLQALIDQEEYSP--ILPSPHLTQIAENHLPTRSKLGLDEIYYINLLRRPDRRMKTEYFLDQLGVAAQHVVAVDGKELDLDNMKEMGVEQLKGYADPYHKRSLKFGEIGCFLSHYNLWKEMVERGFQRILILEDDVRFAPGFVRNLAEVIREADLHKPEWELLYIGRKRMSKNETRVPGTQKLAYPDYTYWTLGYLLKQSGAEKLLAQNPLKKMVAVDEFLPIMFNRHPQKAWLEAFGPRDLIALSAEPLLLEPQKYTGEQFYVSDTEDSGVV 706          
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Match: H2KNS5 (Collagen beta-1 O-galactosyltransferase OS=Clonorchis sinensis OX=79923 GN=CLF_100673 PE=4 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 273/564 (48.40%), Postives = 368/564 (65.25%), Query Frame = 1
Query:  205 LLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILT---MWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI-------------VHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDG-----------LSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPIS---LPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            L P + I   +RNKAH LPYFL  LE  +Y  K I L    D+S D+S  ++  W+  +   YH V+ ++       G D L    MWS E YEH+  LR + L +AR  WAD+ L +DADV+++N  T++ L+             +  +PV+SPL+NCT+   YSNFWG MTETGYY RS+ YFDIQ+R   G+F+VPMVHS++ ++L    + NL + P     K P+DD+I+FA+SA+ +    Y+DN + YGY  +PV+              L RE+E+F H + ++++D+ED   + VL +     ++   LP +SKLGFD++Y INL RR DRR KMEY  D+LGI+A++  AVDG  L    +  L +KQLPGY+DPYHKR LK GEIGCFLSHY +W++M D  YE+I+I EDD+RF PGF R+L  V+ EA+   PDWEL Y+GRKRMS  E  V   ++L YPDYTYWTL Y++ R G  K+LAQ+PL +M+AVDE+LPIMFDRHPQ  W   F PRNLVA+S+EPLL+EP  YTGE  Y+SDTEDS ++ D
Sbjct:  118 LPPTVFIGVLVRNKAHALPYFLHGLETQDYLTKRIQLLFLADNSIDDSVNVLSQWIDSVSERYHQVNLEI-------GGDYLAHSKMWSTEHYEHVALLRQRLLNAARKSWADFYLTIDADVILMNPGTLKHLVESAQSPGKIVSELLDPLPVISPLMNCTSSEFYSNFWGAMTETGYYARSDTYFDIQRRLVLGLFEVPMVHSIFLVNLRHKLSENLRYFPPPSGYKGPLDDLIIFARSAQLSNVPFYLDNREFYGYLPAPVDESDVFGPGSPTEQWLRREVELFVHLRLEVVIDQEDS--MRVLPSEALKDVAENHLPPRSKLGFDEVYYINLLRRKDRRAKMEYFLDQLGIDARHVAAVDGMLLTSENITKLGIKQLPGYADPYHKRALKFGEIGCFLSHYRLWREMEDRGYERIMILEDDVRFAPGFVRNLAGVLSEADTIKPDWELIYIGRKRMSKHEKRVPGTSNLAYPDYTYWTLGYLLKRSGARKLLAQDPLRRMVAVDEYLPIMFDRHPQKAWLEQFKPRNLVALSAEPLLVEPQRYTGEKHYVSDTEDSEVLSD 672          
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Match: A0A183W0G7 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6223 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 275/572 (48.08%), Postives = 382/572 (66.78%), Query Frame = 1
Query:  196 SQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVS--NEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIV-------------------HKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE------------NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPIS---LPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVE 1800
            S  L+P + I   +RNKAHTLPYFL  +E   YP K I L   +D++ D+S  I++ W+   + +YH++  +V   N      E+I  +W++  Y+HII+LR + L  AR +WAD+ L +DADV+++N  TI+ LI                     ++ +++PLLNCT+   YSNFWG M+E GYY RS+ YFD+QKR  +G++ V MVHS++ ++L    +  + + P   N   PIDDII+F++S ++ E   Y+DN++ YGY  SPV+            N  L RE ++F H + Q ++D E+++   V  ++  L I+   LP+ SKLGFD+IY INL RR DRRLKMEY+FD+LG+  K +EAVDGK L+   LD L++KQLPGY+DPYHKR LK GEIGCFLSHY IW +M+   Y+++LI EDD+RF P F  +LN V++EA+  +P W+L Y+GRKRMS KE  V +   LV+PDYTYWTL YI+N  G +K+L QNPL KM+AVDE+LPIMFDRHP+ DW T F PR+++AIS+EPLL+EP  YTGE  YISDTEDS +V+
Sbjct:  152 SNLLMPTLCIGVLVRNKAHTLPYFLNGIESQQYPSKRITLIFYVDNTIDSSDAILNEWIQCNKHKYHNIILEVEEHNVSRSTDEEISKLWTENHYQHIIKLRQKLLNKARDMWADFYLSIDADVILMNPATIEHLISVMLKPLNDVSQSDINSRSNEEIIILAPLLNCTSSEHYSNFWGAMSEEGYYLRSDHYFDLQKRRIQGVYPVAMVHSMFLVNLKFQKSELIGYDPPPTNYTGPIDDIIIFSRSVQRAEIDFYLDNTQFYGYIPSPVDEQDLNIYSEDLSNAWLLREQDLFVHLRLQAIIDEENKQK--VSPSNCLLDIANNQLPKLSKLGFDEIYFINLLRRTDRRLKMEYMFDQLGMSVKRYEAVDGKNLSLEKLDELHIKQLPGYTDPYHKRSLKYGEIGCFLSHYNIWNEMVSRGYQRVLILEDDLRFIPAFINNLNKVVREADENVPGWDLLYIGRKRMSKKEKRVQNTTSLVHPDYTYWTLGYILNINGAQKLLNQNPLQKMVAVDEYLPIMFDRHPRKDWLTQFEPRDILAISAEPLLVEPQRYTGEKYYISDTEDSEVVQ 721          
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Match: colgalt1 (collagen beta(1-O)galactosyltransferase 1 [Source:NCBI gene;Acc:103033940])

HSP 1 Score: 472.626 bits (1215), Expect = 3.656e-160
Identity = 239/542 (44.10%), Postives = 342/542 (63.10%), Query Frame = 1
Query:  184 FNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFG-EDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF-LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            ++ +S  L P++ IA   RN  H+LPYFLG +ERLNYPK+ I L++  DH+ DN++ ++  W++ +Q  YH+V+++   E   +  E+    W   RY H+++LR  AL+SAR +WADYL+++D D ++ N + +  LI     VV+P+L     + YSNFW  MT  GYYKR+  Y  ++K+ +KG F VPMVHS + +DL   ++  L F  P  D  +  DDII+FA SA   E  M++ N + YG F  P+ + + L  EI+ F H   +I +     E       SKYLP  + +  K+GFD++++INL+RR DRR +M     E+ I+ K   AVDGK +N + + +L +  LPGYSDPYH R L  GE+GCFLSHY IWK+++D   +  L+ EDD+RF   FKR L  ++ E +    DW+L Y+GRKRM     E  V    +LV  DY+YWTL Y+++ +G +K+L  +PLSKM+ VDEFLPIMF++HP  D+   F  RNL A S+EPLL+ PTHYTGEP YISDTE ST+
Sbjct:   29 WSPESPLLAPRVVIAMICRNSEHSLPYFLGTIERLNYPKERIALWVATDHNSDNTTYLLRDWLINVQKLYHYVEWRPQEEPRSYADEEGPKQWPNTRYAHVMKLRQAALESAREMWADYLMIVDCDNLLTNRDVLWKLIRENKTVVAPMLESR--AAYSNFWCGMTSQGYYKRTPAYIPMRKQVRKGCFAVPMVHSTFLLDLRKEASRLLAFHPPHPDYSWAFDDIIVFAFSARMAEVQMFVCNKETYGNFPVPLRSHNSLQDEIDSFMHTVLEINVRNPHVE------PSKYLPAPIRQPDKMGFDEVFMINLQRRTDRRERMLRALSEMEIDCKVVAAVDGKAMNVSEIHALGIHMLPGYSDPYHGRPLTKGELGCFLSHYNIWKEIVDRGLKSSLVIEDDLRFEVFFKRRLKNLLIEVQREGLDWDLIYIGRKRMQVDRPEKAVPKVHNLVEADYSYWTLGYMMSLQGAKKLLNVDPLSKMLPVDEFLPIMFNKHPISDYMEQFEDRNLKAFSAEPLLVYPTHYTGEPGYISDTETSTV 562          
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Match: colgalt2 (procollagen galactosyltransferase 2-like [Source:NCBI gene;Acc:103042875])

HSP 1 Score: 455.677 bits (1171), Expect = 1.411e-153
Identity = 225/536 (41.98%), Postives = 335/536 (62.50%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDA--HLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            PK+ IA   RN AH+LPY+LG +E L YPK+ I ++   DH+ DN++ ++  W+   QS YH+V+++   E   + ++     WS  R+ H+++LR  ALK+AR  WADY+L  D+D ++ N   +  ++     +V+P++   +L  YSNFW  +T  GYYKR+ DY  I++ ++ G F VPMVHS + +DL   S+ +L F P   D  +  DDI++FA SA + +  MY+ N + YG+   P++ +  +  E E F H   + ++D         +K S+ L +    +  +GFD+I+LINLKRR DRR +M    D LG+E    EAVDGK LN + L +L ++ +P Y DPY  R L  GEIGCFLSH+  W ++++   + +L+ EDD+RF P FK+ L  +M++ E    DW+L Y+GRKRM   +  VS +   +LV  DY+YWTL Y ++++G +K+L+     KM+ VDEFLPIMF++HP   + THF PR+L+A S EPLL+ PTHYTGEP Y SDTE STI +D
Sbjct:   32 PKVLIAIVARNAAHSLPYYLGCIENLQYPKERIAIWAATDHNVDNTTAMLREWLKAAQSRYHYVEWRPMEEPRSYTDEWGPKHWSPSRFNHLMKLRQAALKAARERWADYILFADSDNLLTNPRVLDLMMAENRTLVAPMMESRSL--YSNFWCGITPQGYYKRTPDYQPIREWKRLGCFPVPMVHSTFLLDLRRSSSKSLAFYPPHPDYSWAFDDIMVFAFSARQADVQMYVCNKEHYGFLPVPLKAHQSVKDEEESFTHTITEALIDH-------TVKPSQLLFVPPKPRDMMGFDEIFLINLKRRTDRRERMLNTLDILGLEVTVTEAVDGKALNSSKLQALGIEMMPDYKDPYSGRVLTRGEIGCFLSHHATWTEVVERGLQSVLVLEDDVRFEPRFKKRLQTIMEDVEKAQLDWDLIYVGRKRMQVAQPEVSVEGVDNLVVADYSYWTLGYALSQQGAQKLLSAQSFHKMLPVDEFLPIMFNKHPNAAYMTHFEPRDLLAFSVEPLLIYPTHYTGEPGYFSDTETSTIWDD 558          
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Match: cercam (procollagen galactosyltransferase 2 [Source:NCBI gene;Acc:103038801])

HSP 1 Score: 454.136 bits (1167), Expect = 3.692e-153
Identity = 240/550 (43.64%), Postives = 352/550 (64.00%), Query Frame = 1
Query:  172 SDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTF-LPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSP------VENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            S+ N+ E+S+   P + IA   RN AH+LPY+LG LERLNYPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++  ++   + GE     W+  RYE++++L+  AL  A+  WADY+L  DAD ++ N  T+  LI     V++P+L+    S YSN+W  +T  GYY+R+ +YF  ++R + G F VPMVHS   +DL   +T  + F  P  D  +P DDII+FA S   +E  MY+ N + YGY + P      VE+D ++     F H   + ++D         +  S Y+ +   +   +GFD+IYLINL+RRPDRR +M +   E+ I AK  +AVDG  LN + +  L V  LPGY+DP++ R L  GE+GCFLSHY+IWK+M+D   +K LI EDD+RF   FKR L  +M+E E+   DW++ YLGRK+++  KE  V +  +LVY DY+YWTLSYII+ +G +K++   PLSKM+ VDEFLPIM+D+HP +D+K+HF  RNL A S+ PLL++P HY G+P+++SDTE ST+
Sbjct:   21 SEENYTEESKMQQPTVVIAIIARNAAHSLPYYLGALERLNYPKDRISIWAATDHNTDNTTAILREWLTVMQQFYHYVEWRPMDKPTSYAGELGPKHWTNGRYEYLMKLKQAALNFAKKRWADYILFTDADNILTNPETLNLLIAENKSVIAPMLDSQ--SAYSNYWCGITPQGYYRRTAEYFPTRRRYRTGCFPVPMVHSTMLLDLRKENTRRVAFHPPHTDYSWPFDDIIVFAFSCRVSEVQMYVCNKERYGYLNVPAKPHEQVEDDHVN-----FIHLYLEALIDGPP------MYVSPYIHVPPKQTDLMGFDEIYLINLRRRPDRRDRMLWSLYEMEINAKVVDAVDGAALNSSDIKLLGVDILPGYNDPFNGRSLTKGEVGCFLSHYYIWKEMVDMQLDKALILEDDVRFQGNFKRRLRHLMEEVELAELDWDIIYLGRKQVNPSKEEPVQNVKNLVYVDYSYWTLSYIISLQGAQKLINAEPLSKMLPVDEFLPIMYDKHPNEDYKSHFLNRNLQAFSTSPLLVQPAHYAGDPQWVSDTETSTL 557          
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Match: si:ch211-13f8.2 (procollagen galactosyltransferase 2 [Source:NCBI gene;Acc:103024967])

HSP 1 Score: 453.366 bits (1165), Expect = 1.177e-152
Identity = 239/586 (40.78%), Postives = 355/586 (60.58%), Query Frame = 1
Query:   70 IQMIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFG---EDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYP--IDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPV-ENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDK--EAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            +Q+ F   +  F  +           +ID  P+        +S  L PK+ IA   RN  H+LP++LG +ERL+YPK  I +++  DHS DN++ ++  W+  ++  YH V ++ + E ER     E     W + R+ H++++R  AL+SARA WADY+L  D+D ++ N   +  L+     +V+P+L    L  YSNFW  MT  GYYKR+E+Y  I+ R++ G   VPM+HS   +DL   ++  L F P   N YP  +DDI++F+ SA +    M++ N + YG+   P+     L  E E F H+  + M++       F ++ S+YL +    K ++ FD++YLINL+RR DRR +M    + LGIE    +AVDGK LN + L +L ++ LPGY DPY  R L  GEIGCFLSH+ IWK+++    +++L+ EDD+RF   FK  LN +M++A+     W+L Y+GRKR+  K  E +V    +L++PDY+YWTL Y ++ +G +K+L   PLSKM+ VDEFLP MF++HP++++  HF  RNL+A S EPLLL PTHYTGEP Y SDTE STI +D
Sbjct:    8 VQLFFAALMTRFGSLSA---------LIDLEPV------RPESALLKPKVMIAILARNSEHSLPFYLGCIERLDYPKDRIAVWVAADHSSDNTTAMLQEWLSGVEGLYHSVRFR-TTEDERSSYEDEQGPKHWPESRFIHVMKMRQAALRSARAQWADYILFADSDNLLTNPAVLMQLMGENRTLVAPMLQSRTL--YSNFWCGMTTQGYYKRTEEYVPIRNRKRIGCHAVPMIHSTMLLDLRRSASKALAFYPPHHN-YPWVLDDIMVFSFSARQAGVQMFVSNREDYGFLPVPLGAQQTLKEEAESFAHSLTEAMVE-------FPMQPSRYLTLRPKRKDRMTFDEVYLINLRRREDRRQRMLSTLEVLGIEVTLTDAVDGKALNSSQLQALGIEMLPGYKDPYSDRVLTRGEIGCFLSHFNIWKEVVRKQQKQVLVLEDDVRFELNFKTRLNTIMEDAKHAHLSWDLIYVGRKRLQVKSPERWVKGVKNLIHPDYSYWTLGYALSLEGAKKLLDAQPLSKMLPVDEFLPAMFNKHPKEEYMAHFEQRNLLAYSVEPLLLYPTHYTGEPGYFSDTETSTIWDD 567          
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Match: cercam (procollagen galactosyltransferase 2 [Source:NCBI gene;Acc:103038801])

HSP 1 Score: 431.409 bits (1108), Expect = 1.129e-144
Identity = 233/547 (42.60%), Postives = 340/547 (62.16%), Query Frame = 1
Query:  172 SDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            S+ N+ E+S+   P + IA   RN AH+LPY+LG LERLNYPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++  ++   + GE     W+  RYE++++L+  AL  A+  WADY+L  DAD ++ N  T+  LI     V++P+L+    S YSN+W  +T  GYY+R+ +YF  ++R + G F VPMVHS   +DL   +T  + F P   D  +P DDII+FA S   +E  MY+ N + YGY + P +                      E  ED  V     ++ + L   S+     IYLINL+RRPDRR +M +   E+ I AK  +AVDG  LN + +  L V  LPGY+DP++ R L  GE+GCFLSHY+IWK++     +K LI EDD+RF   FKR L  +M+E E+   DW++ YLGRK+++  KE  V +  +LVY DY+YWTLSYII+ +G +K++   PLSKM+ VDEFLPIM+D+HP +D+K+HF  RNL A S+ PLL++P HY G+P+++SDTE ST+ ++
Sbjct:   21 SEENYTEESKMQQPTVVIAIIARNAAHSLPYYLGALERLNYPKDRISIWAATDHNTDNTTAILREWLTVMQQFYHYVEWRPMDKPTSYAGELGPKHWTNGRYEYLMKLKQAALNFAKKRWADYILFTDADNILTNPETLNLLIAENKSVIAPMLDSQ--SAYSNYWCGITPQGYYRRTAEYFPTRRRYRTGCFPVPMVHSTMLLDLRKENTRRVAFHPPHTDYSWPFDDIIVFAFSCRVSEVQMYVCNKERYGYLNVPAK--------------------PHEQVEDDHV----NFIHLYLEALSEC----IYLINLRRRPDRRDRMLWSLYEMEINAKVVDAVDGAALNSSDIKLLGVDILPGYNDPFNGRSLTKGEVGCFLSHYYIWKEVKTTRLDKALILEDDVRFQGNFKRRLRHLMEEVELAELDWDIIYLGRKQVNPSKEEPVQNVKNLVYVDYSYWTLSYIISLQGAQKLINAEPLSKMLPVDEFLPIMYDKHPNEDYKSHFLNRNLQAFSTSPLLVQPAHYAGDPQWVSDTETSTLWDN 537          
BLAST of Procollagen galactosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006994.1 (pep scaffold:Pmarinus_7.0:GL480266:3192:21542:1 gene:ENSPMAG00000006305.1 transcript:ENSPMAT00000006994.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.03 bits (985), Expect = 4.185e-128
Identity = 194/454 (42.73%), Postives = 288/454 (63.44%), Query Frame = 1
Query:  457 WSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEND-GLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELF-YLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            WS  RYE++++LR  AL +AR  WADY+  MD D  ++NE T+  L+     +V+P+L+    + YSN+W  MT+ GYYKR+ +Y  +++RE+ G F+VPMVHS + IDL   ++  + F P   N  +P DDII+FA S +     MYI N   +G+   P + +  L  ++++F H   +IM++         +K S+Y+ +   E  K+GFD++Y+INLKRRP+RR +M    +E  I+ K  +AVDGK LNK+ + +L V  LPGY DPY  R L  GEIGCFLSHY IW++++       L+ EDD+RF P F+  L  ++ + +    +W+L  Y+GRK+M     E  V D  +LV+ DY+YWTL+Y ++ +G  K+LA  PL +M+ VDE+LP+MF++HP   +  +F PR+L A S+EPLL+ PT YTGE  Y+SDTE STI +D
Sbjct:   12 WSASRYEYVMKLRQGALNTARERWADYIFFMDVDNFLLNEKTLSFLVGQNRTIVAPMLDSR--TAYSNYWSAMTDQGYYKRAPEYLPVRERERLGCFRVPMVHSTFLIDLRREASRLINFYPPPPNYAWPFDDIIVFAASCKHFGVPMYICNQHRFGHLVVPGKAEITLQDDVDMFIHTHLEIMVEEPP------MKPSQYIHMPERELDKMGFDEVYMINLKRRPERRDRMLRSLEEQQIQCKVVDAVDGKALNKSQIRALGVDMLPGYHDPYSGRVLTKGEIGCFLSHYGIWQEVVGRGLPSSLVLEDDVRFEPFFRHRLERLIADVKSLNLNWDLSRYIGRKKMQIDTPERSVKDIRNLVWADYSYWTLAYAVSLQGARKLLAGEPLGRMLPVDEYLPVMFNKHPIKQYLEYFEPRDLRAFSAEPLLVYPTQYTGEANYVSDTETSTIWDD 457          
BLAST of Procollagen galactosyltransferase vs. Ensembl Sea Lamprey
Match: COLGALT1 (collagen beta(1-O)galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:26182])

HSP 1 Score: 385.185 bits (988), Expect = 8.083e-128
Identity = 201/498 (40.36%), Postives = 303/498 (60.84%), Query Frame = 1
Query:  328 DHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTM-WSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSRE--IEIFNHAKFQIMLDREDQEDLFVLKTSK--YLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKE--AYVSDDAH-LVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            DH+ DN++ +++ W+  +   YHHV +   ++   + ++I    W   RY+H+++LR  AL  AR  W+D++  +DAD +IV+   I  LI     +V+P++   + S YSNFW  +T  GYYKR+ +Y  I++R K+G F VPMVHS   +DL      +LTF P   +  + +DDI+ FA SA K E  MY+ N +++GY   P     LS E  ++ F HA  +IML+R        L+TS   Y+P  +P+K  +GFD++++I+L RR DRR+++     E  ++AK  +AVDG+ LN + L ++ V  LPGY DPY  RD+  GEIGCFLSHY +W ++++   EK+++FEDD+RF   FK+ L  +M E      +W+L YL RK M + E  A V      LV P Y+YW+L+Y+++  G +K++   PL +M+ VDE+LP+M   HP + +   F  R+L   S+ PLL  PTHY+GEP Y SDTE STI
Sbjct:    3 DHNVDNTTAMLEEWLSAVGHTYHHVAWTHKDQPRFYADEIGPRHWPSSRYDHVMRLRQMALMHARNRWSDFIFFVDADNVIVDSQIISFLISQNRTIVAPMME--SRSAYSNFWCGITTQGYYKRTPEYPRIRERRKRGCFPVPMVHSTMLLDLRRARARHLTFYPPHPHYTWALDDIMAFAFSARKAEVPMYVCNQRVFGYLEVPTRPH-LSHEDAVDNFVHAHLEIMLERGP------LETSPHVYVPPRVPDK--MGFDEMFVISLVRRADRRVRILRALHEQELKAKVIDAVDGRSLNTSQLRAMGVDMLPGYQDPYTGRDITRGEIGCFLSHYNVWTEVVERRMEKVVVFEDDVRFELFFKKRLLRLMTEVAAAGLEWDLIYLARKAMRNAEGDAPVQTPVRGLVRPGYSYWSLAYVLSGSGAKKLVEGRPLGRMMPVDEYLPLMSGTHPVEAYNAQFPTRDLRTFSASPLLAYPTHYSGEPGYFSDTETSTI 489          
BLAST of Procollagen galactosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003571.1 (pep scaffold:Pmarinus_7.0:GL478998:41841:77641:-1 gene:ENSPMAG00000003203.1 transcript:ENSPMAT00000003571.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.718e-18
Identity = 60/207 (28.99%), Postives = 108/207 (52.17%), Query Frame = 1
Query:  178 INFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWA-DYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLV 795
            I+ + +S++  P + I  FI      LP FLG + +L+YPK  + L+I       N  V+ +    QI+  +          G  F +  L +   E      + R+ A+   R   A D+ + +D+DV + N+ T++ LI     V++P+++  +   +SNFWG ++  G+Y RSEDY DI + ++ G++ VP + SVY ++ +L+
Sbjct:  277 IDLSARSESDYPMVMIGAFIHQPTPFLPEFLGRIAKLDYPKDKVSLFIH------NKEVLHER---QIEKFFR-------TNGAVFAK--LQVVGPEENLSPGEARNMAMDLCRQDKACDFYMSIDSDVALTNQQTLKILIQQNRGVIAPMVS-RHGKLWSNFWGALSLDGFYARSEDYIDIVEGKRLGVWNVPYMSSVYMVNGSLL 464          
BLAST of Procollagen galactosyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009013.1 (pep scaffold:Pmarinus_7.0:GL481649:366:9308:1 gene:ENSPMAG00000008153.1 transcript:ENSPMAT00000009013.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 4.795e-14
Identity = 34/89 (38.20%), Postives = 54/89 (60.67%), Query Frame = 1
Query:  529 ADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLV 795
             D+   +DADV++ N  T++ L+     +VSPLL       +SNFWG ++  G+Y RSEDY DI +R++ G++ VP + S Y +   L+
Sbjct:   10 CDFYFSLDADVVLTNRATLRILLQQNRKIVSPLLTRAG-KLWSNFWGALSPDGFYARSEDYVDIVQRKRTGVWNVPYLASAYLVQGALL 97          
BLAST of Procollagen galactosyltransferase vs. Ensembl Nematostella
Match: EDO43389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV3])

HSP 1 Score: 437.573 bits (1124), Expect = 3.257e-147
Identity = 237/580 (40.86%), Postives = 350/580 (60.34%), Query Frame = 1
Query:   88 NCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTM--WSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNC-TNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEI-FNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIP--DWELFYLGRKRM-SDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            + +++F+ + +N+          G       + + +S+   P + ++   RN AH LP +LG +E L+YPK  I ++I  DH+EDN++ ++  W    +  YH V    +     +G D+L    W+ ERY H+  LR  AL +AR  WADYL ++D D  + N  T++ L+  +  VVSP+L    N S YSNFWG M E+GYYKR++ YF I  REK G F+VPMVHS Y +DL   +++ L + P   D +   DDI++FA SA      ++I N  +YG+   P E      ++ I F   K    +D  +     ++  S +L +      KLGFD+IY+INLKRRP RR +M     ELGI+AK  +AVDGK L    + +L +K LPGY DPY KR L MGEIGCFLSHY IWK+M++   E++LI EDD+RF P F+R L  ++ +A       +W++ Y+GR+RM ++   +V    ++ + +YT+WTL Y+I  +G  K+++  PL+KM+A+DEFLPIM+D+HP  +W  HF+PRNLVA+++EPLLL PTHY G+  Y SDTE +  V +
Sbjct:    5 SVILAFSLLILNL----------GTNFALAQDTSGESEFKYPTVLLSVIARNAAHLLPNWLGCIENLDYPKDRISIWITSDHNEDNTTELLKEWANNAKHLYHRVTMNFTGSPSNYG-DVLEASDWTDERYAHVAYLRQLALDTARYWWADYLFVVDCDNFLFNPITLRQLMHEEKTVVSPMLEVFGNKSAYSNFWGGMDESGYYKRTDQYFTILNREKVGTFEVPMVHSTYLVDLRRRASSELRYYPPHPDYRGHHDDILVFAHSARMAGVKLHIINKHIYGHLILPFEARESLEDMRIQFLDGKLGYYVDHPEH----LMPLSPHLTVPPVPADKLGFDEIYMINLKRRPLRRRRMMASLAELGIQAKPVDAVDGKALTDAEVKALGIKMLPGYYDPYGKRPLTMGEIGCFLSHYKIWKEMIEKGLERVLILEDDVRFEPDFRRKLLAMIADANQLESKYNWDMIYVGRRRMKTELIGHVEGSQYINWVNYTWWTLGYMIKLEGARKLVSAKPLTKMMAIDEFLPIMYDKHPNAEWSAHFSPRNLVAMTAEPLLLYPTHYIGDKGYFSDTETAAFVPE 569          
BLAST of Procollagen galactosyltransferase vs. Ensembl Nematostella
Match: EDO41428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S477])

HSP 1 Score: 92.8189 bits (229), Expect = 1.090e-19
Identity = 68/248 (27.42%), Postives = 118/248 (47.58%), Query Frame = 1
Query:  193 QSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQ-IQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDI---ILFAKSAEKNEAHMYIDNSKLYG 924
            + ++  PK+ +A FI      +P F   +E L+YPKK I LYI   +  D  +  ++ W+ + I+  YH V Y+     E                     R++A+ S     +DYL ++DA+V+  N+ +++ LI    P++ P ++  +   +SNFWG + + GYY R+EDY DI +  + GI+    V   Y I  ++        LP+  + Y   ++   + F+K    N   MY+ N   +G
Sbjct:  288 EKESDYPKVMMAIFISRPTPFVPEFFKRIEALDYPKKKIALYIH--NLMDGHTKEVNEWLTEEIRGLYHSVTYQGPGTFE------------------AAARNKAVYSG----SDYLFVVDANVVYTNKKSLKLLIEQNRPLLVPKMS-KHAKLWSNFWGTIGDDGYYARAEDYIDIVEYRRVGIWNSAYVTGSYLIQKDV--------LPKLKHAYSYGNLEPDLSFSKYLRDNGIFMYVTNMHYFG 502          
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000018773.2 (collagen beta(1-O)galactosyltransferase 1 [Source:NCBI gene;Acc:101162193])

HSP 1 Score: 476.478 bits (1225), Expect = 1.123e-161
Identity = 230/546 (42.12%), Postives = 345/546 (63.19%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADN-KYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
             ++ +S  L P++ +A   RN  H LP  LG +ERLNYPK  + L++  DH+ DN++ I+  W++ +Q  YH+V+++   E  RF +++    W+  RYEH+++LR  AL +AR +WADY+LM D D ++ N + +  L+     +V+P+L   + + YSNFW  MT  GYYKR+  Y  I+++E++G F VPMVHS Y +DL   ++ NL F P  +   + +DD+I+FA SA   +  MY+ N + YGY   P+  +  L  E E F H   ++M+          L+ S +L +S  + +K+GFD++++INL RR DRR +M     E  I  K   AVDGK LN + ++SL ++ LPGY DPYH R L  GE+GCFLSHY IWK++++   E  L+ EDD+RF   FKR L  +++E      DW+L Y+GRKRM     E  V +  +LV  DY+YWTL+YI++++G +K+L   PLSKM+ VDEFLP+M+++HP  ++   F  R+L A S+EPLL+ PTHYTG+P Y+SDTE S + +D
Sbjct:   28 RWSPESPLLAPRVVVALICRNAEHCLPLVLGAIERLNYPKDRVALWVATDHNSDNTTAILRDWLIHVQKYYHYVEWRPQEEPSRFTDEVGPKHWNNLRYEHVMKLRQAALNTAREIWADYILMTDCDNLLTNPDVLWKLMSENKTIVAPMLE--SRAAYSNFWCGMTSQGYYKRTPAYMPIRRQERRGCFAVPMVHSTYLVDLRKEASRNLAFYPPHEEYNWALDDVIVFAYSARMADVQMYVCNKETYGYLPVPMRAHASLQDEAESFLHTHLEVMVKDPP------LEPSSFLSVSPKQPNKMGFDEVFMINLVRRADRRERMLRSLYEQEISCKVVAAVDGKALNISDMESLGIRMLPGYKDPYHGRPLTKGELGCFLSHYNIWKEIVERGLETSLVLEDDLRFEVFFKRRLQALLQEVTTHRLDWDLIYIGRKRMQVDRPEKSVPNIHNLVEADYSYWTLAYILSKRGAQKLLGAEPLSKMLPVDEFLPVMYNKHPVSEYMERFERRDLHAFSAEPLLVYPTHYTGDPGYVSDTETSVVWDD 565          
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Match: colgalt2 (procollagen galactosyltransferase 2 [Source:NCBI gene;Acc:101161789])

HSP 1 Score: 462.996 bits (1190), Expect = 2.541e-156
Identity = 228/536 (42.54%), Postives = 337/536 (62.87%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDI-LTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVE-NDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVED 1803
            PK+ IA   RN AH+LPY+LG ++RL YPK  I ++   DH+ DN++ ++  W+ + Q  YH V+++   E   F ++     W   R+ H+++LR  ALK+AR  WADY+L  D D ++ N   +  LI   + +V+P+L   +L  YSNFW  +T  GYY+R+ DY  I++ ++ G F+VPMVHS + +DL   S+  LTF P   D  +  DDI++FA SA + +  M++ N + YG+   P++    +  E E F H   + +++ +       +  S+++ +  P + K+GF++I+LINLKRR DRR +M      LG++A   +AVDGK LN + L  L ++ LPGY DPY  R L  GEIGCFLSH+ IW+ +++ +++K+L+ EDD+RF P F+R L  +M++ E    DW+L Y+GRKRM     E  V+   +LV  DY+YWTL Y ++ +G  K+L   P  KM+ VDEFLPIMF++HP   + +HF PRNL A S EPLL+ PTHYTGEP YISDTE STI +D
Sbjct:   39 PKVMIAILARNAAHSLPYYLGCIDRLEYPKDRIAIWAATDHNVDNTTAMLREWLKKAQQVYHFVEWRPMEEPRSFTDEWGPKHWPPSRFNHVMKLRQAALKAARERWADYILFADTDNLLTNPRVLDLLIAENLTLVAPMLESRSL--YSNFWCGITPQGYYRRTPDYQPIREWKRVGCFRVPMVHSTFLVDLRRESSKELTFYPPHPDYSWAFDDIMVFAFSARQADVQMFLCNREHYGFLPVPLKAQQTVEDEAESFIHTITEALIEHD-------MAPSEHVYMLPPPQIKMGFEEIFLINLKRRLDRRQRMLKTMASLGLQATSVDAVDGKALNTSQLQMLGIEMLPGYKDPYSGRVLTRGEIGCFLSHHSIWRQVIERSFQKVLVLEDDVRFEPRFRRRLEAIMEDVERAQLDWDLIYVGRKRMQVHQPEQSVNGVNNLVVADYSYWTLGYALSHQGARKLLDAEPFKKMLPVDEFLPIMFNKHPNAQYMSHFEPRNLKAFSVEPLLIYPTHYTGEPGYISDTETSTIWDD 565          
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Match: colgalt1 (procollagen galactosyltransferase 1 [Source:NCBI gene;Acc:101160659])

HSP 1 Score: 455.292 bits (1170), Expect = 2.666e-153
Identity = 225/547 (41.13%), Postives = 344/547 (62.89%), Query Frame = 1
Query:  184 FNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFG-EDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN-DGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 1809
            ++ +S  L P++ +A   RN  H+LP+FLG +ERLNYPK  + L++  DH+ DN++ ++  W++++Q+ YH+V+++   E   +  E+    W+  RYEH+++LR  AL+SAR +WADY +++D D ++ N N +  LI     +++P+L   + + YSNFW  MT  GYY+R+  Y  I+++ +KG F VPMVHS + IDL   ++  L F P   D  +  DDII+FA SA   +  M++ N + YGYF  P+ + + L  E + F HA  ++ +          +  SKY+P+   +  K+GFD++++INL+RR DR+ +M     E  I  K   AVDGK +N + +  + +  LPGYSDPYH R L  GE+GCFLSHY IWK++++   +  L+ EDD+RF   FKR L  +M E      DW+L Y+GRKRM     E  V +  +LV  DY+YWTL Y+++ +G +K+L   PL +++ VDEFLPIM+++HP  D+   F  R+L A S+EPLL+ PTHYTG+P YISDTE ST+ ++ K
Sbjct:   31 WSPESPLLAPRVHVALICRNSEHSLPHFLGTIERLNYPKDRMALWVATDHNVDNTTAVLRDWLIKVQNLYHYVEWRPQEEPRSYDDEEGPKHWTDLRYEHVMKLRQAALESAREMWADYFMLVDCDNLLTNPNVLWKLIQENKTIIAPMLE--SRAAYSNFWCGMTSEGYYRRTPAYIPIRRQVRKGCFAVPMVHSTFLIDLRKEASKQLAFYPPHPDYSWAFDDIIVFAYSARMADVQMFVCNRESYGYFPVPLRSHNTLQDEADSFLHALLEVNVRNSP------VMPSKYIPVPRKQLDKMGFDEVFMINLQRRTDRKERMLRALYEQEIACKIIAAVDGKAMNVSEIHVMGIHMLPGYSDPYHGRPLTKGELGCFLSHYNIWKEIVERRLQTSLVIEDDLRFEVFFKRRLINLMTEIREEGLDWDLIYIGRKRMQVDHPEKAVPNIHNLVEADYSYWTLGYMMSLQGAKKLLKAEPLKRILPVDEFLPIMYNKHPVTDYMDQFEKRDLKAFSAEPLLVYPTHYTGDPGYISDTETSTVWDNDK 569          
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Match: cercam (cerebral endothelial cell adhesion molecule [Source:NCBI gene;Acc:101156942])

HSP 1 Score: 437.958 bits (1125), Expect = 7.930e-147
Identity = 233/544 (42.83%), Postives = 341/544 (62.68%), Query Frame = 1
Query:  190 EQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLP-EADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSP------VENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS-DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
            E+S+   P + +A   RN AH LPY+LG LERLNYPK  I ++   DH+ DN++ I+  W+  +Q  YH+V+++  ++   + GE     W   RYE++++L+  AL  AR  WADY+L  D D ++ N +T+Q +I     V++P+L+      YSNFW  +T  GYY+R+ +YF  + R + G F VPMVHS   ++L       L F P   D  +P DDII+FA S    E  MY+ N + YGY + P      VE+D L+     F H   + M+D         +  S+++ +   ++  +GFD+IYLINL+RRPDRR +M +  +EL I+ K  +AVDG  LN + +  L V  LPGY DP+  R L  GE+GCFLSHY+IWK+++D   +K LI EDD+RF   FKR +  +M+E E    DW++ YLGRK+++  KE  V +  +LV  DY++WTLSY I+++G +K+L   PLSKM+ VDEFLPIM+D+HP +++K+HF  RNL A S+ PLL+EP HY G+P+++SDTE ST+
Sbjct:   27 EESRMQPPTVVVAIIARNAAHALPYYLGALERLNYPKDRISVWAATDHNVDNTTAILREWLTVMQKYYHYVEWRPMDQPTSYAGELGPKHWPNSRYEYVMKLKQAALNFARKRWADYILYADTDNILTNPDTLQLMIAENKSVIAPMLDSQGA--YSNFWCGITPQGYYRRTAEYFPTRHRHRLGCFPVPMVHSTVLLNLRKEGMKKLAFYPPHKDYSWPYDDIIVFAFSCRAAEIQMYLCNKERYGYLNVPAKPHQTVEDDRLN-----FVHLHLESMIDGPP------MHPSQFVHMFPKQRDLMGFDEIYLINLRRRPDRRDRMLFSLNELEIDVKVVDAVDGNALNSSDIRILGVDLLPGYYDPFSGRTLTKGEVGCFLSHYYIWKEVVDMEMDKALILEDDVRFQANFKRRVLRLMEEVEQVELDWDIIYLGRKQVNPGKEEAVENIRNLVMADYSHWTLSYAISQQGAQKLLNAEPLSKMLPVDEFLPIMYDKHPNEEYKSHFLNRNLQAFSTRPLLVEPCHYAGDPQWVSDTETSTL 557          
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Match: colgalt1 (procollagen galactosyltransferase 1 [Source:NCBI gene;Acc:101160659])

HSP 1 Score: 228.794 bits (582), Expect = 5.322e-67
Identity = 119/264 (45.08%), Postives = 167/264 (63.26%), Query Frame = 1
Query: 1033 VLKTSKY--LPISLPEKSKLGFDK------IYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMS--DKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTI 1794
             + TS+Y  +PI L +  +  F        +++INL+RR DR+ +M     E  I  K   AVDGK +N + +  + +  LPGYSDPYH R L  GE+GCFLSHY IWK++++   +  L+ EDD+RF   FKR L  +M E      DW+L Y+GRKRM     E  V +  +LV  DY+YWTL Y+++ +G +K+L   PL +++ VDEFLPIM+++HP  D+   F  R+L A S+EPLL+ PTHYTG+P YISDTE ST+
Sbjct:  241 AMVTSQYHCVPIILCKMKQTAFCMPFWRLMVFMINLQRRTDRKERMLRALYEQEIACKIIAAVDGKAMNVSEIHVMGIHMLPGYSDPYHGRPLTKGELGCFLSHYNIWKEIVERRLQTSLVIEDDLRFEVFFKRRLINLMTEIREEGLDWDLIYIGRKRMQVDHPEKAVPNIHNLVEADYSYWTLGYMMSLQGAKKLLKAEPLKRILPVDEFLPIMYNKHPVTDYMDQFEKRDLKAFSAEPLLVYPTHYTGDPGYISDTETSTV 504          

HSP 2 Score: 160.999 bits (406), Expect = 3.206e-42
Identity = 69/190 (36.32%), Postives = 121/190 (63.68%), Query Frame = 1
Query:  181 NFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERF-GEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIF 747
             ++ +S  L P++ +A   RN  H+LP+FLG +ERLNYPK  + L++  DH+ DN++ ++  W++++Q+ YH+V+++   E   +  E+    W+  RYEH+++LR  AL+SAR +WADY +++D D ++ N N +  LI     +++P+L   + + YSNFW  MT  GYY+R+  Y  I+++   G+ 
Sbjct:   30 RWSPESPLLAPRVHVALICRNSEHSLPHFLGTIERLNYPKDRMALWVATDHNVDNTTAVLRDWLIKVQNLYHYVEWRPQEEPRSYDDEEGPKHWTDLRYEHVMKLRQAALESAREMWADYFMLVDCDNLLTNPNVLWKLIQENKTIIAPMLE--SRAAYSNFWCGMTSEGYYRRTPAYIPIRRQIIAGLL 217          
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Match: SMESG000037408.1 (SMESG000037408.1)

HSP 1 Score: 1204.89 bits (3116), Expect = 0.000e+0
Identity = 584/587 (99.49%), Postives = 585/587 (99.66%), Query Frame = 1
Query:   49 MTLVLKLIQMIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 1809
            MTLVLKLIQMIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQ L PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLR+QALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK
Sbjct:    1 MTLVLKLIQMIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQKLQPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRNQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 587          
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Match: SMESG000037408.1 (SMESG000037408.1)

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 575/578 (99.48%), Postives = 576/578 (99.65%), Query Frame = 1
Query:   76 MIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 1809
            MIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQ L PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLR+QALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK
Sbjct:    1 MIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQSQKLQPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRNQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVENDGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK 578          
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Match: SMESG000064760.1 (SMESG000064760.1)

HSP 1 Score: 410.609 bits (1054), Expect = 1.569e-136
Identity = 213/546 (39.01%), Postives = 338/546 (61.90%), Query Frame = 1
Query:  199 QTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVD--YKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLI----VHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN--DGLSREIEIFNHAKFQIMLDREDQEDL---FVLKTSKYLPISLPEKSKLGFDKIYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQLPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGPGFKRSLNVVMKEAEIFIPDWELFYLGRKRM-SDKEAYVSDDAHLVYPDYTYWTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPRNLV-AISSEPLLLEPTHYTGEPKYISDTEDSTIV 1797
            Q L+PKI I   +RNKA  LPYF   LE LNY K  IG+ I  DHS D+S  ++  W    ++ +  +D  ++V+       E   T WS+ R +++I+LR++ L +++  W+DYL M+DAD+MI N+NT+  L+          V+P LNCT+L  YSNFW D+T  GYY R+  Y DI+    KG FKV ++HS    +LN     N+TF  E  N Y  DD+I FA  A++N+  + I+N  ++GYF +P+++  +G   E   F +  F  ++     + +   F     +   ++     K+  D+I +INL+RR +R   ++YI   + ++ ++   +DG+++N+TYL S N+ QL GY DP+ KR LK GEIGCFLSH+ IWKDM++ N  +I+I EDDI+    F   +N ++ EA+   P+W+ FYLGRKRM SDKE ++++  +++ P+Y+Y T  Y++ R G  K+L +NPL KMIA+DE++PIM+ + P + W+ +F    L+ AI++ P++++P+H+ GE ++ SDTE+S ++
Sbjct:   30 QKLMPKISIGILVRNKAFALPYFFYYLENLNYSKSRIGIIIYEDHSVDSSGAMVKEWCNTNRNIFAFMDCLFEVNPSKGYEDESSSTDWSEARMKNVIRLREKVLSTSKWHWSDYLFMVDADIMITNKNTLAFLVNVLQTFNNVAVAPRLNCTSLPFYSNFWDDITLNGYYVRTNRYLDIKNSNVKGTFKVALIHSAILFNLNHFHINNITFSQETKNNYSNDDLINFAMHAKRNDIPLLINNEWVFGYFPAPIQSSENGYYLERNTFVNLLFHYIIYHNYSQPIGMRFKQNIKELDKMNYYNDIKIKVDEISVINLERRKNRYTIIKYIMKTMNVDFRFSPGIDGREINETYLLSHNITQLRGYVDPFFKRSLKYGEIGCFLSHFQIWKDMIERNLSRIIILEDDIKCTSEFPFVINDLLDEADSIYPEWDFFYLGRKRMSSDKEKFLNNSKYILIPNYSYRTTGYVLTRNGALKLLDENPLCKMIALDEYVPIMYGKSPYEQWRVNFNGSGLLKAIAAYPVVIQPSHFKGESEHFSDTEESDLL 575          
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Match: SMESG000014398.1 (SMESG000014398.1)

HSP 1 Score: 107.842 bits (268), Expect = 4.610e-24
Identity = 74/243 (30.45%), Postives = 121/243 (49.79%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSP 939
            PK+ +A FI      +  F   +  L+YPK  + L  R+ +   +   I+  ++    S Y+   Y  S        DI +  SK+R       +   +    A   D+LL++D+ V + NEN IQ LI +  P+++PLL+      +SNFWG +    YY RS DY DI   EK+GI+ VP +HS+Y I+  ++   +  ++P  D K   +D+I F+ +    +  M++ N + YGY   P
Sbjct:  422 PKVTLAIFIDQATPFITEFFNRISHLSYPKSRLNL--RISNMVPSHEAIVTAFIDSSASAYNSFVYLAST-------DIKS--SKDR-------KSATINECVAYNCDFLLVVDSVVQLTNENIIQTLISYNKPIIAPLLSRRE-KLWSNFWGALGADKYYARSFDYLDIINSEKRGIWNVPHIHSMYLIEQKIIPKLHDIYIPHPDYKDFENDMI-FSGNLRDKDQFMFVVNEEEYGYLVDP 644          
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Match: SMESG000014398.1 (SMESG000014398.1)

HSP 1 Score: 107.457 bits (267), Expect = 4.874e-24
Identity = 74/243 (30.45%), Postives = 121/243 (49.79%), Query Frame = 1
Query:  211 PKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNSSVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRDQALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLSPYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVSTANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSP 939
            PK+ +A FI      +  F   +  L+YPK  + L  R+ +   +   I+  ++    S Y+   Y  S        DI +  SK+R       +   +    A   D+LL++D+ V + NEN IQ LI +  P+++PLL+      +SNFWG +    YY RS DY DI   EK+GI+ VP +HS+Y I+  ++   +  ++P  D K   +D+I F+ +    +  M++ N + YGY   P
Sbjct:  412 PKVTLAIFIDQATPFITEFFNRISHLSYPKSRLNL--RISNMVPSHEAIVTAFIDSSASAYNSFVYLAST-------DIKS--SKDR-------KSATINECVAYNCDFLLVVDSVVQLTNENIIQTLISYNKPIIAPLLSRRE-KLWSNFWGALGADKYYARSFDYLDIINSEKRGIWNVPHIHSMYLIEQKIIPKLHDIYIPHPDYKDFENDMI-FSGNLRDKDQFMFVVNEEEYGYLVDP 634          
The following BLAST results are available for this feature:
BLAST of Procollagen galactosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COLGALT17.917e-15944.77collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
COLGALT23.752e-14944.09collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
CERCAM4.495e-14239.67cerebral endothelial cell adhesion molecule [Sourc... [more]
COLGALT24.252e-13143.06collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
CERCAM3.836e-12339.67cerebral endothelial cell adhesion molecule [Sourc... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
D2045.91.250e-8836.57pep chromosome:WBcel235:III:10475960:10479758:1 ge... [more]
D2045.91.250e-8836.57pep chromosome:WBcel235:III:10475970:10479753:1 ge... [more]
D2045.91.250e-8836.57pep chromosome:WBcel235:III:10475245:10479758:1 ge... [more]
let-2681.058e-1225.37Multifunctional procollagen lysine hydroxylase and... [more]
let-2681.058e-1225.37Multifunctional procollagen lysine hydroxylase and... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG319152.072e-14543.44gene:FBgn0051915 transcript:FBtr0079099[more]
Plod1.648e-1727.91gene:FBgn0036147 transcript:FBtr0076187[more]
Plod1.648e-1727.91gene:FBgn0036147 transcript:FBtr0076188[more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colgalt24.621e-16142.09collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
si:ch211-114l13.72.445e-15942.03si:ch211-114l13.7 [Source:NCBI gene;Acc:567859][more]
colgalt15.586e-15841.55collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
si:ch211-13f8.24.439e-15142.17si:ch211-13f8.2 [Source:ZFIN;Acc:ZDB-GENE-070705-3... [more]
cercam2.263e-15041.97cerebral endothelial cell adhesion molecule [Sourc... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000013180.17.763e-15540.97collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
ENSXETT00000029164.12.480e-15442.96collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
ENSXETT00000029234.14.257e-15442.96collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
ENSXETT00000013230.16.324e-15442.96collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
ENSXETT00000029220.17.409e-15442.96collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Colgalt13.465e-15944.22collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
Colgalt21.593e-14643.63collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
Cercam4.672e-14239.67cerebral endothelial cell adhesion molecule [Sourc... [more]
Colgalt21.540e-10340.41collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
Plod34.046e-1727.24procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A5PK45|GT251_BOVIN1.908e-16744.57Procollagen galactosyltransferase 1 OS=Bos taurus ... [more]
sp|Q17FB8|GLT25_AEDAE7.002e-16046.17Glycosyltransferase 25 family member OS=Aedes aegy... [more]
sp|A5PMF6|GT251_DANRE1.846e-15842.03Procollagen galactosyltransferase 1 OS=Danio rerio... [more]
sp|Q8K297|GT251_MOUSE2.424e-15844.22Procollagen galactosyltransferase 1 OS=Mus musculu... [more]
sp|Q8NBJ5|GT251_HUMAN3.802e-15844.77Procollagen galactosyltransferase 1 OS=Homo sapien... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NR850.000e+047.35Collagen beta-1,O-galactosyltransferase OS=Paragon... [more]
A0A0X3P3970.000e+046.56Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4E0RDJ10.000e+049.20Procollagen galactosyltransferase OS=Fasciola hepa... [more]
H2KNS50.000e+048.40Collagen beta-1 O-galactosyltransferase OS=Clonorc... [more]
A0A183W0G70.000e+048.08Uncharacterized protein OS=Trichobilharzia regenti... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colgalt13.656e-16044.10collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
colgalt21.411e-15341.98procollagen galactosyltransferase 2-like [Source:N... [more]
cercam3.692e-15343.64procollagen galactosyltransferase 2 [Source:NCBI g... [more]
si:ch211-13f8.21.177e-15240.78procollagen galactosyltransferase 2 [Source:NCBI g... [more]
cercam1.129e-14442.60procollagen galactosyltransferase 2 [Source:NCBI g... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000006994.14.185e-12842.73pep scaffold:Pmarinus_7.0:GL480266:3192:21542:1 ge... [more]
COLGALT18.083e-12840.36collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
ENSPMAT00000003571.11.718e-1828.99pep scaffold:Pmarinus_7.0:GL478998:41841:77641:-1 ... [more]
ENSPMAT00000009013.14.795e-1438.20pep scaffold:Pmarinus_7.0:GL481649:366:9308:1 gene... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO433893.257e-14740.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414281.090e-1927.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018773.21.123e-16142.12collagen beta(1-O)galactosyltransferase 1 [Source:... [more]
colgalt22.541e-15642.54procollagen galactosyltransferase 2 [Source:NCBI g... [more]
colgalt12.666e-15341.13procollagen galactosyltransferase 1 [Source:NCBI g... [more]
cercam7.930e-14742.83cerebral endothelial cell adhesion molecule [Sourc... [more]
colgalt15.322e-6745.08procollagen galactosyltransferase 1 [Source:NCBI g... [more]
back to top
BLAST of Procollagen galactosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037408.10.000e+099.49SMESG000037408.1[more]
SMESG000037408.10.000e+099.48SMESG000037408.1[more]
SMESG000064760.11.569e-13639.01SMESG000064760.1[more]
SMESG000014398.14.610e-2430.45SMESG000014398.1[more]
SMESG000014398.14.874e-2430.45SMESG000014398.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034851 ID=SMED30034851|Name=Procollagen galactosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1823bp
TTTTAATTCGATAAATCAAGACAGCTTTGTAAATATCAAACTCTCAAGAT
GACGTTGGTATTAAAACTGATTCAAATGATATTTATCAATTGTTTAGTAT
CATTTGCTTTCATCTGTGTCAATATTTGTCCTACCAACAATGGAGACATC
ATTGATGGAAACCCGCTGGGATCAGATATCAATTTCAACGAGCAATCGCA
AACACTACTACCGAAAATCCAAATCGCATTTTTTATTAGAAACAAAGCCC
ATACGTTGCCGTACTTTCTTGGAAATCTTGAAAGACTTAATTATCCAAAG
AAAAATATTGGACTTTATATAAGACTAGATCATTCCGAAGACAATAGTTC
AGTTATTATGGATACCTGGATGTTGCAAATTCAATCTGAATATCATCATG
TTGATTATAAAGTTTCTAATGAAGGTGAAAGATTCGGAGAAGATATTCTT
ACTATGTGGTCAAAAGAGAGATATGAGCACATTATTCAATTAAGGGACCA
AGCTTTAAAATCAGCTCGAGCAGTGTGGGCTGATTATTTACTTATGATGG
ATGCTGATGTTATGATTGTCAATGAAAACACTATTCAAGATTTAATAGTC
CATAAAGTGCCTGTGGTGTCTCCATTGCTCAATTGTACAAATTTAAGCCC
ATATTCAAATTTCTGGGGTGACATGACAGAAACTGGTTATTACAAACGAT
CAGAAGATTACTTTGACATTCAGAAAAGGGAAAAAAAAGGAATTTTTAAA
GTTCCCATGGTTCACAGTGTTTATTTTATTGATCTAAACTTAGTAAGCAC
AGCCAACTTAACATTTCTACCTGAAGCCGACAACAAGTACCCAATTGATG
ATATAATTCTTTTTGCAAAGTCTGCTGAGAAAAACGAGGCTCATATGTAC
ATCGACAATAGCAAATTGTATGGCTATTTCAGTAGCCCAGTTGAAAATGA
TGGATTAAGTCGGGAGATCGAAATCTTTAATCATGCCAAATTTCAGATAA
TGCTTGACAGAGAAGATCAGGAAGATTTATTTGTTTTAAAAACATCCAAA
TATCTTCCTATATCTTTACCAGAAAAATCAAAATTGGGTTTTGATAAAAT
TTATCTTATCAATCTTAAAAGACGTCCAGACAGACGTTTGAAAATGGAAT
ATATTTTCGATGAGTTAGGTATTGAAGCGAAATATTTCGAAGCTGTTGAT
GGAAAGAAATTGAACAAGACTTATTTGGATTCTTTGAATGTAAAACAGCT
TCCTGGCTACTCTGATCCTTATCATAAAAGAGATTTGAAAATGGGTGAAA
TTGGATGTTTTTTGAGTCATTATTTCATTTGGAAAGACATGATGGATAAT
AATTATGAAAAAATATTGATATTTGAAGATGATATCAGATTTGGTCCTGG
ATTTAAGAGAAGTCTTAATGTAGTTATGAAAGAAGCAGAAATTTTCATAC
CAGATTGGGAGTTATTCTATCTTGGTAGAAAGCGAATGTCAGATAAAGAA
GCGTACGTATCGGATGATGCTCACTTGGTCTATCCAGATTATACTTATTG
GACATTAAGTTATATAATCAACAGAAAAGGAGTGGAAAAAGTTCTTGCAC
AAAATCCCTTGTCAAAAATGATTGCTGTTGATGAATTTTTGCCAATTATG
TTTGATAGACATCCTCAAGATGACTGGAAAACACATTTTGCTCCTCGGAA
CCTGGTAGCAATTTCTTCTGAACCTTTATTGTTGGAACCAACTCATTATA
CTGGTGAACCAAAGTACATTTCAGATACCGAAGATTCTACAATTGTAGAA
GATCTCAAATAACTTAATGATTA
back to top

protein sequence of SMED30034851-orf-1

>SMED30034851-orf-1 ID=SMED30034851-orf-1|Name=SMED30034851-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=588bp
MTLVLKLIQMIFINCLVSFAFICVNICPTNNGDIIDGNPLGSDINFNEQS
QTLLPKIQIAFFIRNKAHTLPYFLGNLERLNYPKKNIGLYIRLDHSEDNS
SVIMDTWMLQIQSEYHHVDYKVSNEGERFGEDILTMWSKERYEHIIQLRD
QALKSARAVWADYLLMMDADVMIVNENTIQDLIVHKVPVVSPLLNCTNLS
PYSNFWGDMTETGYYKRSEDYFDIQKREKKGIFKVPMVHSVYFIDLNLVS
TANLTFLPEADNKYPIDDIILFAKSAEKNEAHMYIDNSKLYGYFSSPVEN
DGLSREIEIFNHAKFQIMLDREDQEDLFVLKTSKYLPISLPEKSKLGFDK
IYLINLKRRPDRRLKMEYIFDELGIEAKYFEAVDGKKLNKTYLDSLNVKQ
LPGYSDPYHKRDLKMGEIGCFLSHYFIWKDMMDNNYEKILIFEDDIRFGP
GFKRSLNVVMKEAEIFIPDWELFYLGRKRMSDKEAYVSDDAHLVYPDYTY
WTLSYIINRKGVEKVLAQNPLSKMIAVDEFLPIMFDRHPQDDWKTHFAPR
NLVAISSEPLLLEPTHYTGEPKYISDTEDSTIVEDLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002654Glyco_trans_25
IPR029044Nucleotide-diphossugar_trans
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002654Glycosyl transferase, family 25PFAMPF01755Glyco_transf_25coord: 349..530
e-value: 1.3E-32
score: 113.3
IPR002654Glycosyl transferase, family 25CDDcd06532Glyco_transf_25coord: 350..531
e-value: 2.48992E-36
score: 130.029
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 41..229
e-value: 9.3E-10
score: 40.3
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 59..310
NoneNo IPR availablePFAMPF13704Glyco_tranf_2_4coord: 64..182
e-value: 8.4E-9
score: 35.8
NoneNo IPR availablePANTHERPTHR10730:SF47GLYCOSYLTRANSFERASE 25 FAMILY MEMBERcoord: 33..585
NoneNo IPR availablePANTHERPTHR10730PROCOLLAGEN-LYSINE,2-OXOGLUTARATE 5-DIOXYGENASE/GLYCOSYLTRANSFERASE 25 FAMILY MEMBERcoord: 33..585
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.72