Kyphoscoliosis peptidase

Overview
NameKyphoscoliosis peptidase
Smed IDSMED30034849
Length (bp)5803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kyphoscoliosis peptidase (SMED30034849) t-SNE clustered cells

Violin plots show distribution of expression levels for Kyphoscoliosis peptidase (SMED30034849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kyphoscoliosis peptidase (SMED30034849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kyphoscoliosis peptidase (SMED30034849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30034849SMESG000061907.1 Contig47838uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034849SMESG000061907.1 Contig47838newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30034849SMESG000061907.1 dd_Smed_v6_1109_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30034849SMESG000061907.1 dd_Smed_v6_1109_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034849SMESG000061907.1 dd_Smed_v4_1846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30034849SMESG000061907.1 dd_Smed_v4_1846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034849SMESG000061907.1 dd_Smed_v4_1109_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kyphoscoliosis peptidase vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 153.68 bits (387), Expect = 1.708e-37
Identity = 119/444 (26.80%), Postives = 198/444 (44.59%), Query Frame = 1
Query:  139 FEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPN-----GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAAN-HSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK-NGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL 1449
            FEK+D +A +V+  S     +L+ DL  +   +DLE+ R I+ W+  C   + D A +         P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +  + +         + Y++FYF+  P   +  HFP+   WQLL+ P +L QFEN    KS+F+  GM        ++ + +G   + +    P  F + L     K +   +SLR         N +      PT G   L IFA+  ++    V +   +   C Y  +  +  A  H P          GPSW       + P   D +I  +        +  I F  + E +++L  L   +G   E+   +YI    +  +T   + LP  G++ L+I+  +  E   Y  +  YL+
Sbjct:  152 FEKLDIYASQVTAKS--GLDELVSDL-LQEAHTDLERVRAIWIWI--CHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFS-GEFDHAWNAVYLEGRWHLVDSTWGSGLVDT---ITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFML---NGKQEHGLLSLR--------KNGMKLEVYPPTMGTHKLQIFAKGNSDIYSSVLE---YTLKCNYVDMGVQLPAELHQPV---------GPSWFSEQMGIMKPSHPDPIIHTSDG------RCSISFS-VEEGINVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIFVFNYLV 556          

HSP 2 Score: 134.035 bits (336), Expect = 3.464e-31
Identity = 110/453 (24.28%), Postives = 211/453 (46.58%), Query Frame = 1
Query: 3514 FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            F+K+D +A QV+++     ++L+  L+  +    +LE+VR I++W+C     D+      + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +  +     K     +  + FYFL +P+  I  HFP + +WQLL    ++ +FE+    KS F+   +     + ++I+T   +  + I          LF F L   +G +++  +SL + G +            +  P  G++KL I+AK            +  ++ ++ EY +  N+         P       GP+   +Q  I +  +     +  +G   + F +++  I V+A L   +   +++   + + Q L    +  + V LP+AG++ L+++    ++ GN  + V+ Y +  +   +
Sbjct:  152 FEKLDIYASQVTAK--SGLDELVSDLL--QEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGSGLVDTITSK---FTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPT----LFMFML---NGKQEHGLLSLRKNGMK----------LEVYPPTMGTHKLQIFAK-----------GNSDIYSSVLEYTLKCNY--VDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEE-GINVLASLHGDDGPITEETQRRYIFQ-LHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIF-VFNYLVCCANTKV 563          

HSP 3 Score: 70.4774 bits (171), Expect = 2.938e-11
Identity = 63/239 (26.36%), Postives = 109/239 (45.61%), Query Frame = 1
Query: 4735 INVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSD-YGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFL-QLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNG 5445
            + V+ P  G + L+++A   K N + + +V +Y +  +   +   LP+     +GP    FS+  G+   SH DP I  + G   I      ++ I ++A L      ++E    +++ QL R+      ++LPH G F  +IF     E G  +  VFNYL+    +      FP+ FG W +   L EP +GVL  N     + F++  +   +  +V   + W  L  + +G W G
Sbjct:  402 LEVYPPTMGTHKLQIFA---KGNSDIYSSVLEYTLKCNYVDMGVQLPAELHQPVGP--SWFSEQMGIMKPSHPDPIIHTSDGRCSISFSV--EEGINVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYI-FVFNYLVCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLPAN---RNVPFKLK-LHGIAKVLVKGQDTWP-LTLNHEGYWEG 627          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 152.91 bits (385), Expect = 2.386e-37
Identity = 119/444 (26.80%), Postives = 198/444 (44.59%), Query Frame = 1
Query:  139 FEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPN-----GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAAN-HSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK-NGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL 1449
            FEK+D +A +V+  S     +L+ DL  +   +DLE+ R I+ W+  C   + D A +         P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +  + +         + Y++FYF+  P   +  HFP+   WQLL+ P +L QFEN    KS+F+  GM        ++ + +G   + +    P  F + L     K +   +SLR         N +      PT G   L IFA+  ++    V +   +   C Y  +  +  A  H P          GPSW       + P   D +I  +        +  I F  + E +++L  L   +G   E+   +YI    +  +T   + LP  G++ L+I+  +  E   Y  +  YL+
Sbjct:  131 FEKLDIYASQVTAKS--GLDELVSDL-LQEAHTDLERVRAIWIWI--CHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFS-GEFDHAWNAVYLEGRWHLVDSTWGSGLVDT---ITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFMLN---GKQEHGLLSLR--------KNGMKLEVYPPTMGTHKLQIFAKGNSDIYSSVLE---YTLKCNYVDMGVQLPAELHQPV---------GPSWFSEQMGIMKPSHPDPIIHTSDG------RCSISFS-VEEGINVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIFVFNYLV 535          

HSP 2 Score: 134.035 bits (336), Expect = 3.391e-31
Identity = 109/453 (24.06%), Postives = 211/453 (46.58%), Query Frame = 1
Query: 3514 FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            F+K+D +A QV+++     ++L+  L+  +    +LE+VR I++W+C     D+      + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +  +   +       +  + FYFL +P+  I  HFP + +WQLL    ++ +FE+    KS F+   +     + ++I+T   +  + I          LF F L   +G +++  +SL + G +            +  P  G++KL I+AK            +  ++ ++ EY +  N+         P       GP+   +Q  I +  +     +  +G   + F +++  I V+A L   +   +++   + + Q L    +  + V LP+AG++ L+++    ++ GN  + V+ Y +  +   +
Sbjct:  131 FEKLDIYASQVTAK--SGLDELVSDLL--QEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGSGLV---DTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPT----LFMFML---NGKQEHGLLSLRKNGMK----------LEVYPPTMGTHKLQIFAK-----------GNSDIYSSVLEYTLKCNY--VDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEE-GINVLASLHGDDGPITEETQRRYIFQ-LHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYIF-VFNYLVCCANTKV 542          

HSP 3 Score: 70.0922 bits (170), Expect = 3.543e-11
Identity = 63/239 (26.36%), Postives = 109/239 (45.61%), Query Frame = 1
Query: 4735 INVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSD-YGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFL-QLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNG 5445
            + V+ P  G + L+++A   K N + + +V +Y +  +   +   LP+     +GP    FS+  G+   SH DP I  + G   I      ++ I ++A L      ++E    +++ QL R+      ++LPH G F  +IF     E G  +  VFNYL+    +      FP+ FG W +   L EP +GVL  N     + F++  +   +  +V   + W  L  + +G W G
Sbjct:  381 LEVYPPTMGTHKLQIFA---KGNSDIYSSVLEYTLKCNYVDMGVQLPAELHQPVGP--SWFSEQMGIMKPSHPDPIIHTSDGRCSISFSV--EEGINVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIFVKKRQEPGNYI-FVFNYLVCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLPAN---RNVPFKLK-LHGIAKVLVKGQDTWP-LTLNHEGYWEG 606          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 88.9669 bits (219), Expect = 3.880e-18
Identity = 48/145 (33.10%), Postives = 81/145 (55.86%), Query Frame = 1
Query: 3514 FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAA 3927
            F+K+D +A QV+++     ++L+  L+   +   +LE+VR I++W+C    H + +D       + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +
Sbjct:  152 FEKLDIYASQVTAK--SGLDELVSDLLQEAHT--DLERVRAIWIWIC----HHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGS 287          

HSP 2 Score: 85.1149 bits (209), Expect = 8.845e-17
Identity = 49/146 (33.56%), Postives = 78/146 (53.42%), Query Frame = 1
Query:  127 DPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNG-----PEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWAT 549
            D   FEK+D +A +V+  S     +L+ DL  +   +DLE+ R I+ W+  C   + D A +         P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +
Sbjct:  148 DLQQFEKLDIYASQVTAKS--GLDELVSDL-LQEAHTDLERVRAIWIWI--CHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSF-SGEFDHAWNAVYLEGRWHLVDSTWGS 287          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 217.624 bits (553), Expect = 1.287e-60
Identity = 141/464 (30.39%), Postives = 221/464 (47.63%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPN-GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKN------TQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDF--RSQHHGVVHSKDGYLKMNLGF-WKPDS--FTYKLQ-TDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSE----GDTYTHICQYLL 1449
            K ++Y     F  +D  AI  ++N   +F DL+  L+   + SD++ AR I+RW+T  ++N + F +S  N  P  +L  +K    SY   F+ +CSYAGL C+ I GF+K   Y+PG  F    F +TWN + L  SW+ +  +W  R+L + K+      T  ++ Y+YDD YF+ + ++ +Y  FP    WQLL +PL+L QFE +P  +S FFK  + F        V   K G   +++    K DS  F Y L+  D  ++   G+SL+ +V+Q    + + F    P+     L IFA  ++       Q   F++ C++K++ +       P P  C    WGP+ +      L     D +I     N   +V  EI F   R     +  L +N  DD   L      A K +     I  P  G+YGL+IY  +  +        TH C+YL+
Sbjct:   31 KREIYTTTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGAR-SDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLP-ECASGEWGPAKATRLFGLLPISHPDAII-----NTGRYV--EIRFRMTRPLSEFVASLHRNRTDDR-ALQACTRSALKGDMVYIQIEFPGEGQYGLDIYTRQDDQLINGKQLLTHCCKYLI 484          

HSP 2 Score: 211.846 bits (538), Expect = 1.036e-58
Identity = 138/453 (30.46%), Postives = 227/453 (50.11%), Query Frame = 1
Query: 3502 TSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN-IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKE---HKPE---NVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHK-NAVIQTN---APEFELRIAFPKGIEERLLFTFTLSFNDGSE-KYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGP---NEMYKQYPIESENVQSSFYIDNGT-VEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYA--NDSKKNG 4806
            T+  F  +DE A+  +  +  +F  LI  L  +     +++  R I+ W+  K+L+ M FD+ I+ D+P  +L GI+ G  +Y  +F  LC YAGLHC +I G++K A Y PG  F   +  ++WNAV ++G WR + C+W AR L+  +   H+ +   N+RYE D  YF+ +  + IY  FP D+ WQLL   +++ +FE +  V+S+FFKYNL  + +K  + + T+   A    +R+  PKG  + L+F + L F D  E   + +SL R+  Q +           R   P +  LL+     +V            F ++C++K+     L+  + P P C S  +GP     ++   PI   +      I+ G  VE++F + +P    +A L     +  D+  + C    L G D   I +  P  G+YGL++Y   +D   NG
Sbjct:   37 TTDYFSSIDEVAIHCARNEVASFTDLIRTL--SSGARSDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLP-PKG--DSLIFHYNLKFFDSEENTISGMSLKRFVMQSV----TEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE-SLQVIMVPLPECASGEWGPAKATRLFGLLPISHPDA----IINTGRYVEIRFRMTRPLSEFVASLH--RNRTDDRALQACTRSALKG-DMVYIQIEFPGEGQYGLDIYTRQDDQLING 472          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 218.009 bits (554), Expect = 9.215e-59
Identity = 141/464 (30.39%), Postives = 221/464 (47.63%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPN-GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKN------TQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDF--RSQHHGVVHSKDGYLKMNLGF-WKPDS--FTYKLQ-TDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSE----GDTYTHICQYLL 1449
            K ++Y     F  +D  AI  ++N   +F DL+  L+   + SD++ AR I+RW+T  ++N + F +S  N  P  +L  +K    SY   F+ +CSYAGL C+ I GF+K   Y+PG  F    F +TWN + L  SW+ +  +W  R+L + K+      T  ++ Y+YDD YF+ + ++ +Y  FP    WQLL +PL+L QFE +P  +S FFK  + F        V   K G   +++    K DS  F Y L+  D  ++   G+SL+ +V+Q    + + F    P+     L IFA  ++       Q   F++ C++K++ +       P P  C    WGP+ +      L     D +I     N   +V  EI F   R     +  L +N  DD   L      A K +     I  P  G+YGL+IY  +  +        TH C+YL+
Sbjct:  265 KREIYTTTDYFSSIDEVAIHCARNEVASFTDLIRTLSSGAR-SDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCESLQVIMVPLP-ECASGEWGPAKATRLFGLLPISHPDAII-----NTGRYV--EIRFRMTRPLSEFVASLHRNRTDDR-ALQACTRSALKGDMVYIQIEFPGEGQYGLDIYTRQDDQLINGKQLLTHCCKYLI 718          

HSP 2 Score: 210.69 bits (535), Expect = 2.673e-56
Identity = 139/467 (29.76%), Postives = 231/467 (49.46%), Query Frame = 1
Query: 3502 TSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN-IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKE---HKPE---NVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHK-NAVIQTN---APEFELRIAFPKGIEERLLFTFTLSFNDGSE-KYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGP---NEMYKQYPIESENVQSSFYIDNGT-VEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYA--NDSKKNGNSFYAVWQYFIVSS 4848
            T+  F  +DE A+  +  +  +F  LI  L  +     +++  R I+ W+  K+L+ M FD+ I+ D+P  +L GI+ G  +Y  +F  LC YAGLHC +I G++K A Y PG  F   +  ++WNAV ++G WR + C+W AR L+  +   H+ +   N+RYE D  YF+ +  + IY  FP D+ WQLL   +++ +FE +  V+S+FFKYNL  + +K  + + T+   A    +R+  PKG  + L+F + L F D  E   + +SL R+  Q +           R   P +  LL+     +V            F ++C++K+     L+  + P P C S  +GP     ++   PI   +      I+ G  VE++F + +P    +A L     +  D+  + C    L G D   I +  P  G+YGL++Y   +D   NG         +++ S
Sbjct:  271 TTDYFSSIDEVAIHCARNEVASFTDLIRTL--SSGARSDVDVARAIYRWITIKNLNTMIFDDSIQNDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHRFRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLP-PKG--DSLIFHYNLKFFDSEENTISGMSLKRFVMQSV----TEDVVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE-SLQVIMVPLPECASGEWGPAKATRLFGLLPISHPDA----IINTGRYVEIRFRMTRPLSEFVASLH--RNRTDDRALQACTRSALKG-DMVYIQIEFPGEGQYGLDIYTRQDDQLINGKQLLTHCCKYLIHS 720          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086255)

HSP 1 Score: 271.166 bits (692), Expect = 1.252e-75
Identity = 156/496 (31.45%), Postives = 250/496 (50.40%), Query Frame = 1
Query:   73 ISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANS-HPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTS-------GKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS------FTYKLQTDESKDQ--FEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFV--KTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANE------------------PSEGDTYTHICQYLLD 1452
            ++ P P PP+  K Q+Y DP  FE VD  AI V+Q    TF DL+  L  R   +D+EKAR IFRW+T  ++N + F +    + P  +L  +K    SY   F+ +CSYAGL C+ I G++K   Y+PG  F+   F ++WN +++  +W+ +  +W  R+L +       G+   DS+ Y+YDD YF+ +P++ +Y  +P + EWQLL++P+TL +FENLP  +S FF+ G+ F  + +G V   D      +    P        F Y L+  +S ++  ++GVSL+ +V+Q  + N + F    P +G F L IFA  +        +   F++ C++KI  ++      P P  C    WGP+            +  G+I IT  +   F     ++ F   R     +  L KNG+ +E  L +Y+  +   +  +F I+ PE G+YGL+IY  E                    E    TH C+YL++
Sbjct:  330 LNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCT-TDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLP-DCASGEWGPT---------KATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGI-EEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLIN 813          

HSP 2 Score: 253.062 bits (645), Expect = 1.196e-69
Identity = 153/467 (32.76%), Postives = 238/467 (50.96%), Query Frame = 1
Query: 3454 ALPSEMPTKVAI-SPEETSKI--------FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN-IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKP-------ENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVT--HKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEK--YNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYAND 4791
            A+P E P    I +P   SK         F+ VD  A+ V+ + Q  F  L+ QL+  R  TD +EK R IF W+  K+L+ M+FD+ ++ D+P  +L GI+ G  +Y  +F  LC YAGLHC +I GY+K A Y PG+KFQ  +  +SWNAV + G WR + C+W AR L+  +  P       +++RYE D  YFL +P + IY  +P   +WQLL   I + EFE+L  V+S+FF+Y L      +   V   +     +RIA P  ++  L+F + L F D  E+  Y+ VSL R+  Q +  I N   F +  P  G++ L I+A  +   P          F ++C++KI     L+  + P P C S  +GP +  + + +     Q        +++++F + +P    MA L    ++   +L +      L      IIN   P  G+YGL++Y  +
Sbjct:  323 AVPVEYPLNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLV-GRCTTD-IEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVT--PQEYLTGEPMKFKSVCKFKICCE-ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEK-KLAKYVTHSTLDDIVTFIIN--FPEEGQYGLDIYTRE 779          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086256)

HSP 1 Score: 271.166 bits (692), Expect = 1.252e-75
Identity = 156/496 (31.45%), Postives = 250/496 (50.40%), Query Frame = 1
Query:   73 ISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANS-HPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTS-------GKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS------FTYKLQTDESKDQ--FEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFV--KTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANE------------------PSEGDTYTHICQYLLD 1452
            ++ P P PP+  K Q+Y DP  FE VD  AI V+Q    TF DL+  L  R   +D+EKAR IFRW+T  ++N + F +    + P  +L  +K    SY   F+ +CSYAGL C+ I G++K   Y+PG  F+   F ++WN +++  +W+ +  +W  R+L +       G+   DS+ Y+YDD YF+ +P++ +Y  +P + EWQLL++P+TL +FENLP  +S FF+ G+ F  + +G V   D      +    P        F Y L+  +S ++  ++GVSL+ +V+Q  + N + F    P +G F L IFA  +        +   F++ C++KI  ++      P P  C    WGP+            +  G+I IT  +   F     ++ F   R     +  L KNG+ +E  L +Y+  +   +  +F I+ PE G+YGL+IY  E                    E    TH C+YL++
Sbjct:  330 LNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCT-TDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLP-DCASGEWGPT---------KATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGI-EEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLIN 813          

HSP 2 Score: 253.062 bits (645), Expect = 1.196e-69
Identity = 153/467 (32.76%), Postives = 238/467 (50.96%), Query Frame = 1
Query: 3454 ALPSEMPTKVAI-SPEETSKI--------FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN-IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKP-------ENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVT--HKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEK--YNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYAND 4791
            A+P E P    I +P   SK         F+ VD  A+ V+ + Q  F  L+ QL+  R  TD +EK R IF W+  K+L+ M+FD+ ++ D+P  +L GI+ G  +Y  +F  LC YAGLHC +I GY+K A Y PG+KFQ  +  +SWNAV + G WR + C+W AR L+  +  P       +++RYE D  YFL +P + IY  +P   +WQLL   I + EFE+L  V+S+FF+Y L      +   V   +     +RIA P  ++  L+F + L F D  E+  Y+ VSL R+  Q +  I N   F +  P  G++ L I+A  +   P          F ++C++KI     L+  + P P C S  +GP +  + + +     Q        +++++F + +P    MA L    ++   +L +      L      IIN   P  G+YGL++Y  +
Sbjct:  323 AVPVEYPLNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLV-GRCTTD-IEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVT--PQEYLTGEPMKFKSVCKFKICCE-ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEK-KLAKYVTHSTLDDIVTFIIN--FPEEGQYGLDIYTRE 779          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 137.502 bits (345), Expect = 1.266e-32
Identity = 142/606 (23.43%), Postives = 245/606 (40.43%), Query Frame = 1
Query: 3724 IRTGK---STYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLL-FTFTLSFND---GSEKYNEV----SLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDS-NFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSD---QLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFS----------DYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLG-RDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRN 5463
            IR GK   S Y+ + + +CR  G+ C  + GY+KG  Y           +H WNAV I+G W L+D  W A  +   + K +      D FYFL  PS+ I +HFP D  WQLL   I+I+EFE      S F++  L L+  K     T   E  + ++       RLL F++ +  +D   G+ K  EV     LL    Q +          +    PG+Y++ ++A+    EP             +C  +++  +   +Q LP  P                       Q+    D+G  +V     +P + V      C + +++     +++C+  + I  ++ + NV  P  G Y L ++  D    G +F     + +             + P  L  Y P  S          + GLS +SH    + A  G   I   +T  + ++I A L    H  ++    +++ L   D+ +   +  P  G ++  ++     +  +    + +++I  +   ++   FP  +  W  GC L EP  GVL        ++FR+ V  A+ + VV      T L+ +   +W G+    N
Sbjct:   36 IRNGKGVCSGYSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAEECSDHEWNAVFIDGQWWLLDACWGAGTV---DMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVS-----SSRLLTFSYEMRQHDPQTGALKQEEVDSSCGLLSVTHQGMKLR-------LLPSEPGTYEVKLFARREG-EPGA--------LRWVCSLELECPSVQKRQPLPDNPYLNWGLAAGASALGVKTCSVAGEQAVEVADDGECKVILNTSRPLMMV------CELAHNELNATASKRCIAMQ-IAKEQLVCNVMCPYKGFYRLSMFVQDYDSGGGTFQNAGNFLLHRQCQ-------GMNPNSL--YPPDLSLWCGSGIRTQEAGLSHFSHTGAIVNAPQGRCNITFHSTSPE-LQIHAVLCAELHEEADFPLSRYVLLTFNDTKITVSVCAPRAGVYRLGLYGRKPPQ--QDYKPLCDFVIR-SVCEKHGDPFPCVYSGWGRGCVLLEPRTGVL---APQSSVSFRVRVPGAQRVCVVGEKR--TDLKMNKSRVWEGEAVTGN 592          

HSP 2 Score: 108.612 bits (270), Expect = 1.923e-23
Identity = 52/175 (29.71%), Postives = 94/175 (53.71%), Query Frame = 1
Query:  328 EEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQ 852
            +EV+ + K +   Y+N    MC   G+ C+ +SG++KG+ Y+      ++  +H WN + +   W L+DA W    +     T    V +YDDFYF+ EP + + SHFP+   WQLL  P+++ +FE  PL  S F++ G+           ++DG   +++   +  +F+Y+++
Sbjct:   33 DEVIRNGKGVCSGYSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAEECSDHEWNAVFIDGQWWLLDACWGAGTVDMKSKT---FVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVSSSRLLTFSYEMR 204          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 119.013 bits (297), Expect = 2.658e-27
Identity = 97/316 (30.70%), Postives = 151/316 (47.78%), Query Frame = 1
Query: 3505 SKIFQKVDEHAMQVSSQ--QQDNFN-QLIWQLI--YARNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGK---STYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLL-FTFTLSFND---GSEKYNEV----SLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAK 4383
            + +F KVD  +MQ   +  +++ F+ Q I   +   ARN   E+EK+R I++WLC    H + +D       + K  S +E+   IR GK   S Y+ + + +CR  G+ C  + GY+KG  Y           +H WNAV I+G W L+D  W A  +   + K +      D FYFL  PS+ I +HFP D  WQLL   I+I+EFE      S F++  L L+  K     T   E  + ++       RLL F++ +  +D   G+ K  EV     LL    Q +          +    PG+Y++ ++A+
Sbjct:   22 TDVFNKVDAFSMQKGRELREKEEFDAQKIAHAVTEVARN---EVEKLRAIWIWLC----HNIEYDIEGYLGLSQKICSLDEV---IRNGKGVCSGYSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAEECSDHEWNAVFIDGQWWLLDACWGAGTV---DMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVS-----SSRLLTFSYEMRQHDPQTGALKQEEVDSSCGLLSVTHQGMKLR-------LLPSEPGTYEVKLFAR 312          

HSP 2 Score: 110.153 bits (274), Expect = 2.420e-24
Identity = 58/209 (27.75%), Postives = 107/209 (51.20%), Query Frame = 1
Query:  235 SDLEKARVIFRWMT---ACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQ 852
            +++EK R I+ W+      D+      +      +EV+ + K +   Y+N    MC   G+ C+ +SG++KG+ Y+      ++  +H WN + +   W L+DA W    +     T    V +YDDFYF+ EP + + SHFP+   WQLL  P+++ +FE  PL  S F++ G+           ++DG   +++   +  +F+Y+++
Sbjct:   60 NEVEKLRAIWIWLCHNIEYDIEGYLGLSQKICSLDEVIRNGKGVCSGYSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAEECSDHEWNAVFIDGQWWLLDACWGAGTVDMKSKT---FVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTLIHPKQYKTITEDGEAIVSVSSSRLLTFSYEMR 265          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Xenopus
Match: cnpy1 (canopy FGF signaling regulator 1 [Source:Xenbase;Acc:XB-GENE-981809])

HSP 1 Score: 148.288 bits (373), Expect = 5.080e-36
Identity = 128/451 (28.38%), Postives = 195/451 (43.24%), Query Frame = 1
Query:  139 FEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMT---ACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNN-QINFFFRFPTA-GVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSW-----SLISHYQLTP--QQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLP-EPGEYGLEIYANEPSE-GDTYTHICQYLL 1449
            FEK+D ++ +V + S  T   L+  L  R   +DLEK R I+ W+      D++ ++  +     P + LLS K     YA  FE MCS+AG+ CL I GF+KG  Y  G  F   E NH WN + L   W L+D  W   +  S  N   S  ++Y++FYF+  P   +  HFP+   WQLL+ PL++ QFE      S F+  G+         V + +G    ++    P  F++ L   E             ++  T N  Q++    +PT  G   L ++ +  N      T + ++    EY I+   +       P    D   GPSW       + H    P    +DG  S+         K  IV   L  D        K G +     ++Y+    + N+  F I LP + G Y L+I   + S+ G+ Y + C YLL
Sbjct:   87 FEKLDAYSAKVGKAS--TVGQLVSSL-IRMARTDLEKVRAIWTWICHHIEYDLDGMEDKSKRSGDPNQTLLSGKGACEGYAGLFENMCSHAGIQCLKIGGFSKGFCYTTGQTFS-GETNHAWNAVFLNKRWHLLDTTWGAGFANSSTN---SFKFRYNEFYFLTHPALFIEEHFPDNQNWQLLQVPLSMKQFEGNLCRNSSFYNAGLTASYPETLQVETVNGKATFSIEGHSPALFSFTLNKTEKPG----------IMTLTKNGMQLDV---YPTVTGRHKLELYTKPFN------TVKESYDKVVEY-ILHCGSVDTGFRIPKEL-DPIVGPSWLTEMKGFLQHLCSDPIIYTQDGCCSV----GFTLAKKAIVLATLHSDNI------KPGYE-----NRYVLQTLRGNRVEFKIHLPQQAGTYVLKICTKKKSDPGNMYDYACNYLL 494          

HSP 2 Score: 138.272 bits (347), Expect = 7.697e-33
Identity = 131/463 (28.29%), Postives = 203/463 (43.84%), Query Frame = 1
Query: 3508 KIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPEN-VRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEY-----KIDSNFHLKQALPPF--PPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLP-NAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            K F+K+D ++ +V   +     QL+  LI  R    +LEKVR I+ W+C     DL  M   + +   P + L+  +     YA +F  +C +AG+ C  I G++KG  Y  G  F G +  H+WNAV +   W L+D  W A    G  +   N  ++  + FYFL +P+  I  HFP + +WQLL   +++++FE      S F  YN  L       +Q        +  F        LF+FTL   + +EK   ++L + G Q LD         +   + G +KL +Y K  N    V+E+     +  + EY      +D+ F + + L P   P   +   G  +     PI         Y  +G   V F + K  I V+A L S N+K   +   + VLQ L GN      + LP  AG Y L++        GN +     Y +  S  S+
Sbjct:   85 KNFEKLDAYSAKVG--KASTVGQLVSSLI--RMARTDLEKVRAIWTWICHHIEYDLDGMEDKSKRSGDPNQTLLSGKGACEGYAGLFENMCSHAGIQCLKIGGFSKGFCYTTGQTFSG-ETNHAWNAVFLNKRWHLLDTTWGA----GFANSSTNSFKFRYNEFYFLTHPALFIEEHFPDNQNWQLLQVPLSMKQFEGNLCRNSSF--YNAGLTASYPETLQVET--VNGKATFSIEGHSPALFSFTL---NKTEKPGIMTLTKNGMQ-LD---------VYPTVTGRHKLELYTKPFNT---VKES-----YDKVVEYILHCGSVDTGFRIPKELDPIVGPSWLTEMKGFLQHLCSDPI--------IYTQDGCCSVGFTLAKKAI-VLATLHSDNIKPGYE--NRYVLQTLRGN-RVEFKIHLPQQAGTYVLKICTKKKSDPGNMYDYACNYLLCCSNPSV 501          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Xenopus
Match: lmbr1 (limb development membrane protein 1 [Source:Xenbase;Acc:XB-GENE-981846])

HSP 1 Score: 141.354 bits (355), Expect = 3.679e-34
Identity = 130/464 (28.02%), Postives = 199/464 (42.89%), Query Frame = 1
Query:  127 DPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMT---ACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRF---PTAGVFYLTIFAQELNEHNQPVTQ------------ENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTE----IVFDKLREDVSLLCKLRKNGVD-DEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL 1449
            D   FEK+D +A +V      T  DLL     R   SDLEK R I+ W+      D   L   +     P +VL + K +   Y++ FE MCS AG+ C ++SG++KG  YK G  F  D   H WN+++L+ SW L+D+ W +    S        +  Y++FYF+  P   +  HFPE+ + QLLE  ++L QFE L   K  F+K G+                    L  W PD+ T +    +     EG   R+++L         F F      T G+  LT    +L+ + Q   +            E  +    +YK+I  K+   +   P  C     GPSW         P  +D           P + TE     V   L+  +S+   L  + +    D+  ++I   ++ N   F + LP  G Y L +   +P+ GDTYT  C+Y++
Sbjct:   31 DLKAFEKLDAYAAKV------TTVDLLVKELIRNTHSDLEKTRAIWIWICHHIEYDTEGLKDLSQVSCDPNDVLRTRKGVCAGYSSLFESMCSIAGVKCKSMSGYSKGGRYKTGQTFSGDS-THEWNMVYLEGSWHLLDSTWGSVATVS----TFCFLNLYNEFYFLTHPALFIEDHFPEENKHQLLEPCVSLKQFEKLN-RKCYFYKMGL--------------------LSSW-PDTVTVETVKGKVTFTLEG---RHHLL---------FLFHLNKTETPGLMQLTEHGMKLDVYPQKTGEQILQIFAKREDSEGVYDWILDYKVIC-KSVDTNMKIP-KCLMNPVGPSWLSEKAGLFQPSHQD-----------PVIYTEDGCCTVSFALKGKLSIFATLDSSEIQMTSDMKHRHIFQTQRENDVEFKVRLPTSGTYVLCVNVKDPN-GDTYTSQCKYVI 435          

HSP 2 Score: 130.954 bits (328), Expect = 1.072e-30
Identity = 123/466 (26.39%), Postives = 210/466 (45.06%), Query Frame = 1
Query: 3508 KIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLC---------TKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYK-----IDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQS-SFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            K F+K+D +A +V++      + L+ +LI  RN   +LEK R I++W+C          KDL +++ D      P ++L   +   + Y+ +F ++C  AG+ CK + GY+KG  Y  G  F G    H WN V +EG W L+D  W +   +       N+  E   FYFL +P+  I  HFP +N  QLL   +++++FE L   K  F+K  L         ++T     + ++ F       LLF F L   + +E    + L  +G  +LD     +         G   L I+AK           DS+ ++  I +YK     +D+N  +       P C  +  GP+ + ++  +   + Q    Y ++G   V F +K   + + A L S  ++ +  +  + + Q    ND     V LP +G Y L V   D   NG+++ +  +Y I  +  ++
Sbjct:   33 KAFEKLDAYAAKVTT-----VDLLVKELI--RNTHSDLEKTRAIWIWICHHIEYDTEGLKDLSQVSCD------PNDVLRTRKGVCAGYSSLFESMCSIAGVKCKSMSGYSKGGRYKTGQTFSG-DSTHEWNMVYLEGSWHLLDSTWGSVATVST-FCFLNLYNE---FYFLTHPALFIEDHFPEENKHQLLEPCVSLKQFEKLNR-KCYFYKMGLLSSWPDTVTVET----VKGKVTFTLEGRHHLLFLFHL---NKTETPGLMQLTEHG-MKLDVYPQKT---------GEQILQIFAK---------REDSEGVYDWILDYKVICKSVDTNMKI-------PKCLMNPVGPSWLSEKAGLFQPSHQDPVIYTEDGCCTVSFALKG-KLSIFATLDSSEIQMTSDMKHRHIFQTQRENDVE-FKVRLPTSGTYVLCVNVKDP--NGDTYTSQCKYVIFCTNHTV 442          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Xenopus
Match: ENSXETT00000026111.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 92.4337 bits (228), Expect = 3.518e-18
Identity = 99/419 (23.63%), Postives = 160/419 (38.19%), Query Frame = 1
Query:  241 LEKARVIFRWMTA-----CDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGV-DDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL----DFEPPP 1467
            LEK R I+ W+        D+      +     PE+VL   K +   YA  F+ MC   G+ C  ISG+++  +Y  G  F + + NH WN + L   W L+DA W       G  T D       +  FI  P+ ++    P++  WQ  E  +   +FE      S+FF+  +   S                    +P    Y+L   E            ++ +  ++ Q+   FR    G + L++F + L+         + F+ A    +       ++  +P      + GP  +   H    P     VI+ TS       +  I F  +  D  +   L  N V  D   LD+Y  +    +K + S+ LPE G Y L I +      D + H C Y++    D  P P
Sbjct:  145 LEKIRAIWIWLCHNISEWYDVEGYLGFSQKVYRPEDVLALGKGVCSGYAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKSNHMWNAVQLDTDWHLLDACW-------GAGTVD-----LQEKIFI--PRISLRPIGPDEATWQSWESVVPFQEFEQKIFKTSEFFRLHLFITS--------------------RPLLAMYELAHVELSKTLSTRCFVSHIEESQLSCQLLLPFR----GYYRLSLFVKNLSG--------DQFKTAANLLLQCSNPINHNELFPANL-GMHCGPGINSKLHGLTDPSHTAPVINTTSG------QCNITFHTV-SDTEVYTVLENNKVRGDVYSLDRYCLVTHLDHKITISLHLPESGYYKLSILSRATGSPD-FAHACDYVIRSLSDHHPLP 508          

HSP 2 Score: 77.7962 bits (190), Expect = 1.134e-13
Identity = 54/186 (29.03%), Postives = 82/186 (44.09%), Query Frame = 1
Query: 3598 ARNITDE----LEKVRVIFLWLCTK-----DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNL 4128
             R IT E    LEK+R I++WLC       D+      + K   PE++L   +   S YA +F  +CR  G+ CK I GY++  +Y  G+ F   +  H WNAV ++  W L+D  W A                +D+   +  P   +    P +  WQ     +  +EFE      S FF+ +L
Sbjct:  134 VRGITAEARNHLEKIRAIWIWLCHNISEWYDVEGYLGFSQKVYRPEDVLALGKGVCSGYAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKSNHMWNAVQLDTDWHLLDACWGAG--------------TVDLQEKIFIPRISLRPIGPDEATWQSWESVVPFQEFEQKIFKTSEFFRLHL 305          

HSP 3 Score: 54.6842 bits (130), Expect = 1.533e-6
Identity = 65/284 (22.89%), Postives = 118/284 (41.55%), Query Frame = 1
Query: 4612 FLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPY-EPKFSD--YGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQF-LQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDV 5451
            F+  +P   ++A     +V+ S  L+ +C +   I   +    + LP  G Y L ++  +   +G+ F       +  S          L P  LG +  P  +   +GL+  SH  P I   +G   I   T  D  +  + +      +V  +  D++ L    D  +   + LP  G++K  I  L  +          +Y+I  + S  + + FP+ F  W++GC L +P +G+L  +   D   FR+ +  A  + V+  +     LE + + IW G V
Sbjct:  306 FITSRP---LLAMYELAHVELSKTLSTRCFVSH-IEESQLSCQLLLPFRGYYRLSLFVKN--LSGDQFKTAANLLLQCSNPI---NHNELFPANLGMHCGPGINSKLHGLTDPSHTAPVINTTSGQCNITFHTVSDTEVYTVLENNKVRGDVYSL--DRYCLVTHLDHKITISLHLPESGYYKLSI--LSRATGSPDFAHACDYVIR-SLSDHHPLPFPKIFSSWRQGCTLLQPRSGLLAGDIWED---FRIRIPGALKVVVIGPEK--VELELNKNKIWEGQV 570          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Xenopus
Match: ENSXETT00000026106.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 79.7221 bits (195), Expect = 4.339e-16
Identity = 52/153 (33.99%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 3502 TSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDE----LEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAA 3927
            +S  F  +D H +  S Q  +N   L  Q    R IT E    LEK+R I++WLC    H + +D       + K   PE++L   +   S YA +F  +CR  G+ CK I GY++  +Y  G+ F   +  H WNAV ++  W L+D  W A
Sbjct:   28 SSVTFTHIDNHVINWSGQ--NNCQALSIQET-VRGITAEARNHLEKIRAIWIWLC----HNIRYDVEGYLGFSQKVYRPEDVLALGKGVCSGYAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKSNHMWNAVQLDTDWHLLDACWGA 173          

HSP 2 Score: 65.855 bits (159), Expect = 3.272e-11
Identity = 36/108 (33.33%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  241 LEKARVIFRWMTACDMNKLDFA-----NSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWAT 549
            LEK R I+ W+  C   + D       +     PE+VL   K +   YA  F+ MC   G+ C  ISG+++  +Y  G  F + + NH WN + L   W L+DA W  
Sbjct:   68 LEKIRAIWIWL--CHNIRYDVEGYLGFSQKVYRPEDVLALGKGVCSGYAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTKSNHMWNAVQLDTDWHLLDACWGA 173          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Mouse
Match: Ky (kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MGI:96709])

HSP 1 Score: 158.688 bits (400), Expect = 2.790e-39
Identity = 123/446 (27.58%), Postives = 197/446 (44.17%), Query Frame = 1
Query:  127 DPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWM---TACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAAN-HSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK-NGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL 1449
            D  +FEK+D  A +V+  S     +L+ DL  +   SDLE+ R I+ W+      D+      +     P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +  + +   T     + Y++FYF+  P   +  HFP+   WQLL+ P +L QFEN    KS+F+  GM        ++ + +G   + +    P  F + L     K +   +SLR         N +      PT G   L IFA+  +E    V +   +   C Y   S +  +  H P          GPSW         P   D +I  +        +  I F  + E VS+L  L   +G   E+   +YI    +  +T   + LP  G++ L+I+  +  E   +  +  YLL
Sbjct:  148 DLRLFEKLDASASQVTVKS--GLNELVSDL-LQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFS-GEFDHAWNAVYLEGRWHLVDSTWGSGLVDT---TTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLFMFMLN---GKQEHGLLSLR--------KNGMKLEVYPPTMGTHKLQIFAKGNSEIYSSVLE---YTLKCNYVDFSVQLPSELHQPV---------GPSWFSEQMGITKPSHSDPIIHTSDG------RCAISFS-VEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQGNFIFVFNYLL 556          

HSP 2 Score: 140.198 bits (352), Expect = 2.349e-33
Identity = 113/457 (24.73%), Postives = 213/457 (46.61%), Query Frame = 1
Query: 3508 KIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEER--LLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            ++F+K+D  A QV+ +     N+L+  L+  +    +LE+VR I++W+C     D+      + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +  +     K     +  + FYFL +P+  I  HFP + +WQLL    ++ +FE+    KS F+   +     + ++I+T   +  +       IE R   LF F L   +G +++  +SL + G +            +  P  G++KL I+AK            + +++ ++ EY +  N+         P       GP+   +Q  I +  +     +  +G   + F +++  + V+A L   +   +++   + + Q L       + V LP+AG++ L+++    ++ GN F  V+ Y +  +   +
Sbjct:  150 RLFEKLDASASQVTVK--SGLNELVSDLL--QEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGSGLVDTTTSK---FTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATIT------IESRAPTLFMFML---NGKQEHGLLSLRKNGMK----------LEVYPPTMGTHKLQIFAK-----------GNSEIYSSVLEYTLKCNY--VDFSVQLPSELHQPVGPSWFSEQMGITKPSHSDPIIHTSDGRCAISFSVEE-GVSVLASLHGDDGPITEETQRRYIFQ-LNRGKRTELKVQLPHAGKFALKIFVKKRQEQGN-FIFVFNYLLCCANTKV 563          

HSP 3 Score: 74.7146 bits (182), Expect = 8.119e-13
Identity = 77/318 (24.21%), Postives = 133/318 (41.82%), Query Frame = 1
Query: 4507 QSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSD-YGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFL-QLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVD 5454
            ++S Y  +E Y +  + +    S     NG   +    + P +     +F  N K    L         +  +   + V+ P  G + L+++A   K N   + +V +Y +  +       LPS     +GP    FS+  G++  SH DP I  + G   I      ++ + ++A L      ++E    +++ QL R       ++LPH G F  +IF     E G  +  VFNYL+    +      FP+ FG W +   L EP +GVL  N     I F++  +   + A+V   + W  L  + +G W G  +
Sbjct:  337 ENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLF----MFMLNGKQEHGLLS-------LRKNGMKLEVYPPTMGTHKLQIFA---KGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGP--SWFSEQMGITKPSHSDPIIHTSDGRCAISFSV--EEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQGNFI-FVFNYLLCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLPAN---RNIAFKLK-LHGIAKALVKGQDTWP-LTLNPEGYWEGSCN 630          
BLAST of Kyphoscoliosis peptidase vs. UniProt/SwissProt
Match: sp|Q0E908|HIL_DROME (Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.255e-74
Identity = 156/496 (31.45%), Postives = 250/496 (50.40%), Query Frame = 1
Query:   73 ISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANS-HPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTS-------GKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS------FTYKLQTDESKDQ--FEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFV--KTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANE------------------PSEGDTYTHICQYLLD 1452
            ++ P P PP+  K Q+Y DP  FE VD  AI V+Q    TF DL+  L  R   +D+EKAR IFRW+T  ++N + F +    + P  +L  +K    SY   F+ +CSYAGL C+ I G++K   Y+PG  F+   F ++WN +++  +W+ +  +W  R+L +       G+   DS+ Y+YDD YF+ +P++ +Y  +P + EWQLL++P+TL +FENLP  +S FF+ G+ F  + +G V   D      +    P        F Y L+  +S ++  ++GVSL+ +V+Q  + N + F    P +G F L IFA  +        +   F++ C++KI  ++      P P  C    WGP+            +  G+I IT  +   F     ++ F   R     +  L KNG+ +E  L +Y+  +   +  +F I+ PE G+YGL+IY  E                    E    TH C+YL++
Sbjct:  330 LNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLVGRCT-TDIEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSVIGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCEELQTVMVPLP-DCASGEWGPT---------KATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGI-EEKKLAKYVTHSTLDDIVTFIINFPEEGQYGLDIYTRELGGPQHHHHHNNNNSSSSSGEKHLLTHCCKYLIN 813          

HSP 2 Score: 253.062 bits (645), Expect = 1.199e-68
Identity = 153/467 (32.76%), Postives = 238/467 (50.96%), Query Frame = 1
Query: 3454 ALPSEMPTKVAI-SPEETSKI--------FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN-IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKP-------ENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVT--HKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEK--YNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYAND 4791
            A+P E P    I +P   SK         F+ VD  A+ V+ + Q  F  L+ QL+  R  TD +EK R IF W+  K+L+ M+FD+ ++ D+P  +L GI+ G  +Y  +F  LC YAGLHC +I GY+K A Y PG+KFQ  +  +SWNAV + G WR + C+W AR L+  +  P       +++RYE D  YFL +P + IY  +P   +WQLL   I + EFE+L  V+S+FF+Y L      +   V   +     +RIA P  ++  L+F + L F D  E+  Y+ VSL R+  Q +  I N   F +  P  G++ L I+A  +   P          F ++C++KI     L+  + P P C S  +GP +  + + +     Q        +++++F + +P    MA L    ++   +L +      L      IIN   P  G+YGL++Y  +
Sbjct:  323 AVPVEYPLNAPIPAPPAVSKFQIYTDPIEFEDVDRIAISVAQEDQKTFTDLVRQLV-GRCTTD-IEKARTIFRWITVKNLNAMHFDDDLRGDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSRFRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKNDSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVT--PQEYLTGEPMKFKSVCKFKICCE-ELQTVMVPLPDCASGEWGPTKATRLFGLIPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEK-KLAKYVTHSTLDDIVTFIIN--FPEEGQYGLDIYTRE 779          
BLAST of Kyphoscoliosis peptidase vs. UniProt/SwissProt
Match: sp|Q8C8H8|KY_MOUSE (Kyphoscoliosis peptidase OS=Mus musculus OX=10090 GN=Ky PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.042e-38
Identity = 123/446 (27.58%), Postives = 197/446 (44.17%), Query Frame = 1
Query:  127 DPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWM---TACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAAN-HSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK-NGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL 1449
            D  +FEK+D  A +V+  S     +L+ DL  +   SDLE+ R I+ W+      D+      +     P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +  + +   T     + Y++FYF+  P   +  HFP+   WQLL+ P +L QFEN    KS+F+  GM        ++ + +G   + +    P  F + L     K +   +SLR         N +      PT G   L IFA+  +E    V +   +   C Y   S +  +  H P          GPSW         P   D +I  +        +  I F  + E VS+L  L   +G   E+   +YI    +  +T   + LP  G++ L+I+  +  E   +  +  YLL
Sbjct:  148 DLRLFEKLDASASQVTVKS--GLNELVSDL-LQEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFS-GEFDHAWNAVYLEGRWHLVDSTWGSGLVDT---TTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLFMFMLN---GKQEHGLLSLR--------KNGMKLEVYPPTMGTHKLQIFAKGNSEIYSSVLE---YTLKCNYVDFSVQLPSELHQPV---------GPSWFSEQMGITKPSHSDPIIHTSDG------RCAISFS-VEEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQGNFIFVFNYLL 556          

HSP 2 Score: 140.198 bits (352), Expect = 1.557e-32
Identity = 113/457 (24.73%), Postives = 213/457 (46.61%), Query Frame = 1
Query: 3508 KIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEER--LLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASI 4860
            ++F+K+D  A QV+ +     N+L+  L+  +    +LE+VR I++W+C     D+      + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +  +     K     +  + FYFL +P+  I  HFP + +WQLL    ++ +FE+    KS F+   +     + ++I+T   +  +       IE R   LF F L   +G +++  +SL + G +            +  P  G++KL I+AK            + +++ ++ EY +  N+         P       GP+   +Q  I +  +     +  +G   + F +++  + V+A L   +   +++   + + Q L       + V LP+AG++ L+++    ++ GN F  V+ Y +  +   +
Sbjct:  150 RLFEKLDASASQVTVK--SGLNELVSDLL--QEAHSDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGSGLVDTTTSK---FTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATIT------IESRAPTLFMFML---NGKQEHGLLSLRKNGMK----------LEVYPPTMGTHKLQIFAK-----------GNSEIYSSVLEYTLKCNY--VDFSVQLPSELHQPVGPSWFSEQMGITKPSHSDPIIHTSDGRCAISFSVEE-GVSVLASLHGDDGPITEETQRRYIFQ-LNRGKRTELKVQLPHAGKFALKIFVKKRQEQGN-FIFVFNYLLCCANTKV 563          

HSP 3 Score: 74.3294 bits (181), Expect = 8.273e-12
Identity = 76/318 (23.90%), Postives = 133/318 (41.82%), Query Frame = 1
Query: 4507 QSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSD-YGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFL-QLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVD 5454
            ++S Y  +E Y +  + +    S     NG   +    + P +     +F  N K    L         +  +   + V+ P  G + L+++A   K N   + +V +Y +  +       LPS     +GP    FS+  G++  SH DP I  + G   I      ++ + ++A L      ++E    +++ QL R       ++LPH G F  +IF     E G  +  VFNYL+    +      FP+ FG W +   L EP +GVL  N     + F++  +   + A+V   + W  L  + +G W G  +
Sbjct:  337 ENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIESRAPTLF----MFMLNGKQEHGLLS-------LRKNGMKLEVYPPTMGTHKLQIFA---KGNSEIYSSVLEYTLKCNYVDFSVQLPSELHQPVGP--SWFSEQMGITKPSHSDPIIHTSDGRCAISFSV--EEGVSVLASLHGDDGPITEETQRRYIFQLNRGKRTELKVQLPHAGKFALKIFVKKRQEQGNFI-FVFNYLLCCANTKVNWPMFPESFGNWGQDNELLEPLSGVLPAN---RNVAFKLK-LHGIAKALVKGQDTWP-LTLNPEGYWEGSCN 630          
BLAST of Kyphoscoliosis peptidase vs. UniProt/SwissProt
Match: sp|Q8NBH2|KY_HUMAN (Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 GN=KY PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 1.978e-36
Identity = 120/444 (27.03%), Postives = 200/444 (45.05%), Query Frame = 1
Query:  139 FEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPN-----GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAAN-HSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK-NGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYAN--EPSEGDTYTHICQY 1443
            FEK+D +A +V+  S     +L+ DL  +   +DLE+ R I+ W+  C   + D A +         P ++L + K     YA  FE MC  AG+ C+T+ G++KG  Y+ G  F   EF+H WN ++L+  W L+D+ W +  + +         + Y++FYF+  P   +  HFP+   WQLL+ P +L QFEN    KS+F+  GM        ++ + +G   + +    P  F + L     K +   +SLR         N +      PT G   L IFA+  ++    V +   +   C Y  +  +  A  H P          GPSW       + P   D +I  +        +  I F  + E +++L  L   +G   E+   +YI    +  +T   + LP  G++ L+IY    E +  + Y++I +Y
Sbjct:  152 FEKLDIYASQVTAKS--GLDELVSDL-LQEAHTDLERVRAIWIWI--CHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFS-GEFDHAWNAVYLEGRWHLVDSTWGSGLVDT---ITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPTLFMFML---NGKQEHGLLSLR--------KNGMKLEVYPPTMGTHKLQIFAKGNSDIYSSVLE---YTLKCNYVDMGVQLPAELHQPV---------GPSWFSEQMGIMKPSHPDPIIHTSDG------RCSISFS-VEEGINVLASLHGDDGPITEETQRRYIFQLHREKQTELKVQLPHAGKFALKIYVMVLENANHNFYSYILKY 556          

HSP 2 Score: 131.339 bits (329), Expect = 4.659e-30
Identity = 108/440 (24.55%), Postives = 206/440 (46.82%), Query Frame = 1
Query: 3514 FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYA 4821
            F+K+D +A QV+++     ++L+  L+  +    +LE+VR I++W+C     D+      + +   P +IL   +T    YA +F  +CR AG+ C  + GY+KG  Y  G  F G + +H+WNAV +EG W L+D  W +  +   +       +  + FYFL +P+  I  HFP + +WQLL    ++ +FE+    KS F+   +     + ++I+T   +  + I          LF F L   +G +++  +SL + G +            +  P  G++KL I+AK            +  ++ ++ EY +  N+         P       GP+   +Q  I +  +     +  +G   + F +++  I V+A L   +   +++   + + Q L    +  + V LP+AG++ L++Y    +   ++FY+
Sbjct:  152 FEKLDIYASQVTAK--SGLDELVSDLL--QEAHTDLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG-EFDHAWNAVYLEGRWHLVDSTWGSGLV---DTITSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIESCAPT----LFMFML---NGKQEHGLLSLRKNGMK----------LEVYPPTMGTHKLQIFAK-----------GNSDIYSSVLEYTLKCNY--VDMGVQLPAELHQPVGPSWFSEQMGIMKPSHPDPIIHTSDGRCSISFSVEE-GINVLASLHGDDGPITEETQRRYIFQ-LHREKQTELKVQLPHAGKFALKIYVMVLENANHNFYS 551          
BLAST of Kyphoscoliosis peptidase vs. UniProt/SwissProt
Match: sp|O14302|CYK3_SCHPO (cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyk3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.615e-10
Identity = 50/197 (25.38%), Postives = 89/197 (45.18%), Query Frame = 1
Query:  229 QLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEF------MCSYAGLCCLTISGFAKGVDYKPGDVF--KKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSI-VYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKD 792
            Q + L + R +F +++     ++ F N   +  +E+  S + +       FE       M     L C  I G+ K     P D++  +    NH WNV+   N  +LIDA +A     S  + Q ++     +DFYF+M+P + +++H PE  + Q +   L++     LP   S +F  G+  R  +  ++H  D
Sbjct:  492 QTTALAQMRAVFIYIS----ERITFTNQTLDN-DELRTSTQVISEGQGTPFEVALLVKEMLQALDLWCEVIEGYLKS----PDDIYYTRDININHAWNVVTFDNEVRLIDASFA-----SPTHPQQALKSSSSNDFYFLMKPNECIFTHVPENPDQQFIMPDLSMPIVMALPWVSSVYFTLGLKLRKFNTSILHLND 674          

HSP 2 Score: 62.7734 bits (151), Expect = 3.816e-8
Identity = 58/241 (24.07%), Postives = 106/241 (43.98%), Query Frame = 1
Query: 3514 FQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN--IKQDSPEEILMGIRTGKSTYAQIFLT---LCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYEL-DMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAF--PKGIE 4212
            F  +D+    +  Q+      ++ +   A   T  L ++R +F+++      ++ F N  +  D        I  G+ T  ++ L    + +   L C++I GY K  D +     +     H+WN V  +   RLID  +A+       H  + ++    + FYFL  P++ I+TH P + D Q +   +++    +L  V S++F   L L     +++  N  E  L+I F  PK IE
Sbjct:  461 FSAIDKQIRSIIPQRVQVSPAVLAKNYLAPGQTTALAQMRAVFIYIS----ERITFTNQTLDNDELRTSTQVISEGQGTPFEVALLVKEMLQALDLWCEVIEGYLKSPDDI--YYTRDININHAWNVVTFDNEVRLIDASFAS-----PTHPQQALKSSSSNDFYFLMKPNECIFTHVPENPDQQFIMPDLSMPIVMALPWVSSVYFTLGLKLRKFNTSILHLNDLEV-LQIEFLAPKDIE 689          
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Match: A0A3R7F7Z9 (Kyphoscoliosis peptidase OS=Clonorchis sinensis OX=79923 GN=KY PE=4 SV=1)

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 451/789 (57.16%), Postives = 561/789 (71.10%), Query Frame = 1
Query: 3253 PYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFN--DGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQEN---------DSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKK----PDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVG----FPQQFGQWKEGCYLYEPTNGVLGFNGKP-DKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 5559
            P+     DQ++     S    PS  Q YRPD+STANW++GP+Q+EPPK F   PI  E  + KP  Q LPS      A  P  +  +F++VDEHA+ +S QQQD+F QLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN+K D+PEEILMGIRTGKSTYAQIF TLCRYAGLHCKL++GYAKGA+Y PGM+F GRQG+HSWNAVL++ VWRL+DCHWAARRLIGK   PENVRY LDMFYFLANP QLIYTHFPHD+DWQLL H I ++EFE+LAPVKS FFKYNLDL+TH+NAVI    PE  + IAFP   E+ L FTF LS +  +GSE+Y  + L RYGRQE+  + + S F +R P PG+YKLLIYAK     P  Q+N         +S  M+GA+CEY++ +NFH   +LPP+PPCQSS+YGPNE+ K Y I+++  Q +     G +E++F +      P  R+M +L  C +   + LT   + + + GN EA+  VFLP AGEYGLE+YAN+  K+GNSFY VWQY I+S + S V GLP++ P YLGP  P+F   GLST SH DPFI ANTG++CIQL    D P+R+MAQLIH SH+VSE CS Q LQ  RD+ VYF++R PH GFFKFQI+ALPYSE GESLPGVFNYL+E  Q  +   G    FPQQF QWKEGCYL+ P +G+L  + +P D I F++ V +A ++AVV  D  WTHL K  D  W G V ++  W +  +++L+VC N+    + NY TIL+Y +
Sbjct:  797 PFYRQQYDQFSATAGGSPGYAPS-GQFYRPDQSTANWSAGPIQQEPPKEFSLLPISTETYVEKPRPQDLPSIGDKSTA--PFGSFDVFRRVDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAKHHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYPPCQSSSYGPNELAKNYQIQAKQTQCTLRATRGCLEIRFALGSALGLPPPRMMGRL-RCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYIILSDSESPVRGLPTIPPAYLGPM-PRFDSMGLSTVSHPDPFIQANTGELCIQLNQNPDIPVRMMAQLIHASHDVSEDCSQQILQQMRDNQVYFVVRFPHPGFFKFQIYALPYSEPGESLPGVFNYLLEATQVHRNRSGQVMCFPQQFSQWKEGCYLHSPLDGILSPSAQPSDVIPFKLTVPKAIAVAVVVGD-EWTHLNKVGDR-WEGQVSLKQHWGR--EHQLAVCANYNT-GNGNYGTILEYQV 1575          

HSP 2 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 311/599 (51.92%), Postives = 392/599 (65.44%), Query Frame = 1
Query:   28 MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMC------------SYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQ-----------------TDESKDQFEG--VSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITS----------PNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKPQAS---------------------------VFGPIKPGSKPLSHKPSKIRDMYNYEKDATPLGSLPKPYMPSQY 1620
            M APS F LP P+   S PPP  P YLKHQVYD P VF KVD HAI+V+   +P F+DL+WDL +RY+L +LE+ARVIFRWM++ DM  + F +S PN PEE+L+S K+ +G++A  FE MC            SY+G+ C+T+SG+AKGVDY PGD F     NH+WNV+H++ SWQLID HWA RYL+SG+N  +++VY+YDDFYF+MEPQQAVYSHFPE   WQLL  PLTL+QFENLPLTKSQFFKC +DF  QHHGVV ++DG L+M LGFW+P  FTYKLQ                   E  D      V L+ +VLQET  +++NF+FR P +GV+YLTI+AQEL+  N  V +E+TFRAACEYKII D+ A +  PYP TCHDANWGP+W  + +Y L P   DGVIS+T+              P V  +I F K R +V+LL KL +NGV DE  LDQY  + E   +T+F ++LPEPGEYGLEIYANEP+EGDTYTH+CQYL+ +E PPG+ P                              VFG +   SK      S +R+MY+YE  A  +G LP+PY  SQY
Sbjct:   53 MYAPSGFHLPSPLSEDSHPPPGLPQYLKHQVYDQPDVFSKVDEHAIQVAGCEHPAFRDLVWDLVYRYRLDELERARVIFRWMSSKDMQNIRFESSPPNSPEEILMSFKHNRGTFARIFEIMCRYVRNSITHSGFSYSGIHCITVSGYAKGVDYLPGDRFSGLPPNHSWNVVHIRGSWQLIDVHWAARYLSSGRNAPENVVYEYDDFYFMMEPQQAVYSHFPEDPCWQLLPVPLTLSQFENLPLTKSQFFKCAIDFLEQHHGVVFTRDGLLRMVLGFWRPGGFTYKLQYLTNSSGHPHPEELSTNPSELSDSIPSLDVDLKNFVLQETTKDRLNFYFRLPASGVYYLTIYAQELS--NLTVDRESTFRAACEYKIICDRPAVDSHPYP-TCHDANWGPAWPHVYYYALEPSHTDGVISVTAKEEWNRGASGSRTPPPVSVDIRFGKQRPEVNLLAKLHRNGVPDE-FLDQYQRVTETMLETTFHVTLPEPGEYGLEIYANEPAEGDTYTHMCQYLVHYEAPPGWNPTPRLTASGADAGPSPEAIKARGLSEATGDRVFGRLAAASKWPVDLSSPLREMYDYEMHAPSMGVLPRPYAESQY 647          

HSP 3 Score: 275.404 bits (703), Expect = 9.424e-71
Identity = 159/468 (33.97%), Postives = 254/468 (54.27%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSD-LEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGF----WKPDSFTYKLQTD--ESKDQFEGVSLRYYVLQE--TVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQEN-------------TFRAACEYKIISD-KAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSL-----LCKLRKNGVDDEDILDQYIEIAEKPNKTS-FSISLPEPGEYGLEIYANEPS-EGDTYTHICQYLL 1449
            VF +VD HA+ +SQ    +FK L+W L +   ++D LEK RVIF W+   D++K++F N  P+ PEE+L+ ++  K +YA  F  +C YAGL C  + G+AKG +Y PG  F   +  H+WN + +   W+L+D HWA R L   + + +++ Y  D FYF+  P Q +Y+HFP  ++WQLL  P+TL +FENL   KS FFK  +D  +  + V+   D  + + + F     K  SFT+ L  D  E  +++ G+ L  Y  QE   V ++  F+ R P  G + L I+A+  +  N P  Q+N              + A CEY+++++     +  PYP  C  +++GP+  L  +YQ+  +Q    +  T          EI F  L   + L     + +LR   V DE +    ++ +   N+ + F++ LPE GEYGLEIYAN P+ +G+++  + QY++
Sbjct:  880 VFRRVDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAK--HHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYP-PCQSSSYGPN-ELAKNYQIQAKQTQCTLRATRGC------LEIRF-ALGSALGLPPPRMMGRLRCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYII 1336          

HSP 4 Score: 274.248 bits (700), Expect = 2.667e-70
Identity = 176/522 (33.72%), Postives = 263/522 (50.38%), Query Frame = 1
Query: 3412 PIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRY------------AGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAF--PKGIEERLLFTFTLSFNDGSEKYN-------------EVSLLRYGRQEL--DFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQY----PIESENVQSSFYIDNG-------------TVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFI 4839
            P  L E+ + P    LP  +  +V   P+    +F KVDEHA+QV+  +   F  L+W L+Y R   DELE+ RVIF W+ +KD+  + F++   +SPEEILM  +  + T+A+IF  +CRY            +G+HC  + GYAKG DY+PG +F G    HSWN V I G W+LID HWAAR L    + PENV YE D FYF+  P Q +Y+HFP D  WQLL   + + +FE+L   KS FFK  +D +   + V+ T      + + F  P G   +L +    S +   E+ +             +V L  +  QE   D +N    F  R P  G Y L IYA+    E +    D +  F A CEYKI  +     +  P+P C  + +GP   +  Y    P  ++ V S    +               +V+++F  ++P++ ++AKL    V +      Q V + ++   E   +V LP  GEYGLE+YAN+  + G+++  + QY +
Sbjct:   62 PSPLSEDSHPPP--GLPQYLKHQVYDQPD----VFSKVDEHAIQVAGCEHPAFRDLVWDLVY-RYRLDELERARVIFRWMSSKDMQNIRFESSPPNSPEEILMSFKHNRGTFARIFEIMCRYVRNSITHSGFSYSGIHCITVSGYAKGVDYLPGDRFSGLPPNHSWNVVHIRGSWQLIDVHWAARYLSSGRNAPENVVYEYDDFYFMMEPQQAVYSHFPEDPCWQLLPVPLTLSQFENLPLTKSQFFKCAIDFLEQHHGVVFTRDGLLRMVLGFWRPGGFTYKLQYLTNSSGHPHPEELSTNPSELSDSIPSLDVDLKNFVLQETTKDRLN----FYFRLPASGVYYLTIYAQ----ELSNLTVDRESTFRAACEYKIICDRPAVDSH-PYPTCHDANWGPAWPHVYYYALEPSHTDGVISVTAKEEWNRGASGSRTPPPVSVDIRFGKQRPEVNLLAKLHRNGVPDEFLDQYQRVTETML---ETTFHVTLPEPGEYGLEIYANEPAE-GDTYTHMCQYLV 563          
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Match: H2KPM4 (Kyphoscoliosis peptidase OS=Clonorchis sinensis OX=79923 GN=CLF_102240 PE=4 SV=1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 451/789 (57.16%), Postives = 561/789 (71.10%), Query Frame = 1
Query: 3253 PYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFN--DGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQEN---------DSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKK----PDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVG----FPQQFGQWKEGCYLYEPTNGVLGFNGKP-DKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 5559
            P+     DQ++     S    PS  Q YRPD+STANW++GP+Q+EPPK F   PI  E  + KP  Q LPS      A  P  +  +F++VDEHA+ +S QQQD+F QLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN+K D+PEEILMGIRTGKSTYAQIF TLCRYAGLHCKL++GYAKGA+Y PGM+F GRQG+HSWNAVL++ VWRL+DCHWAARRLIGK   PENVRY LDMFYFLANP QLIYTHFPHD+DWQLL H I ++EFE+LAPVKS FFKYNLDL+TH+NAVI    PE  + IAFP   E+ L FTF LS +  +GSE+Y  + L RYGRQE+  + + S F +R P PG+YKLLIYAK     P  Q+N         +S  M+GA+CEY++ +NFH   +LPP+PPCQSS+YGPNE+ K Y I+++  Q +     G +E++F +      P  R+M +L  C +   + LT   + + + GN EA+  VFLP AGEYGLE+YAN+  K+GNSFY VWQY I+S + S V GLP++ P YLGP  P+F   GLST SH DPFI ANTG++CIQL    D P+R+MAQLIH SH+VSE CS Q LQ  RD+ VYF++R PH GFFKFQI+ALPYSE GESLPGVFNYL+E  Q  +   G    FPQQF QWKEGCYL+ P +G+L  + +P D I F++ V +A ++AVV  D  WTHL K  D  W G V ++  W +  +++L+VC N+    + NY TIL+Y +
Sbjct:  107 PFYRQQYDQFSATAGGSPGYAPS-GQFYRPDQSTANWSAGPIQQEPPKEFSLLPISTETYVEKPRPQDLPSIGDKSTA--PFGSFDVFRRVDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAKHHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYPPCQSSSYGPNELAKNYQIQAKQTQCTLRATRGCLEIRFALGSALGLPPPRMMGRL-RCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYIILSDSESPVRGLPTIPPAYLGPM-PRFDSMGLSTVSHPDPFIQANTGELCIQLNQNPDIPVRMMAQLIHASHDVSEDCSQQILQQMRDNQVYFVVRFPHPGFFKFQIYALPYSEPGESLPGVFNYLLEATQVHRNRSGQVMCFPQQFSQWKEGCYLHSPLDGILSPSAQPSDVIPFKLTVPKAIAVAVVVGD-EWTHLNKVGDR-WEGQVSLKQHWGR--EHQLAVCANYNT-GNGNYGTILEYQV 885          

HSP 2 Score: 275.018 bits (702), Expect = 5.108e-73
Identity = 159/468 (33.97%), Postives = 254/468 (54.27%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSD-LEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGF----WKPDSFTYKLQTD--ESKDQFEGVSLRYYVLQE--TVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQEN-------------TFRAACEYKIISD-KAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSL-----LCKLRKNGVDDEDILDQYIEIAEKPNKTS-FSISLPEPGEYGLEIYANEPS-EGDTYTHICQYLL 1449
            VF +VD HA+ +SQ    +FK L+W L +   ++D LEK RVIF W+   D++K++F N  P+ PEE+L+ ++  K +YA  F  +C YAGL C  + G+AKG +Y PG  F   +  H+WN + +   W+L+D HWA R L   + + +++ Y  D FYF+  P Q +Y+HFP  ++WQLL  P+TL +FENL   KS FFK  +D  +  + V+   D  + + + F     K  SFT+ L  D  E  +++ G+ L  Y  QE   V ++  F+ R P  G + L I+A+  +  N P  Q+N              + A CEY+++++     +  PYP  C  +++GP+  L  +YQ+  +Q    +  T          EI F  L   + L     + +LR   V DE +    ++ +   N+ + F++ LPE GEYGLEIYAN P+ +G+++  + QY++
Sbjct:  190 VFRRVDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAK--HHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYP-PCQSSSYGPN-ELAKNYQIQAKQTQCTLRATRGC------LEIRF-ALGSALGLPPPRMMGRLRCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYII 646          
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Match: A0A1S8WJI3 (TGc domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09607 PE=4 SV=1)

HSP 1 Score: 908.672 bits (2347), Expect = 0.000e+0
Identity = 450/789 (57.03%), Postives = 563/789 (71.36%), Query Frame = 1
Query: 3253 PYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFN--DGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQEN---------DSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKK----PDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVG----FPQQFGQWKEGCYLYEPTNGVLGFNGKP-DKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 5559
            P+     DQ++     S    PS  Q YRPD+STANW++GP+Q+EPPK F   PI  E  + KP  Q LPS +  K  + P  +  +F+++DEHA+ +S QQQD+F QLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN+K D+PEEILMGIRTGKSTYAQIF TLCRYAGLHCKL++GYAKGA+Y PGM+F GRQG+HSWNAVL++ VWRL+DCHWAARRLIGK   PENVRY LDMFYFLANP QLIYTHFPHD+DWQLL H I ++EFE+LAPVKS FFKYNLDL+TH+NAVI    PE  + IAFP   E+ L FTF LS +  +GSE+Y  + L RYGRQE+  + + S F +R P PG+YKLLIYAK     P  Q+N         +S  M+GA+CEY++ +NFH   +LPP+PPCQSS+YGPNE+ K Y I+++  Q +     G +E++F +      P  R+M +L  C +   + LT   + + + GN EA+  VFLP AGEYGLE+YAN+  K+GNSFY VWQY I+S + S V GLP++ P YLGP  P+F   GLST SH DPFI ANTG++CIQL    D P+R+MAQLIH SH+VSE CS Q LQ  RD+ VYF++R PH GFFKFQI+ALPYSE GESLPGVFNYL+E  Q  +   G    FPQQF QWKEGCYL+ P +G+L  + +P D I F++ V +A ++AVV  D  WTHL K  D  W G V ++  W +  +++L+VC N+    + NY TIL+Y +
Sbjct:   18 PFYRQQYDQFSATPGGSPGYAPS-GQFYRPDQSTANWSAGPIQQEPPKEFSLLPISTETYVEKPRPQDLPS-IGDKSTV-PFGSFDVFRRLDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAKHHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYPPCQSSSYGPNELAKNYQIQAKQTQCTLRATRGCLEIRFALGSSLGLPPPRMMGRL-RCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYIILSDSESPVRGLPTIPPAYLGPM-PRFDSMGLSTVSHPDPFIQANTGELCIQLNQNPDIPVRMMAQLIHASHDVSEDCSQQILQQMRDNQVYFVVRFPHPGFFKFQIYALPYSEPGESLPGVFNYLLEATQVHRNRSGQVMCFPQQFSQWKEGCYLHSPLDGILSPSAQPSDVIPFKLTVPKAIAVAVVVGD-EWTHLNKVGDR-WEGQVSLKQHWGR--EHQLAVCANYNT-GNGNYGTILEYQV 796          

HSP 2 Score: 273.863 bits (699), Expect = 2.416e-73
Identity = 158/468 (33.76%), Postives = 254/468 (54.27%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSD-LEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGF----WKPDSFTYKLQTD--ESKDQFEGVSLRYYVLQE--TVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQEN-------------TFRAACEYKIISD-KAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSL-----LCKLRKNGVDDEDILDQYIEIAEKPNKTS-FSISLPEPGEYGLEIYANEPS-EGDTYTHICQYLL 1449
            VF ++D HA+ +SQ    +FK L+W L +   ++D LEK RVIF W+   D++K++F N  P+ PEE+L+ ++  K +YA  F  +C YAGL C  + G+AKG +Y PG  F   +  H+WN + +   W+L+D HWA R L   + + +++ Y  D FYF+  P Q +Y+HFP  ++WQLL  P+TL +FENL   KS FFK  +D  +  + V+   D  + + + F     K  SFT+ L  D  E  +++ G+ L  Y  QE   V ++  F+ R P  G + L I+A+  +  N P  Q+N              + A CEY+++++     +  PYP  C  +++GP+  L  +YQ+  +Q    +  T          EI F  L   + L     + +LR   V DE +    ++ +   N+ + F++ LPE GEYGLEIYAN P+ +G+++  + QY++
Sbjct:  101 VFRRLDEHAVSISQQQQDSFKQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAK--HHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANFHPNCSLPPYP-PCQSSSYGPN-ELAKNYQIQAKQTQCTLRATRGC------LEIRF-ALGSSLGLPPPRMMGRLRCTLVPDEALTRSLLQRSVNGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYII 557          
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Match: A0A4E0RXE9 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_001183 PE=4 SV=1)

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 444/794 (55.92%), Postives = 558/794 (70.28%), Query Frame = 1
Query: 3274 DQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETS-KIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFN--DGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQEN------------DSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLI-----KKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVG----FPQQFGQWKEGCYLYEPTNGVL--------GFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 5559
            DQ N+     +   PS    YRPD STANW +GP+Q+EPPK F+ +P+  E  + KP+ Q LPS   T V   P   S  +F++VDEHA+ +S QQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLH+MNFDN+K DSPEEILMGIRTGKSTYAQIF TLCRYAGLHCKL++GYAKGA+Y PGM F GRQG+HSWNAVL++ VWRL+DCHWAARRLIGK   PENVRY LDMFYFLANP QLIYTHFPHD+DWQLL H I+++EFE+LAPVKS FFKYNL+LVTH+NAVI T  PE  + I+FP G ++ + FTF LS +  +GSE+Y  + L RYGRQE+    N S F +R P PG+YKLLIYAK          +            +++ M+GA+CEY++ +NF    +LPP+PPCQSS+YGPNE+ K Y I  +  + +     G +E++F +       P  R+M KL  C +   + L+   + + + G  EA+  VFLP AGEYGLE+YAN+  ++GNSF+ VWQY I+S + S V GLPS+ P YLGP  P+F   GLST SH DPF+ ANTG++CIQL T  D P+RIMAQLIH S++V+E CS Q LQ  RD+ V+FLIR PH GFFKFQI+ALP+SE GESLPGVFNYL+E  Q  +   G    FPQQF QWKEGCYLY P +GV+          +G+ D ++FR+ V RA ++AVV  D +WTHL K  D  W G V ++  W +  + +L++C N+    D NY T+L+Y +
Sbjct: 1008 DQINSTQGGGAAYAPSVATFYRPDRSTANWGTGPIQREPPKEFKPRPLAPEMSVEKPQPQELPSVGDTTV---PRFGSFDVFRRVDEHAVSISQQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHRMNFDNVKPDSPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMHFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPISLKEFENLAPVKSAFFKYNLNLVTHRNAVIVTVEPEVRVEISFPSGADQYMSFTFGLSIDNKEGSEEYRGLPLSRYGRQEISVRQNKSIFYVRPPRPGAYKLLIYAKHQGASNQTSHSNNGTITDYGSDVNTENMYGAVCEYRLVANFGPNASLPPYPPCQSSSYGPNELAKNYSILPQYSECTLRAQRGCLELRFRLGGPGSNGPPARLMGKL-RCTLVAEEALSRSLLQRNVNGGREAVFVVFLPEAGEYGLEIYANNPDRDGNSFFVVWQYIILSDSESPVRGLPSIPPAYLGPM-PRFESMGLSTASHSDPFVQANTGELCIQLNTRPDIPLRIMAQLIHASNDVTEDCSQQVLQQMRDNQVFFLIRFPHPGFFKFQIYALPFSEPGESLPGVFNYLLEATQVHRGRNGQVMPFPQQFAQWKEGCYLYTPLDGVISPASSNGGSISGQSDTVSFRVSVPRAHAVAVVVGD-DWTHLGKVLDR-WEGQVSLKPHWGR--ERQLALCANYD-NGDGNYGTLLEYRL 1791          

HSP 2 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 309/597 (51.76%), Postives = 401/597 (67.17%), Query Frame = 1
Query:   28 MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQ-----------------TDESKDQFEGVS--LRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSP---------NNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKP----------------------QASVFGPIKPGSKPLSHKPSK---------------IRDMYNYEKDATPLGSLPKPYMPSQYA 1623
            M AP  F LP P+ + + PPP  P YLKHQVYD P VF KVD HAI+VS   +P F+DL+WDL +RY+L +LE+ARVIFRWM++ DM  + F ++ PN PEEVLLS K  +G++A  FE MCSY+G+ C+T+SG+AKGVDY PGD F     NH+WNVI+++ SWQL+DAHWA RYL+SGKN  +++VY+YDDFYF+MEPQQAVYSHFPE + WQLL  PLTL+QFENLPLTKSQFFKC +DF  QHHGVVH++DG L+M LGFW+P  FTYKLQ                   + +DQ   ++  L+ ++LQET  +++NF+FR P +GV+YLTI+AQEL      V +E+TFRAACEYKII D  A +  PYP TCHDANWGP+W  + HY L P   DGVIS+ +           + P +  +++F K R +V+LL KL +NGV D D LDQY  ++E   +T F ++LPEPGEYGLEIYANEPSEGDTYTH+CQYL+ +E PPG++P                      Q++  G I  G+  ++ +  +               +R+MY+YE  A  LG LP+PY  SQYA
Sbjct:    1 MYAPEGFQLPHPLSSENNPPPELPKYLKHQVYDKPEVFSKVDEHAIQVSSCEHPAFRDLMWDLVYRYKLDELERARVIFRWMSSKDMQTIRFVSAPPNSPEEVLLSFKYNRGTFARIFEVMCSYSGIHCITVSGYAKGVDYLPGDRFSGLPANHSWNVIYIRGSWQLVDAHWAARYLSSGKNLPENVVYEYDDFYFMMEPQQAVYSHFPEDSRWQLLPTPLTLSQFENLPLTKSQFFKCAIDFLDQHHGVVHTRDGRLRMTLGFWRPGGFTYKLQYLITSAGHPNPEALVANPADLRDQVPKINMELKSFLLQETTRDRLNFYFRLPASGVYYLTIYAQELASLK--VGRESTFRAACEYKIICDTPAVDAQPYP-TCHDANWGPAWPHVQHYALEPSHTDGVISLCAKADWSPTVDQRSPPPMTIDVLFGKQRPEVNLLAKLHRNGVPD-DYLDQYQRVSETVQETRFHVTLPEPGEYGLEIYANEPSEGDTYTHMCQYLVHYEAPPGWRPTPRLTASGADAGPSAEAVHAWRQSAGSGMI--GTDRVTRQADRNHHNSTYWSGENQGSLREMYDYESHAPSLGQLPRPYAASQYA 591          

HSP 3 Score: 286.189 bits (731), Expect = 6.403e-74
Identity = 172/494 (34.82%), Postives = 257/494 (52.02%), Query Frame = 1
Query: 3460 PSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAF--PKGIEERLLFTFTLS--------------FNDGSEKYNEVSLLRYGRQEL--DFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPN----EMYKQYPIESENVQS-------SFYIDNG-----TVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFI 4839
            P E+P  +     +  ++F KVDEHA+QVSS +   F  L+W L+Y R   DELE+ RVIF W+ +KD+  + F +   +SPEE+L+  +  + T+A+IF  +C Y+G+HC  + GYAKG DY+PG +F G    HSWN + I G W+L+D HWAAR L   ++ PENV YE D FYF+  P Q +Y+HFP D+ WQLL   + + +FE+L   KS FFK  +D +   + V+ T      + + F  P G   +L +  T +                D   K N + L  +  QE   D +N    F  R P  G Y L IYA+    E    +   +  F A CEYKI  +     A  P+P C  + +GP     + Y   P  ++ V S       S  +D       T++V F  ++P++ ++AKL    V + D L +   +   +   E   +V LP  GEYGLE+YAN+  + G+++  + QY +
Sbjct:   20 PPELPKYLKHQVYDKPEVFSKVDEHAIQVSSCEHPAFRDLMWDLVY-RYKLDELERARVIFRWMSSKDMQTIRFVSAPPNSPEEVLLSFKYNRGTFARIFEVMCSYSGIHCITVSGYAKGVDYLPGDRFSGLPANHSWNVIYIRGSWQLVDAHWAARYLSSGKNLPENVVYEYDDFYFMMEPQQAVYSHFPEDSRWQLLPTPLTLSQFENLPLTKSQFFKCAIDFLDQHHGVVHTRDGRLRMTLGFWRPGGFTYKLQYLITSAGHPNPEALVANPADLRDQVPKIN-MELKSFLLQETTRDRLN----FYFRLPASGVYYLTIYAQ----ELASLKVGRESTFRAACEYKIICDTPAVDAQ-PYPTCHDANWGPAWPHVQHYALEPSHTDGVISLCAKADWSPTVDQRSPPPMTIDVLFGKQRPEVNLLAKLHRNGVPD-DYLDQYQRVSETV--QETRFHVTLPEPGEYGLEIYANEPSE-GDTYTHMCQYLV 498          

HSP 4 Score: 266.544 bits (680), Expect = 7.350e-68
Identity = 149/467 (31.91%), Postives = 246/467 (52.68%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSD-LEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPD----SFTYKLQTD--ESKDQFEGVSLRYYVLQE--TVNNQINFFFRFPTAGVFYLTIFAQELNEHNQP--------------VTQENTFRAACEYKIISDKAA-ANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLRED---VSLLCKLRKNGVDDEDILDQYIEIAEKPNKTS-FSISLPEPGEYGLEIYANEP-SEGDTYTHICQYLL 1449
            VF +VD HA+ +SQ     F  L+W L +   ++D LEK RVIF W+   D+++++F N  P+ PEE+L+ ++  K +YA  F  +C YAGL C  + G+AKG +Y PG  F   +  H+WN + +   W+L+D HWA R L   + + +++ Y  D FYF+  P Q +Y+HFP  ++WQLL  P++L +FENL   KS FFK  ++  +  + V+ + +  +++ + F        SFT+ L  D  E  +++ G+ L  Y  QE     N+  F+ R P  G + L I+A+     NQ               V  EN + A CEY+++++    A+  PYP  C  +++GP+  L  +Y + PQ  +  +       +  ++          +     L+ KLR   V +E +    ++      + + F + LPE GEYGLEIYAN P  +G+++  + QY++
Sbjct: 1085 VFRRVDEHAVSISQQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHRMNFDNVKPDSPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMHFSGRQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPISLKEFENLAPVKSAFFKYNLNLVTHRNAVIVTVEPEVRVEISFPSGADQYMSFTFGLSIDNKEGSEEYRGLPLSRYGRQEISVRQNKSIFYVRPPRPGAYKLLIYAKHQGASNQTSHSNNGTITDYGSDVNTENMYGAVCEYRLVANFGPNASLPPYP-PCQSSSYGPN-ELAKNYSILPQYSECTLRA----QRGCLELRFRLGGPGSNGPPARLMGKLRCTLVAEEALSRSLLQRNVNGGREAVFVVFLPEAGEYGLEIYANNPDRDGNSFFVVWQYII 1545          
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Match: A0A095ADX6 (Kyphoscoliosis peptidase OS=Schistosoma haematobium OX=6185 GN=MS3_00128 PE=4 SV=1)

HSP 1 Score: 881.708 bits (2277), Expect = 0.000e+0
Identity = 435/770 (56.49%), Postives = 551/770 (71.56%), Query Frame = 1
Query: 3328 QKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFN--DGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQEN------------DSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKF----LIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVG----FPQQFGQWKEGCYLYEPTNGVLGFNGK----PDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVI 5559
            Q Y+ D+STANW+SGP+Q+ PPK F   P+ ++    KP+ Q +P+   T+++ +P ++  IF+++DEHA+ VS QQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFD++K DSPEEILMGIRTGKSTYAQIF TLCRYAGLHCKL++GYAKGA+Y PGM F GRQG+HSWNAVLI+  WRLIDCHWAARRLIGK   P+NVRY LDMFYFLA+PSQLIYTHFPHD DWQLL H ++++EFE+LAPVKS FFKYNLDLVTH+N+VI  + PE  + IAFP   +  L FTF LSF+  +GSE++  + L R+GRQE     + S F IR P PG+YKLLIYAK      N Q+              S+ +FGA+CEY++ +NF    +LPPFPPCQSS+YGPNE+ K Y I ++ V  +     GT+E++F    L   P  R+MAKL  C +   + L++  + + + GN EA+  +FLP AGEYGLEVYAND  K+GNSF+ VWQY I+S   S V GLP++ P YLGP   +F   GL   SH DPFI ANTG++CIQ     DKP+RIMAQLIHCSH+VSE CS Q LQ  RD  +YF+IR PH GFFKFQI+ALPY+E GESLP V+NYL+E  Q ++   G    FPQQF QWKEGCYL+ P +G+L  +G      D + FR+ +  A ++AVV  + +WTHL K +D  W G V ++  W    +N+L++C  + ++ D NY T+L+Y +
Sbjct:  605 QFYKFDQSTANWSSGPIQRVPPKEFAPSPLSMDTLEDKPKPQEIPTT--TEMSSTPYQSFDIFRRIDEHAVSVSQQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDHVKPDSPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMHFSGRQGQHSWNAVLIDKCWRLIDCHWAARRLIGKRPSPDNVRYGLDMFYFLASPSQLIYTHFPHDPDWQLLRHPVSLKEFENLAPVKSAFFKYNLDLVTHRNSVIVCSDPEVRIVIAFPSDSKNDLSFTFGLSFDNQEGSEEFRGIPLTRFGRQETLIREHTSVFYIRPPRPGAYKLLIYAKQHQPHQNGQKEGLGIVSMIPDDLSSENLFGAVCEYRLVANFGSNCSLPPFPPCQSSSYGPNELAKNYRITAQRVDCTLRAIRGTLEIRFGLGSLPGCPPPRLMAKL-KCTLVAENALSKSLLQRSVNGNSEAVFAIFLPEAGEYGLEVYANDPVKDGNSFFVVWQYIIISDCDSPVRGLPTIPPTYLGPVS-RFDSMGLKALSHTDPFIQANTGELCIQFARHPDKPLRIMAQLIHCSHDVSEDCSQQILQQTRDFQIYFVIRFPHPGFFKFQIYALPYTEPGESLPSVYNYLLEATQVNRGRNGHVMCFPQQFAQWKEGCYLHTPMDGILYPSGSNQPTADTVPFRVTIPTAHAVAVVVGE-DWTHLSKVND-CWIGQVCLKPYWGI--ENQLALCAKYNVD-DGNYGTLLEYRL 1365          

HSP 2 Score: 360.918 bits (925), Expect = 1.793e-98
Identity = 197/399 (49.37%), Postives = 247/399 (61.90%), Query Frame = 1
Query:  619 MEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQ-----------------TDESKDQFE--GVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISI---------TSPNNKPFVKT-EIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYK----PQASVFGPIKPGSKPLSHK---------------------------PS-----KIRDMYNYEKDATPLGSLPKPYMPSQY 1620
            MEPQQAVYSHFPE   WQLL  PLTL+QFENLPLTKSQFFKC +DF  QHHGVV ++DG L+M LGFW+P  FTYKLQ                   E  DQ     V L+ +VLQET  +++NFFFR P +G++YLTI+AQEL+  +  V +E+TFRAACEYKII    A +  PYP+ CHDANWGP+WS + HY L P   +GVISI         ++ ++ P  KT +I F K R +V+LL KL +NGV D D LDQY  + E   +T F ++LPEPGEYGLE+YANEPSEGDTYTH+CQYL+ +E P  +     P+ +  G    G  P++H+                           PS      +R+MYNYE DA P+G+LPK Y  SQY
Sbjct:    1 MEPQQAVYSHFPEDQRWQLLPVPLTLSQFENLPLTKSQFFKCAIDFLQQHHGVVRTQDGCLRMTLGFWRPGGFTYKLQYLVTSYNNPDLDSLTAYPSELTDQVPNLNVDLKCFVLQETTKDRLNFFFRLPASGIYYLTIYAQELS--SLAVGRESTFRAACEYKIICSSPARDAQPYPI-CHDANWGPAWSHVHHYALEPSHTEGVISIPNELDSSVNSNGHHTPLPKTVDIRFQKHRPEVNLLAKLHRNGVSD-DFLDQYQRVTETVRETLFHVTLPEPGEYGLEVYANEPSEGDTYTHMCQYLIHYEYPSNWSNNCIPRLTTAG-ADAGPSPVAHQFWHSNERTNNNTRNGNLPKYLSATFNEPSLNSSGSLREMYNYELDAPPIGNLPKLYAHSQY 394          

HSP 3 Score: 271.166 bits (692), Expect = 1.021e-69
Identity = 162/504 (32.14%), Postives = 263/504 (52.18%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSD-LEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGF---WKPD-SFTYKLQTD--ESKDQFEGVSLRYYVLQETVNNQIN--FFFRFPTAGVFYLTIFAQELNEHNQ--------------PVTQENTFRAACEYKIISDKAA-ANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKL------REDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEP-SEGDTYTHICQYLL--DFEPPPGYKPQA--SVFGPIKP----GSKPLSH 1530
            +F ++D HA+ VSQ     F  L+W L +   ++D LEK RVIF W+   D++K++F +  P+ PEE+L+ ++  K +YA  F  +C YAGL C  + G+AKG +Y PG  F   +  H+WN + +   W+LID HWA R L   + + D++ Y  D FYF+  P Q +Y+HFP   +WQLL  P++L +FENL   KS FFK  +D  +  + V+   D  +++ + F    K D SFT+ L  D  E  ++F G+ L  +  QET+  +    F+ R P  G + L I+A++   H                 ++ EN F A CEY+++++  +  +  P+P  C  +++GP+  L  +Y++T Q+ D  +       +  ++       L      R    L C L       + +L + +      ++  F+I LPE GEYGLE+YAN+P  +G+++  + QY++  D + P    P    +  GP+      G K LSH
Sbjct:  664 IFRRIDEHAVSVSQQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDHVKPDSPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMHFSGRQGQHSWNAVLIDKCWRLIDCHWAARRLIGKRPSPDNVRYGLDMFYFLASPSQLIYTHFPHDPDWQLLRHPVSLKEFENLAPVKSAFFKYNLDLVTHRNSVIVCSDPEVRIVIAFPSDSKNDLSFTFGLSFDNQEGSEEFRGIPLTRFGRQETLIREHTSVFYIRPPRPGAYKLLIYAKQHQPHQNGQKEGLGIVSMIPDDLSSENLFGAVCEYRLVANFGSNCSLPPFP-PCQSSSYGPN-ELAKNYRITAQRVDCTLRAI----RGTLEIRFGLGSLPGCPPPRLMAKLKCTLVAENALSKSLLQRSV---NGNSEAVFAIFLPEAGEYGLEVYANDPVKDGNSFFVVWQYIIISDCDSPVRGLPTIPPTYLGPVSRFDSMGLKALSH 1158          

HSP 4 Score: 111.309 bits (277), Expect = 1.810e-20
Identity = 93/315 (29.52%), Postives = 144/315 (45.71%), Query Frame = 1
Query: 4003 PSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAF--PKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHS----CFCI------------RTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMY-KQYPIESENVQSSFYIDN----------------GTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGN-DEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFI 4839
            P Q +Y+HFP D  WQLL   + + +FE+L   KS FFK  +D +   + V++T      + + F  P G   +L +  T S+N+        SL  Y  +  D + N +    CF +            R P  G Y L IYA+    E +      +  F A CEYKI  +   + A  P+P C  + +GP   +   Y +E  + +    I N                 TV+++F   +P++ ++AKL    V  SD   +Q   QR+     E + +V LP  GEYGLEVYAN+  + G+++  + QY I
Sbjct:    3 PQQAVYSHFPEDQRWQLLPVPLTLSQFENLPLTKSQFFKCAIDFLQQHHGVVRTQDGCLRMTLGFWRPGGFTYKLQYLVT-SYNNPDLD----SLTAYPSELTDQVPNLNVDLKCFVLQETTKDRLNFFFRLPASGIYYLTIYAQ----ELSSLAVGRESTFRAACEYKIICSSPARDAQ-PYPICHDANWGPAWSHVHHYALEPSHTEGVISIPNELDSSVNSNGHHTPLPKTVDIRFQKHRPEVNLLAKLHRNGV--SDDFLDQ--YQRVTETVRETLFHVTLPEPGEYGLEVYANEPSE-GDTYTHMCQYLI 302          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Cavefish
Match: ENSAMXT00000040397.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:312137:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000040397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 5.268e-43
Identity = 166/650 (25.54%), Postives = 281/650 (43.23%), Query Frame = 1
Query: 3487 ISPEETSKIFQ---------KVDEHAMQVSSQQQDN---FNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQD------------SPEEILMGIRTGK---STYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAA------RRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALP-PF---PPCQSSTYGPN-EMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKF--SDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVL 5316
            I P+ + K+FQ         +VD + +    + +       + I Q I     T++LE++R +++WLC         DNI+ D            SP+++   IRTGK   S YA + L LC   G+ C+ + GY KG  Y PG K QG    H+WNAV +EG W L+D  W A      +R+  K +         + FYFL +P + I  H+P +  WQLL   +N++EFE      + F++  L L+  K   + T   E  + +    G+ E   FT+T+S  +GS+K    + L   R  L    +     +  P  GS+++ ++A+   V  +         +  +C      +F LK A P PF   P   S  +G + + Y +     E       + +G  E+     +P +RV+  L   ++  +  L  +CV  +    ++   +V  P  G Y L VY  D  ++GN  +     F++  T++ V+      P       P    ++ GLS +SH    + A  G   I  +  +D  +  +     C  +   +    F+     S+V   I LP  G +  ++F         +   + +++I+ N S      FP  +  W++G  L EP +G+L
Sbjct:  168 IKPQSSRKLFQELIANTDFSRVDTYVINAGKELKRKKIYSVETIAQTII-NGTTNDLERLRAVWIWLC---------DNIEYDVEGFLGVTKKLYSPDDV---IRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQGTN--HAWNAVNLEGHWHLLDSCWGAGNCDMSQRVFNKCY---------NEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISM----GLSEPANFTYTISQCNGSKK----TELSKSRGLLTITKSSMKLRVIPPTAGSFEVELFARAAGVTGS---------YSHLC------SFLLKCAKPKPFEDLPENPSLCWGISPDGYARGLRSCEYGGEVIELRSGRFELVLQTARP-LRVICSLSHKDLDGT--LATRCVASQAEA-EKLTCSVLCPYTGYYTLSVYVRD-YESGNGNHESAASFLLHCTSNPVNLNELFPPDLSNKCGPGLTTTEAGLSQFSHTGAIVTAQQGKCNITFQNQQDISLHAVLSKEQCKLSTYPLSRYSFVNYD-GSMVTISIALPEPGSYLLRLFG--------NSTHLCDFIIQ-NSSDISCPPFPCTYSSWEKGGVLLEPQSGLL 755          

HSP 2 Score: 128.257 bits (321), Expect = 2.632e-29
Identity = 96/402 (23.88%), Postives = 176/402 (43.78%), Query Frame = 1
Query:  235 SDLEKARVIFRWMTACDMNKLDF-----ANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQ--YDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGD 1419
            +DLE+ R ++ W+  CD  + D             P++V+ + K +   YA     +C+  G+ C  ++G+ KGV Y+PG   K    NH WN ++L+  W L+D+ W      +G       V+   Y++FYF+ +P++ +  H+P + +WQLLE+P+ L +FE      +QF++ G+         + +++G   +++G  +P +FTY +       + E    R   L     + +      PTAG F + +FA+        VT   +   +   K    K   +    P  C    WG S    +    + +    VI + S       + E+V    R  + ++C L    +D   +  + +    +  K + S+  P  G Y L +Y  +   G+
Sbjct:  221 NDLERLRAVWIWL--CDNIEYDVEGFLGVTKKLYSPDDVIRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQ--KCQGTNHAWNAVNLEGHWHLLDSCWG-----AGNCDMSQRVFNKCYNEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPANFTYTISQCNGSKKTELSKSRG--LLTITKSSMKLRVIPPTAGSFEVELFARAAG-----VTGSYSHLCSFLLKCAKPKPFEDLPENPSLC----WGISPDGYARGLRSCEYGGEVIELRSG------RFELVLQTAR-PLRVICSLSHKDLDG-TLATRCVASQAEAEKLTCSVLCPYTGYYTLSVYVRDYESGN 594          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Cavefish
Match: ENSAMXT00000032424.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:316716:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000032424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 2.157e-42
Identity = 156/582 (26.80%), Postives = 259/582 (44.50%), Query Frame = 1
Query: 3610 TDELEKVRVIFLWLCTK---DLHKMNFDNIKQDSPEEILMGIRTGK---STYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALP-PF---PPCQSSTYGPN-EMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKF--SDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVL 5316
            T++LE++R +++WLC     D+        K  SP+++   IRTGK   S YA + L LC   G+ C+ + GY KG  Y PG K QG    H+WNAV +EG W L+D  W A        +  N  Y  + FYFL +P + I  H+P +  WQLL   +N++EFE      + F++  L L+  K   + T   E  + +    G+ E   FT+T+S  +GS+K    + L   R  L    +     +  P  GS+++ ++A+   V  +         +  +C      +F LK A P PF   P   S  +G + + Y +     E       + +G  E+     +P +RV+  L   ++  +  L  +CV  +    ++   +V  P  G Y L VY  D  ++GN  +     F++  T++ V+      P       P    ++ GLS +SH    + A  G   I  +  +D  +  +     C  +   +    F+     S+V   I LP  G +  ++F       G S   + +++I+ N S      FP  +  W++G  L EP +G+L
Sbjct:   59 TNDLERLRAVWIWLCDNIEYDVEGFLGVTKKLYSPDDV---IRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQGTN--HAWNAVNLEGHWHLLDSCWGAGN-CDMSQRVFNKCY--NEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISM----GLSEPANFTYTISQCNGSKK----TELSKSRGLLTITKSSMKLRVIPPTAGSFEVELFARAAGVTGS---------YSHLC------SFLLKCAKPKPFEDLPENPSLCWGISPDGYARGLRSCEYGGEVIELRSGRFELVLQTARP-LRVICSLSHKDLDGT--LATRCVASQAEA-EKLTCSVLCPYTGYYTLSVYVRD-YESGNGNHESAASFLLHCTSNPVNLNELFPPDLSNKCGPGLTTTEAGLSQFSHTGAIVTAQQGKCNITFQNQQDISLHAVLSKEQCKLSTYPLSRYSFVNY-DGSMVTISIALPEPGSYLLRLF-------GNSTH-LCDFIIQ-NSSDISCPPFPCTYSSWEKGGVLLEPQSGLL 594          

HSP 2 Score: 127.487 bits (319), Expect = 2.553e-29
Identity = 96/401 (23.94%), Postives = 175/401 (43.64%), Query Frame = 1
Query:  238 DLEKARVIFRWMTACDMNKLDF-----ANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQ--YDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGD 1419
            DLE+ R ++ W+  CD  + D             P++V+ + K +   YA     +C+  G+ C  ++G+ KGV Y+PG   K    NH WN ++L+  W L+D+ W      +G       V+   Y++FYF+ +P++ +  H+P + +WQLLE+P+ L +FE      +QF++ G+         + +++G   +++G  +P +FTY +       + E    R   L     + +      PTAG F + +FA+        VT   +   +   K    K   +    P  C    WG S    +    + +    VI + S       + E+V    R  + ++C L    +D   +  + +    +  K + S+  P  G Y L +Y  +   G+
Sbjct:   61 DLERLRAVWIWL--CDNIEYDVEGFLGVTKKLYSPDDVIRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQ--KCQGTNHAWNAVNLEGHWHLLDSCWG-----AGNCDMSQRVFNKCYNEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPANFTYTISQCNGSKKTELSKSRG--LLTITKSSMKLRVIPPTAGSFEVELFARAAG-----VTGSYSHLCSFLLKCAKPKPFEDLPENPSLC----WGISPDGYARGLRSCEYGGEVIELRSG------RFELVLQTAR-PLRVICSLSHKDLDG-TLATRCVASQAEAEKLTCSVLCPYTGYYTLSVYVRDYESGN 433          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 147.132 bits (370), Expect = 4.163e-35
Identity = 140/547 (25.59%), Postives = 230/547 (42.05%), Query Frame = 1
Query: 3427 EEIYKPEIQALPSEMPTKVAISPEETSK------------IFQKVDEHAMQVSSQ--QQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFND---GSEKYNEV----SLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDS-NFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYI---DNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPY---EPKFSDYGLSTYSHKDPFI 4962
            EE  KP     P   P K  +    +S+            +F KVD  A+    +  +Q  F+         +   +ELEK+R I++WLC    H + +D       + K  +PEE++   R   S ++ I L +CR  G+ C+ + GY+KG  + PG K    + +HSWN V ++  W L+D  W A   +  E K    R+  D FYFL +PS+ I +HFP +  WQLL   I++E+FE L P+K+  F Y L L   +    +    + E  ++        L F + L   D   G     EV     LL   RQ +          +  P PG Y+L ++A+         E DS  +   +C  +++       Q LP  P     ++G         ++  ++ +   +   + G  EV     +P + V+ +L    +  +  L ++C L   I  +  + NV  P  G Y L ++  D      +   V  + +   +  +   L  L P  LGP+     +    GLS +SH    +
Sbjct:  151 EEPAKPLSPTDPGRQPGKACLPISSSSQRKPRRQLFSSTGVFHKVDTLAISAGRELKEQGVFSAQSIARAITQGAINELEKLRAIWVWLC----HNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSGFSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRSDHSWNVVWVKDRWGLLDACWGA-GTVNMETKTFVKRF--DDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFE-LGPLKTSAF-YTLGLTLQQPTQYKITTEDGEATVSVTS--SRPLTFAYELRQRDVQTGVPGQREVDSSCGLLSVTRQGMSLR-------LLPPDPGDYELKLFAR--------AEGDSGALR-WVCSLELECPAVRQSQPLPANP---YMSWGSGARAGALGVKGCSLPNEEPLEVGEGGECEVILHTARP-LMVVCELAHALLDPA--LAKRC-LALQIAAERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLLHCKSQGV--NLNQLYPPDLGPWCGPGMRTDAAGLSQFSHPGALV 661          

HSP 2 Score: 134.42 bits (337), Expect = 3.559e-31
Identity = 113/473 (23.89%), Postives = 207/473 (43.76%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQ----------LSDLEKARVIFRWMTACDMNKLD---FANSHPN--GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYV-----LQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPF-----VKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGD-TYTHICQYLL 1449
            + Q++    VF KVD  AI          ++L     F  Q          +++LEK R I+ W+  C   + D   +    P    PEEV+   + +   +++    MC   G+ C  +SG++KG+ + PG    +D  +H+WNV+ +++ W L+DA W    +     T    V ++DDFYF+ +P + + SHFP++  WQLL+ P++L +FE  PL  S F+  G+  +      + ++DG   +++   +P +F Y+L+    +D   GV  +  V     L       ++     P  G + L +FA+   +           R  C  + +   A     P P     AN   SW   +          GV   + PN +P       + E++    R  + ++C+L  + + D  +  + + +     +   ++  P  G Y L ++  + S+G  T  ++  +LL
Sbjct:  182 RRQLFSSTGVFHKVDTLAISAG-------RELKEQGVFSAQSIARAITQGAINELEKLRAIWVWL--CHNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSGFSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRSDHSWNVVWVKDRWGLLDACWGAGTVNMETKT---FVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELR---QRDVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGD-------SGALRWVCSLE-LECPAVRQSQPLP-----ANPYMSWGSGARAGAL-----GVKGCSLPNEEPLEVGEGGECEVILHTAR-PLMVVCEL-AHALLDPALAKRCLALQIAAERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLL 619          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 147.132 bits (370), Expect = 4.163e-35
Identity = 140/547 (25.59%), Postives = 230/547 (42.05%), Query Frame = 1
Query: 3427 EEIYKPEIQALPSEMPTKVAISPEETSK------------IFQKVDEHAMQVSSQ--QQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFND---GSEKYNEV----SLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDS-NFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYI---DNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPY---EPKFSDYGLSTYSHKDPFI 4962
            EE  KP     P   P K  +    +S+            +F KVD  A+    +  +Q  F+         +   +ELEK+R I++WLC    H + +D       + K  +PEE++   R   S ++ I L +CR  G+ C+ + GY+KG  + PG K    + +HSWN V ++  W L+D  W A   +  E K    R+  D FYFL +PS+ I +HFP +  WQLL   I++E+FE L P+K+  F Y L L   +    +    + E  ++        L F + L   D   G     EV     LL   RQ +          +  P PG Y+L ++A+         E DS  +   +C  +++       Q LP  P     ++G         ++  ++ +   +   + G  EV     +P + V+ +L    +  +  L ++C L   I  +  + NV  P  G Y L ++  D      +   V  + +   +  +   L  L P  LGP+     +    GLS +SH    +
Sbjct:  151 EEPAKPLSPTDPGRQPGKACLPISSSSQRKPRRQLFSSTGVFHKVDTLAISAGRELKEQGVFSAQSIARAITQGAINELEKLRAIWVWLC----HNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSGFSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRSDHSWNVVWVKDRWGLLDACWGA-GTVNMETKTFVKRF--DDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFE-LGPLKTSAF-YTLGLTLQQPTQYKITTEDGEATVSVTS--SRPLTFAYELRQRDVQTGVPGQREVDSSCGLLSVTRQGMSLR-------LLPPDPGDYELKLFAR--------AEGDSGALR-WVCSLELECPAVRQSQPLPANP---YMSWGSGARAGALGVKGCSLPNEEPLEVGEGGECEVILHTARP-LMVVCELAHALLDPA--LAKRC-LALQIAAERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLLHCKSQGV--NLNQLYPPDLGPWCGPGMRTDAAGLSQFSHPGALV 661          

HSP 2 Score: 134.42 bits (337), Expect = 3.559e-31
Identity = 113/473 (23.89%), Postives = 207/473 (43.76%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQ----------LSDLEKARVIFRWMTACDMNKLD---FANSHPN--GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYV-----LQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPF-----VKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGD-TYTHICQYLL 1449
            + Q++    VF KVD  AI          ++L     F  Q          +++LEK R I+ W+  C   + D   +    P    PEEV+   + +   +++    MC   G+ C  +SG++KG+ + PG    +D  +H+WNV+ +++ W L+DA W    +     T    V ++DDFYF+ +P + + SHFP++  WQLL+ P++L +FE  PL  S F+  G+  +      + ++DG   +++   +P +F Y+L+    +D   GV  +  V     L       ++     P  G + L +FA+   +           R  C  + +   A     P P     AN   SW   +          GV   + PN +P       + E++    R  + ++C+L  + + D  +  + + +     +   ++  P  G Y L ++  + S+G  T  ++  +LL
Sbjct:  182 RRQLFSSTGVFHKVDTLAISAG-------RELKEQGVFSAQSIARAITQGAINELEKLRAIWVWL--CHNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSGFSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDRSDHSWNVVWVKDRWGLLDACWGAGTVNMETKT---FVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELR---QRDVQTGVPGQREVDSSCGLLSVTRQGMSLRLLPPDPGDYELKLFARAEGD-------SGALRWVCSLE-LECPAVRQSQPLP-----ANPYMSWGSGARAGAL-----GVKGCSLPNEEPLEVGEGGECEVILHTAR-PLMVVCEL-AHALLDPALAKRCLALQIAAERLVCNVLCPYKGFYRLSMFVRDYSDGSGTLQNVGNFLL 619          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009155.1 (pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-1 gene:ENSPMAG00000008280.1 transcript:ENSPMAT00000009155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 1.160e-24
Identity = 61/170 (35.88%), Postives = 93/170 (54.71%), Query Frame = 1
Query: 3616 ELEKVRVIFLWLCTKDLH--KMNFDNIKQDSPEEILMGIRTG-KSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFF 4116
            ELEK+R I++W+C    +  K  F   K +  +E ++  RT   + YA +   +CR+ G+ C+ +VGY K   +VP   FQ     H+WNAV I G W L+D  W A   +  E +  N RY  + FYFLA+P + + +H+P  + WQL+ H ++ E+FE        FF
Sbjct:   13 ELEKLRSIWIWVCHNIEYDVKYWFGKDKSNYKKEDVLSSRTAICAGYAGLVNEMCRHVGVECEEVVGYGKTLGHVP---FQIEDPNHAWNAVRIGGRWYLLDACWGAG-AVSNETQSFNRRY--NEFYFLADPKKFVESHWPKISKWQLMEHLVSREDFEYRVLKDFRFF 176          

HSP 2 Score: 88.1965 bits (217), Expect = 4.898e-20
Identity = 53/173 (30.64%), Postives = 88/173 (50.87%), Query Frame = 1
Query:  235 SDLEKARVIFRWMTACDMNKLD----FANSHPN-GPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFF 738
            ++LEK R I  W+  C   + D    F     N   E+VL S   +   YA     MC + G+ C  + G+ K + + P   F+ ++ NH WN + +   W L+DA W    ++   N   S   +Y++FYF+ +P++ V SH+P+ ++WQL+E  ++   FE   L   +FF
Sbjct:   12 TELEKLRSI--WIWVCHNIEYDVKYWFGKDKSNYKKEDVLSSRTAICAGYAGLVNEMCRHVGVECEEVVGYGKTLGHVP---FQIEDPNHAWNAVRIGGRWYLLDACWGAGAVS---NETQSFNRRYNEFYFLADPKKFVESHWPKISKWQLMEHLVSREDFEYRVLKDFRFF 176          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Nematostella
Match: EDO40037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B7])

HSP 1 Score: 112.079 bits (279), Expect = 1.467e-24
Identity = 151/632 (23.89%), Postives = 246/632 (38.92%), Query Frame = 1
Query: 3496 EETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDN--------IKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKE---HKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSE--KYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSS--TYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVS-STASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVY---FLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKE-GCYLYEPTNGVLGFNGK 5331
            E TS + +++D H  +      ++  +L  Q + A     +  +   ++ W+       ++FD+         K+   E +L+        +A +F  LC  A +  + + G+AKG  Y  G + QG +  H+WN +     W + D  W +   +G +   H+  N  Y      F+  P   I  HFP D  WQLL   I+ EEFE+L       F   L L +HKN   Q  +    + +  PK    R +    L  + G      N + +     +E DF+          P PG Y++ I   L++ E  +             EY++  +  + Q    FP   +S  T G   +     I +EN +++  +     +V  L K    +V        +K   Q    C +++ +      I V  P  G Y L+++A   K   NS Y +  YFI + S     +G P L          KFS  G  T   K   I A  G+  + LK      +RI   L     ++  MC  +     + +  Y     I  P  G FK  IF     E       V +Y+++  + +  N GFP+  GQ K  G  L +    +   +GK
Sbjct:  172 ELTSSVDREIDAHVRKTPKDATESIEKL-SQYLTAPFEESQRSRAFALYRWITLN----VSFDSEGYFGRAEKKECRAESVLVTRSAVSQGFANLFQALCMEADIQARSVDGFAKGYGYCAGDEIQGSKFAHTWNILRTRVGWTICDVTWGSG-FLGDDLMFHRQPNAHY------FMVTPELAISDHFPLDTKWQLLDAVISKEEFENLIVPSPAIFSSGLRLESHKNCFYQEESDSIVITLRAPK----RNMIRGVLKDSSGQTIGPRNMIDVTSGKLKEADFLIPVKV-TTHFPEPGEYRVQIC--LVSAEGQLVPG---------VEYRVRCSRGVGQNTGGFPHLGTSFNTLGFELIKPLENIATENGRANIVLSCEDRKVTNL-KCKLTKVFLDSGDNTLKEQVQDKSMCFVEKRL--KLFRIKVNSPQTGTYKLDIFAK--KAYANSEY-ICTYFINAYSGVKSPAGFPYLS--------EKFSSRGF-TLVDKFENIEARDGEASVTLKIPVG--VRITGYLKSGEEDLPNMCYTEMKPRDKGAKTYESTVHIHTPRAGVFKVNIFG---REANGDTQFVCSYVVKSLKPAGDNPGFPRVSGQLKTWGVELVDQQQNITSPDGK 755          

HSP 2 Score: 103.219 bits (256), Expect = 7.577e-22
Identity = 57/215 (26.51%), Postives = 103/215 (47.91%), Query Frame = 1
Query:  136 VFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTAC----DMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVY--QYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRS 762
            V  ++D H  +  +++  + + L   L   ++ S   +A  ++RW+T             A       E VL++   +   +AN F+ +C  A +   ++ GFAKG  Y  GD  +  +F HTWN++  +  W + D  W + +L       D +++  Q +  YF++ P+ A+  HFP  T+WQLL+  ++  +FENL +     F  G+   S
Sbjct:  177 VDREIDAHVRKTPKDATESIEKLSQYLTAPFEESQRSRAFALYRWITLNVSFDSEGYFGRAEKKECRAESVLVTRSAVSQGFANLFQALCMEADIQARSVDGFAKGYGYCAGDEIQGSKFAHTWNILRTRVGWTICDVTWGSGFLG------DDLMFHRQPNAHYFMVTPELAISDHFPLDTKWQLLDAVISKEEFENLIVPSPAIFSSGLRLES 385          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Nematostella
Match: EDO32609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUI9])

HSP 1 Score: 98.9821 bits (245), Expect = 9.014e-21
Identity = 105/472 (22.25%), Postives = 186/472 (39.41%), Query Frame = 1
Query:  235 SDLEKARVIFRWMT---ACDMNKLDFANSH--PNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYD--DFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS-----FTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAA-NHSPYPMTCHDANWGPSWSL---ISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLR------------------------EDVSLLCKLRKNGVDD--------EDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLL----DFEPPPGYKPQASVF 1494
            +D EKA  I+RW+T   A D++   F  S       E+VL S  ++   YA+ +  +   AGL    +SG+AKG  +K G  F  +  NH WNV+ + N+W + DA W   ++       D +++  +   + F+  P +A++ H PE+ +WQ L+  +    FE       +  + G++  S       +    + M   F+ P          K  + ++ +  E V LR+  L      QI    +FP AG + + ++          V  EN++     Y++ + +    N   YP    +A +   ++L   + + Q    + + V   TS N    +      D  R                         D   + +L   GV          E+ L     +     +    +  PE GEY L I+A    E +  T + +Y++       P PG+   ++ F
Sbjct:  226 TDREKAFAIYRWLTFNVAYDVDGF-FGRSEKKSTSAEDVLSSRTSVCAGYASLYTALGEAAGLEIHNVSGYAKGYGHKLGQRF--EGVNHAWNVLKVDNTWYVSDATWGAGFVG------DDMLFTKNPNTYRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSAKPSCEMLEMGIELESHKDYAYETPTDTIDMT--FYCPGRKMLLMGKVKTSSGQALEGRERVRLRFKGLH-----QIEMRAQFPNAGTYKVEVYV---------VKGENSWNHGVSYEVTASQGCGWNCGGYPKV-SNALYDHGFTLEKPLENIQTDDGRAEVVFQCTSTNFSHLISRMTREDGGRFPYVHPRFFEWGVKLVSPCENIYSTDGKAVVELELPGVSSVSGYLKRREETLHSCTMVTGDGERKLIQVHTPEKGEYELNIFAKRTGE-EKNTFLLRYIIHATQGTGPNPGFPVLSNAF 670          

HSP 2 Score: 84.3445 bits (207), Expect = 2.753e-16
Identity = 69/297 (23.23%), Postives = 122/297 (41.08%), Query Frame = 1
Query: 3499 ETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNF----DNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIY 4377
            E S   +++D+H     +    + NQL   L      + + EK   I+ WL     + ++        K  S E++L    +  + YA ++  L   AGL    + GYAKG  +  G +F+G    H+WN + ++  W + D  W A   +G +          + + FL  P + I+ H P +  WQ L  +I+   FE  A       +  ++L +HK+   +T     ++    P G +  L+     S     E    V L   G  +++          + P  G+YK+ +Y
Sbjct:  190 ERSGFEREIDKHVQNTPASATASINQLSDYLTEC--FSTDREKAFAIYRWLTFNVAYDVDGFFGRSEKKSTSAEDVLSSRTSVCAGYASLYTALGEAAGLEIHNVSGYAKGYGHKLGQRFEGVN--HAWNVLKVDNTWYVSDATWGAG-FVGDDML---FTKNPNTYRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSAKPSCEMLEMGIELESHKDYAYETPTDTIDMTFYCP-GRKMLLMGKVKTSSGQALEGRERVRLRFKGLHQIEMR-------AQFPNAGTYKVEVY 470          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 168.703 bits (426), Expect = 4.857e-42
Identity = 162/674 (24.04%), Postives = 288/674 (42.73%), Query Frame = 1
Query: 3502 TSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYA--RNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLS-----FNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPI-ESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPY---EPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEM------CSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDV 5451
            +S++F ++D   ++   + ++     +  ++++  R   +EL+++R I++WLC    H + +D       + K  S EE++   R    +Y+ + L +CR  G+ C+ + G++KG  Y  G   +    +H WNAVL+ G W L+D  W A R +  EH  E+     D FYFL +P + I +HFP +  WQLL   I +E+FE      S FF   L L+   +  I T+  E  + I F         FT+ ++      + G+ +  E S   +G   L   +      +  P  GSY   ++A+         E  S  +   +C + ++      +A+   P     ++G   +     + +    +    +D G  ++     +P + V+ +L    ++ +  L ++C L   I  D  + +V  P  G Y L V+  D +K+   F     + +       V  +  L P  LG       + +  GLS +SH    +    G   I     RD         +HC+ +  E        S   L    D+ V   I LP  G ++  ++A      GE  P + ++++  N  +     FP  +  W++GC L+EP  G+L       ++ FR+ V  A  ++VV        L KS   +W G+V
Sbjct:  171 SSEVFHRIDSRVIRTGLELKERHVYDVKTIVHSITRESRNELDRLRAIWVWLC----HNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNSDHLWNAVLLGGQWFLLDACWGAGR-VDMEH--ESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTT----FTYEITQHRDLLHCGALEQKESSSSSFGI--LTVSHRSMNLQLLPPATGSYDCKVFAR--------HEKASTPLVW-VCSFTVEC--LAPRAMEVIPENPYLSWGMQPVAASLGVADCSQSREVAEVDKGVFDLVLKTSRP-LMVLCELVHPQMEAA--LAKRC-LATQIQPDILLCHVLCPFPGFYRLSVFVRDYEKSELKFQNAANFLL--HCKGKVFHVDELFPPNLGSACGPGTRTAQAGLSKFSHNASVVSTQQGKCNITFHNQRDLE-------LHCTLSRDESKAPAVPLSRHLLCTYTDTKVTVSISLPEVGVYRLGLYA-RVGPGGEFSP-MCDFVLR-NSCALPGPPFPCLYSAWRKGCVLFEPRAGLL---DPLSRVHFRVRVPGALRVSVVGETRTDLTLNKSR--VWEGEV 799          

HSP 2 Score: 134.035 bits (336), Expect = 4.246e-31
Identity = 86/328 (26.22%), Postives = 158/328 (48.17%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIR----VSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFA-----NSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDE------SKDQFEGVSLRYYVLQETVNNQ-INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAAC 1044
            +  ++    VF ++D   IR    + +      K ++  +  R   ++L++ R I+ W+  C   + D +     +   +  EEV+ + + +  SY++    MC   G+ C  + G +KGV Y+ G   +    +H WN + L   W L+DA W    +       +S V ++DDFYF+ +P++ + SHFPE+ +WQLL+ P+ L  FE      S FF  G+   + HH  + + DG   +++GF  P +FTY++          + +Q E  S  + +L  TV+++ +N     P  G +   +FA+   + + P+    +F   C
Sbjct:  165 RKDLFSSSEVFHRIDSRVIRTGLELKERHVYDVKTIVHSIT-RESRNELDRLRAIWVWL--CHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNSDHLWNAVLLGGQWFLLDACWGAGRV---DMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSSSSFGIL--TVSHRSMNLQLLPPATGSYDCKVFARH-EKASTPLVWVCSFTVEC 483          
BLAST of Kyphoscoliosis peptidase vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 160.229 bits (404), Expect = 2.319e-39
Identity = 163/676 (24.11%), Postives = 278/676 (41.12%), Query Frame = 1
Query: 3502 TSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYA--RNITDELEKVRVIFLWLCTKDLHKMNFD-------NIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLS-----FNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDI---RVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPY---EPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEM------CSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDV 5451
            +S++F ++D   ++   + ++     +  ++++  R   +EL+++R I++WLC    H + +D       + K  S EE++   R    +Y+ + L +CR  G+ C+ + G++KG  Y  G   +    +H WNAVL+ G W L+D  W A R +  EH  E+     D FYFL +P + I +HFP +  WQLL   I +E+FE      S FF   L L+   +  I T+  E  + I F         FT+ ++      + G+ +  E S   +G   L   +      +  P  GSY   ++A+         E  S  +   +C + ++                     P  M        E +  + Y+  G   V   +   D    R +A++          L ++C L   I  D  + +V  P  G Y L V+  D +K+   F     + +       V  +  L P  LG       + +  GLS +SH    +    G   I     RD         +HC+ +  E        S   L    D+ V   I LP  G ++  ++A      GE  P + ++++  N  +     FP  +  W++GC L+EP  G+L       ++ FR+ V  A  ++VV        L KS   +W G+V
Sbjct:  171 SSEVFHRIDSRVIRTGLELKERHVYDVKTIVHSITRESRNELDRLRAIWVWLC----HNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNSDHLWNAVLLGGQWFLLDACWGAGR-VDMEH--ESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTT----FTYEITQHRDLLHCGALEQKESSSSSFGI--LTVSHRSMNLQLLPPATGSYDCKVFAR--------HEKASTPLVW-VCSFTVE------------------CLAPRAM--------EVIPENPYLSWGMQPVAASLGVADCSQSREVAEM-------EAALAKRC-LATQIQPDILLCHVLCPFPGFYRLSVFVRDYEKSELKFQNAANFLL--HCKGKVFHVDELFPPNLGSACGPGTRTAQAGLSKFSHNASVVSTQQGKCNITFHNQRDLE-------LHCTLSRDESKAPAVPLSRHLLCTYTDTKVTVSISLPEVGVYRLGLYAR-VGPGGEFSP-MCDFVLR-NSCALPGPPFPCLYSAWRKGCVLFEPRAGLL---DPLSRVHFRVRVPGALRVSVVGETRTDLTLNKSR--VWEGEV 773          

HSP 2 Score: 134.035 bits (336), Expect = 3.464e-31
Identity = 86/328 (26.22%), Postives = 158/328 (48.17%), Query Frame = 1
Query:  109 KHQVYDDPYVFEKVDGHAIR----VSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFA-----NSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDE------SKDQFEGVSLRYYVLQETVNNQ-INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAAC 1044
            +  ++    VF ++D   IR    + +      K ++  +  R   ++L++ R I+ W+  C   + D +     +   +  EEV+ + + +  SY++    MC   G+ C  + G +KGV Y+ G   +    +H WN + L   W L+DA W    +       +S V ++DDFYF+ +P++ + SHFPE+ +WQLL+ P+ L  FE      S FF  G+   + HH  + + DG   +++GF  P +FTY++          + +Q E  S  + +L  TV+++ +N     P  G +   +FA+   + + P+    +F   C
Sbjct:  165 RKDLFSSSEVFHRIDSRVIRTGLELKERHVYDVKTIVHSIT-RESRNELDRLRAIWVWL--CHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRHVNSDHLWNAVLLGGQWFLLDACWGAGRV---DMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSSSSFGIL--TVSHRSMNLQLLPPATGSYDCKVFARH-EKASTPLVWVCSFTVEC 483          
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Match: SMESG000061907.1 (SMESG000061907.1)

HSP 1 Score: 3736.04 bits (9687), Expect = 0.000e+0
Identity = 1822/1845 (98.75%), Postives = 1823/1845 (98.81%), Query Frame = 1
Query:   28 MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKPQASVFGPIKPGSKPLSHKPSKIRDMYNYEKDATPLGSLPKPYMPSQYAPEDITLVSIDKVSNRHTYVSSANKMIPGQAKSKPMPFAYQQNKNAATKADDSDLEMPDFXXXXXXXXTNQTISAEYESSVSVAXXXXXXNTLSNNSFNEDKINQFDPKNQRSFQSDKKSYQPGNQQMNTGDKFNAGQKNLNFSIQGATPFSKSNVSGPNNFTSGPVDGSKFSQKSNSPSYKGETLDNDSAKLQPYLANVEKGQSPQLSRKVFGSNVPTSGKDQLGSEYSLSGSKHSPTVNADKTPISARYSSSIDKTERQNLSELNMVSSAFGKSDSITVQQPYLQNILSGGSPGLSRKVMQKPVESNQGKGFNMSTSSDPKTATDRFPRESESLINESKSTPAFRGYGRPNFKSGSAAEVSQGAILSQSQFQQPPNQGDSFISSGSNIKDNSASNQQYSKDHSFATGSPNIQYQNPSSTSAGATNPGSYNNQYQMPSNFSTGSAMQGSGSNQYPFAKGFEKDRQYQAGQDPKNNQCPNVSISSVNTQKDPKVLNQQSNFRDQESKFSNTYTVNTSKEFGNNRNDPKKISNIAVTLSPSGFKNPYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQ 5562
            MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDE+KDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKPQASVFGPIKPGSKPLSHKPSKIRDMYNYEKDATPLGSLPKPYMPSQYAPEDIT                   MIPGQAKSKPMPFAYQQNKNAATKADDSDLEMPDFLPPPPPLLTNQTISAEYESSVSVAPPPPPPNTLSNNSFNEDKINQFDPKNQRSFQSDKKSYQPGNQQMNTGDKFNAGQKNLNFSIQGATPFSKSNVSGPNNFTSGPVDGSKFSQKSNSPSYKGETLDNDSAKLQPYLANVEKGQSPQLSRKVFGSNVPTSGKDQLGSEYSLSGSKHSPTVNADKTPISARYSSSIDKTERQNLSELNMVSSAFGKSDSITVQQPYLQNILSGGSPGLSRKVMQKPVESNQGKGFNMSTSSDPKT  DRFPRESESLINESKSTPAFRGYGRPNFKSGSAAEVSQGAILSQSQFQQPPNQGDSFISSGSNIKDNSASNQQYSKDHSFATGSPNIQYQNPSSTSAGATNPGSYNNQYQMPSNFSTGSAMQGSGSNQYPFAKGFEKDRQYQAGQDPKNNQCPNVSISSVNTQKDPKVLNQQSNFRDQESKFSNTYTVNTSKEFGNNRNDPKKISNIAVTLSPSGFKNPYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIW GDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQ
Sbjct:    1 MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQNSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDENKDQFEGVSLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKPQASVFGPIKPGSKPLSHKPSKIRDMYNYEKDATPLGSLPKPYMPSQYAPEDIT-------------------MIPGQAKSKPMPFAYQQNKNAATKADDSDLEMPDFLPPPPPLLTNQTISAEYESSVSVAPPPPPPNTLSNNSFNEDKINQFDPKNQRSFQSDKKSYQPGNQQMNTGDKFNAGQKNLNFSIQGATPFSKSNVSGPNNFTSGPVDGSKFSQKSNSPSYKGETLDNDSAKLQPYLANVEKGQSPQLSRKVFGSNVPTSGKDQLGSEYSLSGSKHSPTVNADKTPISARYSSSIDKTERQNLSELNMVSSAFGKSDSITVQQPYLQNILSGGSPGLSRKVMQKPVESNQGKGFNMSTSSDPKTVADRFPRESESLINESKSTPAFRGYGRPNFKSGSAAEVSQGAILSQSQFQQPPNQGDSFISSGSNIKDNSASNQQYSKDHSFATGSPNIQYQNPSSTSAGATNPGSYNNQYQMPSNFSTGSAMQGSGSNQYPFAKGFEKDRQYQAGQDPKNNQCPNVSISSVNTQKDPKVLNQQSNFRDQESKFSNTYTVNTSKEFGNNRNDPKKISNIAVTLSPSGFKNPYKLDLSDQYNNQYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNSDQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTGDICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRLPHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSSDGIWTGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQ 1826          
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Match: SMESG000080370.1 (SMESG000080370.1)

HSP 1 Score: 463.381 bits (1191), Expect = 3.297e-142
Identity = 293/794 (36.90%), Postives = 430/794 (54.16%), Query Frame = 1
Query: 3346 ESTANWASGP--MQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARN---ITDELEKVRVIFLWLCTKDLHKMNF--DNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQG-RQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNF-----------HL-KQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPD----IRVMAKLFSCNVKNSDQLTEQCVLQRLIGN----DEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTAS-IVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFI-----VANTG----DICIQLKTTRDKPIRIMAQLIHCSHNVSEM-CSDQFLQ---LGRDSV--VYFLIRLPHQG-FFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQ------YNVG---FPQQFGQWKEGCYLYEPTNGVLGFNGKPDKIT-FRMDVMRAKSLAVVDNDNNWTHLEK---SSDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKY 5553
            E T N  + P  +  +PP++F  KP +L E++ K E+  L +E+P++   +  E     +++DE A+ +      +F  LI+ LIY R      +E +KV  +F WL TK+LH++ F  +    DSPE +L+GI TGK+ YAQ+F  LCRY GL CKLI GYAKG DY PGMK  G ++ +H+WNAV ++ VW L DCHWAARRL+GK    + ++Y+LD+FYF+ NP+QL YTHFP + DWQL    I +EEFE L  VK  FFKYNL+L +H  AV++    +  L I  P  + E++  TFTL+     E Y   +L RYG QE +          R P  GSYKLL+YA+              ++FG ICEY++++             H+ ++ + P+PP Q S+YG  EM  QY +      +S  + +G   + F     +     R+M +L S   ++S  ++   +LQR        D+ II  FLP+AGEY LE+YAN+ +K G+SF+ +WQ FI +   S +  GLP + PG     +P+F ++GL+  SH DP+I     V  TG    D+ + +       I+++ QL+  S    E   SD  LQ   L    +  V F IR+P  G F+K  I+  P +   E+LP VF+YLI   Q         Y  G   +P Q  QWK+ C LY+P N  +  N   + I  F + +  A  +AVV    NW  L +   S D IW G+V   +    P  ++++VC  +  E+  +Y+TIL+Y
Sbjct:   43 EETKNEETVPDLLYPDPPEDF--KP-DLVEQVGK-EVIPLENEIPSEDDYNIPE-----KRLDELAITIGKHSFSSFIPLIYHLIYNRTDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD-KLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAR----------EYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSR--LLQRNTYEKNIIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVPYYGSGEGPYPYQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGENWNQLSRENESDDVIWTGNVKFDS--STPADSKITVCACYN-ESITSYSTILEY 811          

HSP 2 Score: 214.542 bits (545), Expect = 4.405e-57
Identity = 145/477 (30.40%), Postives = 234/477 (49.06%), Query Frame = 1
Query:  142 EKVDGHAIRVSQNSYPTFKDLLWDLAFR----YQLSDLEKARVIFRWMTACDMNKLDFAN-SHP-NGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPG-DVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGY---LKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQET--VNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKI-------ISDKAAANHS------PYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITS--------PNNKPFVKTEIVFDKLR----EDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPS-EGDTYTHICQYLLDFE 1458
            +++D  AI + ++S+ +F  L++ L +      + ++ +K   +F W+T  ++++L F++ +H  + PE VLL +   K +YA  F+ +C Y GL C  I G+AKGVDYKPG  +    E  H WN + + N W L D HWA R L       D I Y  D FYF+  P Q  Y+HFP + +WQL +K +TL +FE+L L K  FFK  ++  S    V+  +D     +K+ +   +    T+ L  +   + +EG +L  Y +QET          FRFP +G + L ++A+E  +          F   CEY++        ++K    H       PYP T   +++G +  +   Y L    E+  I +T          +NK       +  +L+    ED  L+ +L +    +++I+DQ+I +A           LP+ GEY LEIYAN P  EG ++  I Q  +  E
Sbjct:   93 KRLDELAITIGKHSFSSFIPLIYHLIYNRTDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQ--------IFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPT-QQSSYGKT-EMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNIIDQFIILA----------FLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTE 549          
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 348.977 bits (894), Expect = 1.020e-101
Identity = 254/839 (30.27%), Postives = 425/839 (50.66%), Query Frame = 1
Query: 3289 QYEDSSKIVPSPFQKYRPDESTANWASGPMQKEPPKNFEAKPIELEE--EIYKPEI--QALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYAR-NITDELEKVRVIFLWLCTKDLHKMNFDNIKQ---------DSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQ-GRQGEHSWNAVLIEGVWRLIDCHWAARRLIGK-EHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKG-IEERLLFTFTL-SFNDGSEKYNEVSLLRYGRQEL---DFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQA--LPPFPPCQSSTYGPNEMYKQYPIESE-NVQSSFYIDNGTVEVKFL-IKKPDI----RVMAKLFSCNVKNSDQLTEQCVLQRLIG------------NDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVAN------TGDICIQL---------KTTRDKP-IRIMAQLIHCS-------HNVSEMCSDQFLQLGRDSV--VYFLIRLPHQG-FFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNV-------GFPQQFGQWKEGCYLYEPTNGVLGF-----NGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKS--SDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQ 5562
            + E S+   P P +    D  T + ++G   K P  +  AK I   E  + +K  +  +   +E+P   +I     S   +  D  A+ +  ++   F  L++QLI+   ++  +L+K R +F WL   +  + +FD I +         +SP   L G+ TG+ TYAQ F  LCR+AG+ CKL+ GYAKG D+ PGMK + G+  +H+WN+V I G W L D HW ARRL G+  ++ +    +LD+FYFL +P  + Y+HFP D  WQL+ + I++E FE LA VK  FF++ L       A+++TN  + ++ + FP     E++ FT+T  +     + + ++ L R+G  E+   D   +   F IR P  GSYK++I+AK +            ++F  +CEY I ++   +Q   + PFPP Q + YG  E+  +Y I+S  N ++   +++   E++F   K+ D     R+MA+L  CN  +  +L+++ +L R+I              +E  I  +LP+  EY LE+YAN+ +  G+SF+ +WQ+ IV     +   +P L  G++   + +F + GL   S+ DP I  N        D+ I+L          ++  KP IRI+ QL+  S       ++ S +   Q      +S+  V F+IRL  +  F+K  I+A+   +  +++P    YLI+ + +  Y+         FPQQ  QWKE C L  P N +L       +GK ++I F + + +A  +A V  D  W    +S   +  W G + + +  K    + L++  NF    ++ Y  +L+Y+IQ
Sbjct:   39 KLETSTNSNPHPTESVNEDH-TDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNN-DIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV----------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARL-KCNSIDDSELSKK-LLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEI-FEVIIPQAMKVASVI-DEEWFQFSESKEEESKWIGSMSLNSSMK--SGSLLTIFANFNSRYNS-YIPLLEYLIQ 858          

HSP 2 Score: 189.119 bits (479), Expect = 1.488e-48
Identity = 148/487 (30.39%), Postives = 230/487 (47.23%), Query Frame = 1
Query:  151 DGHAIRVSQNSYPTFKDLLWDLAFR--YQLSDLEKARVIFRWMTACDMN---------KLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEF-NHTWNVIHLQNSWQLIDAHWATRYLTSGKNT----QDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS-----FTYKLQTD-ESKDQFEGVSLRYYVLQETVNNQ-----INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHS---PYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKT------EIVFDKL-REDVS----LLCKLRKNGVDDEDILDQYI--EIAEKPNKTSFSIS----------LPEPGEYGLEIYANEP-SEGDTYTHICQYLL 1449
            D  A+ + Q    TF+ L++ L        +DL+KAR +F W+T  +           + DF N     P   L  L   + +YA  F+ +C +AG+ C  + G+AKG D+KPG   +  +   H WN + +  +W L D HW  R L +G+N+    Q+S   Q D FYF++ P    YSHFP    WQL+  P++L  FE L + K  FF+  + F +Q   +V + +  +K+ L F   DS     FTY  QT+ ++ D F+ + L  + L E V        + F+ RFP +G + + IFA+          ++  F   CEY II+D +        P+P T     +G +  L+S Y           +I S  N   +KT      EI F    R D +    L+ +L+ N +DD ++  + +   IA   +K    +S          LP+  EY LEIYAN P +EG ++  I Q+L+
Sbjct:  121 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL-AGRNSNQGKQNST--QLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNND-IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK--------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPT-QQTCYGKT-ELLSKY-----------NIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLI 582          
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 348.977 bits (894), Expect = 1.022e-97
Identity = 249/821 (30.33%), Postives = 419/821 (51.04%), Query Frame = 1
Query: 3343 DESTANWASGPMQKEPPKNFEAKPIELEE--EIYKPEI--QALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYAR-NITDELEKVRVIFLWLCTKDLHKMNFDNIKQ---------DSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQ-GRQGEHSWNAVLIEGVWRLIDCHWAARRLIGK-EHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKG-IEERLLFTFTL-SFNDGSEKYNEVSLLRYGRQEL---DFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQA--LPPFPPCQSSTYGPNEMYKQYPIESE-NVQSSFYIDNGTVEVKFL-IKKPDI----RVMAKLFSCNVKNSDQLTEQCVLQRLIG------------NDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVAN------TGDICIQL---------KTTRDKP-IRIMAQLIHCS-------HNVSEMCSDQFLQLGRDSV--VYFLIRLPHQG-FFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNV-------GFPQQFGQWKEGCYLYEPTNGVLGF-----NGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKS--SDGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQ 5562
            ++ T + ++G   K P  +  AK I   E  + +K  +  +   +E+P   +I     S   +  D  A+ +  ++   F  L++QLI+   ++  +L+K R +F WL   +  + +FD I +         +SP   L G+ TG+ TYAQ F  LCR+AG+ CKL+ GYAKG D+ PGMK + G+  +H+WN+V I G W L D HW ARRL G+  ++ +    +LD+FYFL +P  + Y+HFP D  WQL+ + I++E FE LA VK  FF++ L       A+++TN  + ++ + FP     E++ FT+T  +     + + ++ L R+G  E+   D   +   F IR P  GSYK++I+AK +            ++F  +CEY I ++   +Q   + PFPP Q + YG  E+  +Y I+S  N ++   +++   E++F   K+ D     R+MA+L  CN  +  +L+++ +L R+I              +E  I  +LP+  EY LE+YAN+ +  G+SF+ +WQ+ IV     +   +P L  G++   + +F + GL   S+ DP I  N        D+ I+L          ++  KP IRI+ QL+  S       ++ S +   Q      +S+  V F+IRL  +  F+K  I+A+   +  +++P    YLI+ + +  Y+         FPQQ  QWKE C L  P N +L       +GK ++I F + + +A  +A V  D  W    +S   +  W G + + +  K    + L++  NF    ++ Y  +L+Y+IQ
Sbjct:  682 NDHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESIEQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNN-DIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAV----------EDQLFSGVCEYYIIADISTEQTEKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARL-KCNSIDDSELSKK-LLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVCKAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVNQCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHLKGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEI-FEVIIPQAMKVASVI-DEEWFQFSESKEEESKWIGSMSLNSSMK--SGSLLTIFANFNSRYNS-YIPLLEYLIQ 1484          

HSP 2 Score: 188.734 bits (478), Expect = 1.150e-47
Identity = 148/487 (30.39%), Postives = 230/487 (47.23%), Query Frame = 1
Query:  151 DGHAIRVSQNSYPTFKDLLWDLAFR--YQLSDLEKARVIFRWMTACDMN---------KLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEF-NHTWNVIHLQNSWQLIDAHWATRYLTSGKNT----QDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDS-----FTYKLQTD-ESKDQFEGVSLRYYVLQETVNNQ-----INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHS---PYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKT------EIVFDKL-REDVS----LLCKLRKNGVDDEDILDQYI--EIAEKPNKTSFSIS----------LPEPGEYGLEIYANEP-SEGDTYTHICQYLL 1449
            D  A+ + Q    TF+ L++ L        +DL+KAR +F W+T  +           + DF N     P   L  L   + +YA  F+ +C +AG+ C  + G+AKG D+KPG   +  +   H WN + +  +W L D HW  R L +G+N+    Q+S   Q D FYF++ P    YSHFP    WQL+  P++L  FE L + K  FF+  + F +Q   +V + +  +K+ L F   DS     FTY  QT+ ++ D F+ + L  + L E V        + F+ RFP +G + + IFA+          ++  F   CEY II+D +        P+P T     +G +  L+S Y           +I S  N   +KT      EI F    R D +    L+ +L+ N +DD ++  + +   IA   +K    +S          LP+  EY LEIYAN P +EG ++  I Q+L+
Sbjct:  747 DPVALNLCQKKIVTFETLVFQLIHENPSVKTDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRL-AGRNSNQGKQNST--QLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNND-IKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAK--------AVEDQLFSGVCEYYIIADISTEQTEKVKPFPPT-QQTCYGKT-ELLSKY-----------NIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLI 1208          
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Match: SMESG000070325.1 (SMESG000070325.1)

HSP 1 Score: 166.392 bits (420), Expect = 4.048e-43
Identity = 129/452 (28.54%), Postives = 206/452 (45.58%), Query Frame = 1
Query:  235 SDLEKARVIFRWMTACDMNKLDFANSHPNGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTS-------GKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFK---CGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQT-DESKDQFEGV-----SLRYYVLQETVNNQINFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAANHSPYPMTCHDANWGPSWSLISHYQLTP-QQEDGVISITSPNNKPFVKTEIVFDKLREDVSLLCKLRK---------------------NG------VDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPSEGDTYTHICQYLLDFE 1458
            ++++K   IF W++  D     F N      E     +         AFEF+C   G+ C+TISG A+ +DY P     K   NHTWN + + N+W L D  W++  +            +Q+S    + + YF+M P     +HFP +  +QLL K +T + FE+ PL  + FF+     +D++S     + S+ G+ K+ L +    SF + L+  DE             S++ + L E     I  +FRFP  G ++LT   Q+  E +  + +   ++A  ++KI   K   +   +   C D N GPSW  +++Y L P     G++ I      P    E  F KL  +V ++ K+R                      NG      +DDED         +  ++ + +I LP+ GEY LEIYAN P EGDT+  + QY+LD +
Sbjct:   62 ANIDKVASIFYWLSFIDKKNAQFPNVLFGSLESKFNIIIQSICWKPAAFEFLCRCIGISCMTISGIARTMDYVPNKNSIKTS-NHTWNSVFINNAWHLSDILWSSEVIMKTFTGIILSTESQESDQRIFSNQYFLMPPIIFQTTHFPNEQTFQLLSKTITFDHFESYPLFTNHFFESPLASLDYKSYS---MISQKGHFKLILPYNGNSSFFHFLEYYDEKTKTIIIKTKHNQSIKSFSLIEITKENIIIYFRFPLEGNYFLTFCIQDELEDSPSIMK---YKALLKWKIQCLKTTDSIEGF-YGCRDMNLGPSWFHMNYYGLLPINLTTGIVKIEF---SPPAYIEACFRKLNPEVMVIAKVRGAAAMLPSNYSSDIPSQWNSQCNGECLDWLIDDED---------DSESEITITIRLPKYGEYSLEIYANFPQEGDTFVQVAQYILDLK 493          

HSP 2 Score: 101.679 bits (252), Expect = 9.272e-22
Identity = 113/464 (24.35%), Postives = 191/464 (41.16%), Query Frame = 1
Query: 3568 FNQLIWQLIYARNITDELEKVRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAA----RRLIGKEHKPENVRYELDMF---YFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDG----------SEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGPNEMYKQY----PIE-SENVQSSFYIDNGTVEVKFLIKKPDIRVMAKL----------FSCNVKNSDQLTEQC---VLQRLIGND-----EAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFI 4839
            FN LI       + +  ++KV  IF WL   D     F N+   S E     I          F  LCR  G+ C  I G A+  DYVP  K   +   H+WN+V I   W L D  W++    +   G     E+   +  +F   YFL  P     THFP++  +QLL  +I  + FES     + FF+  L  + +K+  + +    F+L + +         F F   +++           ++     SL+   ++ +           R P+ G+Y L        ++  ++++ S   + A+ ++KI        ++  F  C+    GP+  +  Y    PI  +  +    +     +E  F    P++ V+AK+          +S ++ +  Q   QC    L  LI ++     E  I + LP  GEY LE+YAN  ++ G++F  V QY +
Sbjct:   53 FNSLI------NDCSANIDKVASIFYWLSFIDKKNAQFPNVLFGSLESKFNIIIQSICWKPAAFEFLCRCIGISCMTISGIARTMDYVPN-KNSIKTSNHTWNSVFINNAWHLSDILWSSEVIMKTFTGIILSTESQESDQRIFSNQYFLMPPIIFQTTHFPNEQTFQLLSKTITFDHFESYPLFTNHFFESPLASLDYKSYSMISQKGHFKLILPYNGN---SSFFHFLEYYDEKTKTIIIKTKHNQSIKSFSLIEITKENI-------IIYFRFPLEGNYFL-----TFCIQDELEDSPSIMKYKALLKWKIQC-LKTTDSIEGFYGCRDMNLGPSWFHMNYYGLLPINLTTGIVKIEFSPPAYIEACFRKLNPEVMVIAKVRGAAAMLPSNYSSDIPS--QWNSQCNGECLDWLIDDEDDSESEITITIRLPKYGEYSLEIYANFPQE-GDTFVQVAQYIL 490          
The following BLAST results are available for this feature:
BLAST of Kyphoscoliosis peptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
KY1.708e-3726.80kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY2.386e-3726.80kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY3.880e-1833.10kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ltd-11.287e-6030.39Lim and Transglutaminase Domain [Source:UniProtKB... [more]
ltd-19.215e-5930.39Lim and Transglutaminase Domain [Source:UniProtKB... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hil1.252e-7531.45gene:FBgn0050147 transcript:FBtr0086255[more]
Hil1.252e-7531.45gene:FBgn0050147 transcript:FBtr0086256[more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky1.266e-3223.43kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
ky2.658e-2730.70kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnpy15.080e-3628.38canopy FGF signaling regulator 1 [Source:Xenbase;A... [more]
lmbr13.679e-3428.02limb development membrane protein 1 [Source:Xenbas... [more]
ENSXETT00000026111.13.518e-1823.63kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
ENSXETT00000026106.14.339e-1633.99kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ky2.790e-3927.58kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q0E908|HIL_DROME1.255e-7431.45Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil... [more]
sp|Q8C8H8|KY_MOUSE2.042e-3827.58Kyphoscoliosis peptidase OS=Mus musculus OX=10090 ... [more]
sp|Q8NBH2|KY_HUMAN1.978e-3627.03Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 G... [more]
sp|O14302|CYK3_SCHPO2.615e-1025.38cytokinesis protein 3 OS=Schizosaccharomyces pombe... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7F7Z99.424e-7157.16Kyphoscoliosis peptidase OS=Clonorchis sinensis OX... [more]
H2KPM45.108e-7357.16Kyphoscoliosis peptidase OS=Clonorchis sinensis OX... [more]
A0A1S8WJI32.416e-7357.03TGc domain-containing protein (Fragment) OS=Opisth... [more]
A0A4E0RXE96.403e-7455.92Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A095ADX61.793e-9856.49Kyphoscoliosis peptidase OS=Schistosoma haematobiu... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000040397.15.268e-4325.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032424.12.157e-4226.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ky4.163e-3525.59uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ky4.163e-3525.59uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009155.11.160e-2435.88pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400371.467e-2423.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326099.014e-2122.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky4.857e-4224.04kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
ky2.319e-3924.11kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Kyphoscoliosis peptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061907.10.000e+098.75SMESG000061907.1[more]
SMESG000080370.13.297e-14236.90SMESG000080370.1[more]
SMESG000073008.11.020e-10130.27SMESG000073008.1[more]
SMESG000073008.11.022e-9730.33SMESG000073008.1[more]
SMESG000070325.14.048e-4328.54SMESG000070325.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034849 ID=SMED30034849|Name=Kyphoscoliosis peptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=5803bp
CTATATAAATCTTATATGATTTTTTAAATGCTCGCACCTTCAAGTTTCGT
TCTACCAGAACCCGTAAAAAATATTTCAGTGCCTCCCCCATGTCCTCCGT
CGTATTTAAAGCATCAAGTATACGATGATCCATATGTTTTCGAAAAAGTT
GATGGCCATGCTATTAGAGTATCTCAAAATAGCTACCCAACCTTTAAAGA
CTTATTGTGGGACCTAGCGTTCAGATATCAATTATCCGATTTAGAAAAAG
CTCGGGTTATTTTTCGTTGGATGACTGCTTGTGATATGAACAAATTGGAT
TTTGCCAATTCTCATCCAAATGGTCCAGAAGAAGTTTTATTGTCATTGAA
AAATTTAAAAGGATCTTATGCAAATGCTTTTGAATTTATGTGCAGCTACG
CTGGACTCTGCTGTTTGACAATAAGCGGGTTTGCTAAAGGAGTTGATTAC
AAGCCCGGGGACGTGTTTAAGAAAGATGAATTCAATCACACATGGAATGT
AATTCATTTACAAAACTCTTGGCAGTTAATTGACGCACATTGGGCAACTA
GATACTTGACATCTGGAAAAAACACCCAAGACTCAATAGTTTATCAATAT
GATGATTTCTATTTCATTATGGAACCGCAGCAAGCTGTTTACAGTCATTT
CCCGGAAAAAACCGAATGGCAATTACTAGAAAAGCCTTTGACATTGAATC
AATTTGAGAATTTGCCATTGACTAAATCTCAATTTTTCAAATGTGGCATG
GATTTTCGTTCACAGCACCACGGAGTGGTTCATTCTAAGGATGGTTACTT
GAAAATGAATTTAGGATTTTGGAAGCCGGATAGTTTTACCTATAAGTTAC
AAACTGATGAAAGTAAAGATCAATTTGAAGGGGTTTCTTTGAGGTATTAC
GTTCTCCAAGAAACAGTCAATAATCAAATAAATTTTTTCTTTCGTTTTCC
GACAGCCGGAGTATTTTATTTGACAATTTTCGCACAGGAATTAAATGAAC
ATAATCAACCAGTAACTCAAGAAAACACATTTCGAGCAGCGTGTGAATAC
AAAATTATCTCAGACAAAGCAGCAGCAAATCATTCACCATATCCCATGAC
TTGTCACGACGCAAATTGGGGTCCATCGTGGTCATTAATCAGTCATTATC
AATTAACTCCTCAACAAGAAGATGGAGTCATATCGATTACATCTCCCAAT
AACAAACCGTTTGTAAAAACTGAAATCGTATTTGATAAACTTCGTGAAGA
TGTCAGTTTACTTTGTAAACTTCGTAAAAACGGTGTCGATGACGAGGATA
TTCTTGATCAATACATTGAAATTGCGGAAAAACCAAACAAAACATCATTT
TCAATCAGCTTGCCGGAACCAGGTGAATATGGCTTGGAAATTTATGCCAA
CGAACCATCGGAAGGCGATACATATACACATATTTGCCAATATTTATTGG
ATTTTGAGCCACCACCTGGTTATAAACCGCAGGCATCAGTATTTGGGCCT
ATAAAACCTGGTAGTAAACCATTGTCGCATAAACCGTCTAAAATTCGTGA
CATGTACAACTATGAGAAAGATGCAACTCCTCTTGGAAGTTTACCTAAGC
CATATATGCCATCTCAATATGCTCCAGAGGATATTACGTTAGTGTCAATA
GATAAAGTTTCGAATAGGCATACTTATGTTAGCAGTGCGAATAAAATGAT
ACCCGGACAAGCTAAATCAAAACCAATGCCTTTTGCATATCAACAAAACA
AAAACGCTGCTACCAAAGCCGATGATTCCGATTTAGAAATGCCCGATTTT
TTACCACCGCCACCACCGCTTTTGACAAATCAAACGATATCGGCGGAATA
TGAAAGCAGCGTGAGTGTTGCTCCTCCACCGCCACCACCGAATACCTTGT
CAAACAACTCATTTAATGAGGATAAAATCAATCAATTTGATCCAAAAAAT
CAGCGTTCATTTCAGTCGGACAAGAAATCATATCAACCTGGAAACCAACA
AATGAATACCGGAGATAAATTTAATGCCGGACAGAAAAATTTGAATTTCT
CAATTCAAGGTGCTACACCGTTTTCAAAATCGAACGTTTCGGGTCCAAAC
AATTTTACAAGTGGCCCTGTCGACGGATCAAAATTTTCACAAAAATCCAA
TTCGCCAAGTTATAAAGGCGAAACACTGGATAATGACTCTGCAAAGTTAC
AGCCGTATCTAGCCAACGTTGAGAAAGGTCAATCTCCTCAATTATCTAGG
AAAGTTTTTGGTAGCAATGTACCTACAAGTGGCAAGGATCAATTAGGTTC
CGAATATTCGTTGAGTGGTTCCAAACATTCACCAACTGTAAATGCTGATA
AAACCCCTATATCTGCACGATATTCATCATCAATAGACAAAACTGAGAGG
CAAAATTTATCTGAACTCAATATGGTTTCATCAGCGTTTGGAAAGTCGGA
CAGTATTACTGTTCAACAGCCATATTTACAAAATATTTTAAGTGGTGGAT
CTCCTGGGTTATCTCGAAAGGTTATGCAGAAGCCAGTCGAATCGAATCAA
GGTAAAGGATTCAATATGTCTACAAGTTCTGACCCTAAAACAGCTACCGA
TCGTTTCCCACGAGAATCAGAATCTTTAATTAATGAGTCTAAATCAACGC
CTGCGTTTCGGGGATATGGTCGGCCAAACTTCAAATCTGGCAGCGCTGCT
GAAGTTTCACAAGGAGCAATTTTGAGTCAATCTCAATTTCAACAACCACC
AAACCAAGGAGACTCTTTTATTTCAAGTGGATCAAATATCAAAGATAATT
CAGCTTCTAATCAACAATATTCCAAGGATCATTCTTTTGCGACTGGTTCT
CCTAACATTCAATATCAAAATCCATCATCAACATCTGCAGGAGCTACCAA
TCCAGGATCATACAACAATCAATACCAAATGCCTTCCAATTTCTCTACCG
GCTCTGCCATGCAAGGATCCGGATCAAATCAATATCCATTTGCTAAAGGT
TTTGAAAAGGATCGTCAATACCAAGCTGGTCAAGATCCCAAAAACAATCA
ATGTCCGAATGTTTCCATATCTTCAGTCAATACCCAAAAAGATCCAAAGG
TTTTAAATCAGCAATCAAATTTTAGAGATCAAGAATCTAAATTCTCGAAT
ACTTACACTGTTAATACCTCGAAGGAATTTGGCAATAATAGAAATGATCC
CAAAAAGATTTCCAATATTGCAGTTACGCTTTCGCCTTCTGGATTTAAAA
ATCCTTACAAATTGGATTTATCAGATCAGTACAATAATCAATACGAAGAC
TCATCTAAAATAGTTCCATCGCCTTTTCAAAAGTATCGACCAGATGAGAG
CACTGCTAATTGGGCATCGGGTCCAATGCAAAAAGAACCACCAAAGAATT
TTGAGGCAAAACCAATAGAATTGGAGGAAGAAATTTACAAGCCAGAAATT
CAAGCACTTCCTTCAGAAATGCCTACTAAAGTCGCAATCAGTCCTGAAGA
AACTTCTAAAATATTTCAAAAAGTTGATGAACATGCAATGCAAGTCTCTT
CTCAGCAACAAGATAACTTCAATCAGTTGATTTGGCAATTGATATACGCA
CGTAACATCACTGATGAATTAGAAAAAGTGCGAGTTATATTCCTCTGGTT
ATGCACTAAGGATTTGCATAAAATGAATTTCGATAATATCAAGCAAGATT
CTCCCGAAGAGATTCTAATGGGCATTAGAACTGGAAAAAGCACTTACGCT
CAAATATTCTTAACATTATGCAGATATGCCGGACTGCATTGCAAACTGAT
TGTAGGATATGCCAAAGGTGCTGATTACGTTCCCGGAATGAAATTCCAAG
GAAGGCAAGGTGAACATTCCTGGAATGCTGTACTGATTGAGGGTGTATGG
CGATTAATTGATTGTCACTGGGCGGCACGACGGTTAATTGGGAAAGAACA
TAAACCAGAAAATGTTCGATATGAGTTGGATATGTTTTATTTTTTAGCAA
ATCCGAGTCAGTTGATTTACACACATTTCCCCCATGACAACGATTGGCAA
CTTTTACATCATTCTATTAATATAGAGGAATTTGAATCACTAGCGCCTGT
GAAGTCAATGTTTTTCAAATATAATTTAGATTTGGTAACCCACAAAAATG
CAGTTATTCAGACTAATGCTCCAGAATTTGAATTAAGAATTGCCTTTCCT
AAAGGAATTGAAGAAAGACTTTTGTTTACTTTCACTTTGTCGTTTAATGA
CGGATCTGAAAAATATAATGAAGTATCTTTATTGCGTTATGGTAGACAGG
AATTGGATTTCATCAACAATCACAGCTGTTTCTGTATCAGGACTCCAATA
CCCGGTTCTTATAAATTGTTGATTTACGCAAAATTGATCAATGTTGAACC
AAATGTTCAAGAAAACGATTCACAGAAAATGTTTGGTGCAATATGTGAAT
ATAAAATTGATTCTAATTTCCATTTGAAACAAGCTTTGCCTCCATTCCCA
CCATGTCAGAGTTCAACATACGGACCGAATGAGATGTACAAACAATATCC
AATTGAATCAGAAAATGTTCAGTCTTCATTCTACATTGATAACGGTACAG
TGGAGGTTAAATTCCTTATTAAGAAACCTGATATCCGCGTTATGGCAAAG
CTGTTTAGTTGCAACGTAAAAAATAGTGACCAATTAACTGAACAGTGTGT
TTTACAACGACTGATTGGGAATGATGAAGCTATCATCAATGTTTTCCTCC
CCAATGCTGGAGAATATGGTCTTGAAGTATATGCTAACGATTCAAAGAAA
AACGGAAACTCATTCTATGCTGTTTGGCAATATTTTATTGTTTCATCTAC
TGCATCAATCGTTAGTGGATTGCCGTCCTTGCAGCCTGGATATCTGGGTC
CGTATGAACCTAAATTCAGTGATTATGGGTTGTCAACATACAGTCATAAA
GACCCATTCATTGTTGCTAATACGGGAGATATATGTATCCAATTAAAAAC
CACTAGAGATAAACCAATTCGTATTATGGCACAATTGATTCATTGCAGCC
ATAATGTATCAGAAATGTGCTCAGATCAATTTTTACAACTTGGTCGAGAT
TCGGTTGTTTACTTTCTAATCAGATTGCCACATCAAGGTTTCTTTAAGTT
TCAAATATTTGCTTTGCCGTATTCAGAAATGGGCGAATCATTGCCTGGTG
TTTTTAATTATCTGATTGAAGGAAATCAGTCATCTCAGTATAATGTCGGA
TTCCCTCAACAATTCGGTCAATGGAAAGAAGGATGCTACTTGTATGAGCC
GACGAATGGAGTTCTTGGATTCAATGGTAAACCAGACAAAATAACATTTC
GCATGGATGTAATGCGAGCCAAATCGCTGGCTGTTGTTGATAATGATAAC
AATTGGACTCATCTAGAAAAGAGTAGCGATGGAATCTGGAATGGAGATGT
TGATATGAGGAACATTTGGAAAAAGCCTGGTAAAAATGAACTCTCAGTTT
GTGGCAACTTCGGAATGGAGGCTGATGCTAATTATGCGACGATTTTAAAA
TACGTAATCCAAAATTGATTTTTCAATTTTATTTTTCTTGATATTTTTTT
GTATTCTGTGCCAAAATCGTTTGAGTGAAATGAAAAATTCAGTTGACAAT
GATTTCATATCGATAGCACGCTTTTGTCTATGATAATTGATCCATAACTT
TATACACGTAGTTCTGAATTTATTAACTGATTTTTTTAATTATTATCATT
GACTATAATTTTTTATGTAATCATGTTTCTAATAAAATATTTTCAAAAAA
AAA
back to top

protein sequence of SMED30034849-orf-1

>SMED30034849-orf-1 ID=SMED30034849-orf-1|Name=SMED30034849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1847bp
MLAPSSFVLPEPVKNISVPPPCPPSYLKHQVYDDPYVFEKVDGHAIRVSQ
NSYPTFKDLLWDLAFRYQLSDLEKARVIFRWMTACDMNKLDFANSHPNGP
EEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPGDVFKKD
EFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEP
QQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGV
VHSKDGYLKMNLGFWKPDSFTYKLQTDESKDQFEGVSLRYYVLQETVNNQ
INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKIISDKAAA
NHSPYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITSPNNKPFVKTEI
VFDKLREDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGE
YGLEIYANEPSEGDTYTHICQYLLDFEPPPGYKPQASVFGPIKPGSKPLS
HKPSKIRDMYNYEKDATPLGSLPKPYMPSQYAPEDITLVSIDKVSNRHTY
VSSANKMIPGQAKSKPMPFAYQQNKNAATKADDSDLEMPDFLPPPPPLLT
NQTISAEYESSVSVAPPPPPPNTLSNNSFNEDKINQFDPKNQRSFQSDKK
SYQPGNQQMNTGDKFNAGQKNLNFSIQGATPFSKSNVSGPNNFTSGPVDG
SKFSQKSNSPSYKGETLDNDSAKLQPYLANVEKGQSPQLSRKVFGSNVPT
SGKDQLGSEYSLSGSKHSPTVNADKTPISARYSSSIDKTERQNLSELNMV
SSAFGKSDSITVQQPYLQNILSGGSPGLSRKVMQKPVESNQGKGFNMSTS
SDPKTATDRFPRESESLINESKSTPAFRGYGRPNFKSGSAAEVSQGAILS
QSQFQQPPNQGDSFISSGSNIKDNSASNQQYSKDHSFATGSPNIQYQNPS
STSAGATNPGSYNNQYQMPSNFSTGSAMQGSGSNQYPFAKGFEKDRQYQA
GQDPKNNQCPNVSISSVNTQKDPKVLNQQSNFRDQESKFSNTYTVNTSKE
FGNNRNDPKKISNIAVTLSPSGFKNPYKLDLSDQYNNQYEDSSKIVPSPF
QKYRPDESTANWASGPMQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPT
KVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARNITDELEK
VRVIFLWLCTKDLHKMNFDNIKQDSPEEILMGIRTGKSTYAQIFLTLCRY
AGLHCKLIVGYAKGADYVPGMKFQGRQGEHSWNAVLIEGVWRLIDCHWAA
RRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIE
EFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLF
TFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIY
AKLINVEPNVQENDSQKMFGAICEYKIDSNFHLKQALPPFPPCQSSTYGP
NEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPDIRVMAKLFSCNVKNS
DQLTEQCVLQRLIGNDEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVW
QYFIVSSTASIVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFIVANTG
DICIQLKTTRDKPIRIMAQLIHCSHNVSEMCSDQFLQLGRDSVVYFLIRL
PHQGFFKFQIFALPYSEMGESLPGVFNYLIEGNQSSQYNVGFPQQFGQWK
EGCYLYEPTNGVLGFNGKPDKITFRMDVMRAKSLAVVDNDNNWTHLEKSS
DGIWNGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKYVIQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR002931Transglutaminase-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0030018Z disc
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007517muscle organ development
GO:0007528neuromuscular junction development
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002931Transglutaminase-likeSMARTSM00460TG_5coord: 106..172
e-value: 0.018
score: 20.2
coord: 1230..1298
e-value: 1.1E-4
score: 31.5
IPR002931Transglutaminase-likePFAMPF01841Transglut_corecoord: 1192..1291
e-value: 3.9E-6
score: 27.3
NoneNo IPR availableGENE3DG3DSA:3.10.620.30coord: 1145..1306
e-value: 7.3E-8
score: 33.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 732..776
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 696..718
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1001..1035
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 997..1035
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 837..855
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 837..882
NoneNo IPR availablePANTHERPTHR47020FAMILY NOT NAMEDcoord: 894..1841
coord: 4..475
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 58..175
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 1170..1304