Protein kinase

Overview
NameProtein kinase
Smed IDSMED30034836
Length (bp)2268
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30034836) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30034836) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30034836) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30034836) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034836

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v4_2745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v4_2745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v4_2745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v6_2745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v6_2745_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074965.1 SMESG000074956.1 Contig16231newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074965.1 SMESG000074956.1 Contig16231newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074965.1 SMESG000074956.1 Contig16231uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074965.1 SMESG000074956.1 Contig16231uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v4_2745_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30034836SMESG000075057.1 SMESG000074969.1 SMESG000074956.1 dd_Smed_v4_2745_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 83.5741 bits (205), Expect = 3.370e-16
Identity = 65/224 (29.02%), Postives = 105/224 (46.88%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDE---SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            H +F Q+    H     S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   98 HLKFQQMEVLLHSRKLGSKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLVGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 310          
BLAST of Protein kinase vs. Ensembl Human
Match: MYLK3 (myosin light chain kinase 3 [Source:HGNC Symbol;Acc:HGNC:29826])

HSP 1 Score: 82.8037 bits (203), Expect = 6.879e-16
Identity = 62/211 (29.38%), Postives = 105/211 (49.76%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFN-QTDYLHIENID-NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND--KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            +SH   IQL DAF  +    LVME V G  L   I +EK Y L E ++  +T+QI EG+ Y+HQ  I+++DL P +I       H +K+ +F     Y   E +  NF         ++++PE++  E      D+WS+G I   +    + +  ++D E +  ++N       D  +G+S+E K+F+   L+ + + R S       E++
Sbjct:  226 LSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEK-YHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNF------GTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWL 429          
BLAST of Protein kinase vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 80.8777 bits (198), Expect = 1.007e-15
Identity = 61/210 (29.05%), Postives = 100/210 (47.62%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   16 SKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLVGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 211          
BLAST of Protein kinase vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 81.2629 bits (199), Expect = 1.462e-15
Identity = 61/210 (29.05%), Postives = 100/210 (47.62%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLVGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Human
Match: STK26 (serine/threonine kinase 26 [Source:HGNC Symbol;Acc:HGNC:18174])

HSP 1 Score: 80.8777 bits (198), Expect = 1.506e-15
Identity = 61/207 (29.47%), Postives = 99/207 (47.83%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLVGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 75.485 bits (184), Expect = 8.823e-15
Identity = 55/207 (26.57%), Postives = 102/207 (49.28%), Query Frame = 3
Query: 1605 DESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            D   + +VM+ + G  L   +   +   L E +I+   ++ L+ L ++H+  I++ D+   ++ +  N  VKLT+      +        +         ++SPEI+ K++Y  K D+WSLG + +++   E  Y R++  + + ++  N    IK  D+ +S E   F+D CL+ D + RA T  L    F++K + PL  LI  I
Sbjct:   66 DADDLWVVMDYLEGGNLTDVVVKTE---LDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQ----PGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDR-LSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKKAK-PLSSLIPYI 263          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 76.2554 bits (186), Expect = 4.889e-14
Identity = 58/199 (29.15%), Postives = 100/199 (50.25%), Query Frame = 3
Query: 1596 AFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKG--MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRK 2183
            +F   S + ++ME + G    S ++  K+  L E  I+   ++IL+GLEY+H    I+ D+   ++ +  + +VK+ +F     L  E +     F       +++PE+I++  Y  KAD+WSLG   +++   E   P  SD   M  + L  KN     +G   SK  KEF+++CL  D   R S + L   +FI++
Sbjct:   98 SFLKGSKLWIIMEYLGG---GSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQL-TETVKKRITFV--GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGE---PPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKR 287          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 75.8702 bits (185), Expect = 5.362e-14
Identity = 58/199 (29.15%), Postives = 100/199 (50.25%), Query Frame = 3
Query: 1596 AFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKG--MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRK 2183
            +F   S + ++ME + G    S ++  K+  L E  I+   ++IL+GLEY+H    I+ D+   ++ +  + +VK+ +F     L  E +     F       +++PE+I++  Y  KAD+WSLG   +++   E   P  SD   M  + L  KN     +G   SK  KEF+++CL  D   R S + L   +FI++
Sbjct:   78 SFLKGSKLWIIMEYLGG---GSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQL-TETVKKRITFV--GSPFWMAPELIKQSSYDYKADIWSLGITAIELANGE---PPHSDLHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIKR 267          
BLAST of Protein kinase vs. Ensembl Celegans
Match: aak-1 (5'-AMP-activated protein kinase catalytic subunit alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:P45894])

HSP 1 Score: 75.8702 bits (185), Expect = 5.432e-14
Identity = 54/208 (25.96%), Postives = 97/208 (46.63%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEY-GVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYN-DKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            ++H    +L       S + LVME V G  L S+I  +   P+ E    ++ +QI+ G+ Y H   I++ DL P ++ +D N N+K+ +F  ++Y+   ++ +    + N    Y +PE+I  + Y G + D+WS G IL  +      +    D+ +  +    K+ +Y     M K+  + I   L  D   RA    + N  + R
Sbjct:   79 LTHPHITRLFRVISTPSDIFLVMELVSGGELFSYITRKGALPIRESR--RYFQQIISGVSYCHNHMIVHRDLKPENLLLDANKNIKIADFGLSNYMTDGDLLSTACGSPN----YAAPELISNKLYVGPEVDLWSCGVILYAMLCGTLPF---DDQNVPTLFAKIKSGRYTVPYSMEKQAADLISTMLQVDPVKRADVKRIVNHSWFR 277          
BLAST of Protein kinase vs. Ensembl Celegans
Match: aak-1 (5'-AMP-activated protein kinase catalytic subunit alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:P45894])

HSP 1 Score: 75.8702 bits (185), Expect = 5.432e-14
Identity = 54/208 (25.96%), Postives = 97/208 (46.63%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEY-GVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYN-DKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            ++H    +L       S + LVME V G  L S+I  +   P+ E    ++ +QI+ G+ Y H   I++ DL P ++ +D N N+K+ +F  ++Y+   ++ +    + N    Y +PE+I  + Y G + D+WS G IL  +      +    D+ +  +    K+ +Y     M K+  + I   L  D   RA    + N  + R
Sbjct:   79 LTHPHITRLFRVISTPSDIFLVMELVSGGELFSYITRKGALPIRESR--RYFQQIISGVSYCHNHMIVHRDLKPENLLLDANKNIKIADFGLSNYMTDGDLLSTACGSPN----YAAPELISNKLYVGPEVDLWSCGVILYAMLCGTLPF---DDQNVPTLFAKIKSGRYTVPYSMEKQAADLISTMLQVDPVKRADVKRIVNHSWFR 277          
BLAST of Protein kinase vs. Ensembl Fly
Match: Dsor1 (gene:FBgn0010269 transcript:FBtr0071313)

HSP 1 Score: 74.3294 bits (181), Expect = 9.842e-14
Identity = 57/225 (25.33%), Postives = 106/225 (47.11%), Query Frame = 3
Query: 1596 AFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIH-QFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKI---------------------HKRETLYPRKSDR-----EMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            AF+ +  + + ME + G +L+  ++     P  E  + + T  +L+GL Y+     II+ D+ P +I ++ +  +K+ +F  +  L I+++ N   F       Y+SPE ++   Y V++D+WSLG  LV++                     +  E+  P    R     E+++ ++N    K   K  S E K+F+D+CL    + RA    L +  +IRK +
Sbjct:  151 AFYSDGEISICMEYMDGGSLDLILKRAGRIP--ESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQL-IDSMAN--SFVGTRS--YMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAE 368          
BLAST of Protein kinase vs. Ensembl Fly
Match: Dsor1 (gene:FBgn0010269 transcript:FBtr0340120)

HSP 1 Score: 74.3294 bits (181), Expect = 1.019e-13
Identity = 57/225 (25.33%), Postives = 106/225 (47.11%), Query Frame = 3
Query: 1596 AFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIH-QFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKI---------------------HKRETLYPRKSDR-----EMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            AF+ +  + + ME + G +L+  ++     P  E  + + T  +L+GL Y+     II+ D+ P +I ++ +  +K+ +F  +  L I+++ N   F       Y+SPE ++   Y V++D+WSLG  LV++                     +  E+  P    R     E+++ ++N    K   K  S E K+F+D+CL    + RA    L +  +IRK +
Sbjct:  148 AFYSDGEISICMEYMDGGSLDLILKRAGRIP--ESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQL-IDSMAN--SFVGTRS--YMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAE 365          
BLAST of Protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334540)

HSP 1 Score: 75.485 bits (184), Expect = 1.041e-13
Identity = 55/220 (25.00%), Postives = 110/220 (50.00%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLIF 2222
            H   +   D++     + +VME + G +L   +       + E +I+   +++L+ LE++H   +I+ D+   +I +  + +VKLT+F     +  E               +++PE++ +++YG K D+WSLG + +++ + E  Y  ++  + + ++  N    IK  DK +S   ++F+D CL  +V+ RAS   L    F++  + PL  L  LI 
Sbjct:  620 HPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC---MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP---YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDK-LSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLAR-PLASLTPLIM 831          
BLAST of Protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334542)

HSP 1 Score: 75.485 bits (184), Expect = 1.041e-13
Identity = 55/220 (25.00%), Postives = 110/220 (50.00%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLIF 2222
            H   +   D++     + +VME + G +L   +       + E +I+   +++L+ LE++H   +I+ D+   +I +  + +VKLT+F     +  E               +++PE++ +++YG K D+WSLG + +++ + E  Y  ++  + + ++  N    IK  DK +S   ++F+D CL  +V+ RAS   L    F++  + PL  L  LI 
Sbjct:  620 HPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC---MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP---YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDK-LSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLAR-PLASLTPLIM 831          
BLAST of Protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334543)

HSP 1 Score: 75.485 bits (184), Expect = 1.041e-13
Identity = 55/220 (25.00%), Postives = 110/220 (50.00%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLIF 2222
            H   +   D++     + +VME + G +L   +       + E +I+   +++L+ LE++H   +I+ D+   +I +  + +VKLT+F     +  E               +++PE++ +++YG K D+WSLG + +++ + E  Y  ++  + + ++  N    IK  DK +S   ++F+D CL  +V+ RAS   L    F++  + PL  L  LI 
Sbjct:  620 HPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC---MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP---YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDK-LSSAFQDFLDQCLEVEVDRRASALDLLKHPFLKLAR-PLASLTPLIM 831          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: stk26 (serine/threonine protein kinase 26 [Source:ZFIN;Acc:ZDB-GENE-080516-5])

HSP 1 Score: 85.8853 bits (211), Expect = 2.519e-17
Identity = 64/205 (31.22%), Postives = 101/205 (49.27%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLN-NKNIKYNDKG-MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  EY+I+   K+IL+GL+Y+H    I+ D+   ++ +  +  VKL +F     L    I   E F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++ +  KN      G  SK  KEF+D CL  D   R +   L   +FI KY     YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDEYQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKR-ETFV--GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFHIPKNTPPTLNGDFSKIFKEFVDSCLNKDPAFRPTAKELLKHKFIVKYAKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: stk25b (serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-GENE-040426-2537])

HSP 1 Score: 82.0333 bits (201), Expect = 2.817e-16
Identity = 63/201 (31.34%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  K  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:    4 IIMEYLGG---GSALDLLKPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNTPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELI 195          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: stk25b (serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-GENE-040426-2537])

HSP 1 Score: 82.0333 bits (201), Expect = 5.480e-16
Identity = 63/201 (31.34%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  K  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:   93 IIMEYLGG---GSALDLLKPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNTPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELI 284          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: si:dkey-240h12.4 (si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-406])

HSP 1 Score: 79.7221 bits (195), Expect = 1.779e-15
Identity = 55/203 (27.09%), Postives = 101/203 (49.75%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNH----NVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGMSKE---LKEFIDLCLIGDVNARAST 2150
            + H   + +RD F   + ++L++E + G  L  FI  ++N  L E E  ++ KQILEG+ Y+HQ  + + DL P +I +   H    ++K+ +F    +     I   E  +     +Y++PEII  E  G  AD+WS+G I   +    + +  ++D E +  ++ + N ++     S+     K+FI   L+ D + R + 
Sbjct:   71 LQHQNIMAIRDVFESRAEIVLIVELIKGGELFDFIAEKEN--LTETEAIEFMKQILEGVNYMHQKNVAHFDLKPENIMLSDKHDPHPDIKIIDFGMAHHF----IQGEEYKSLGGTPQYIAPEIINYEPLGTAADMWSIGVITYILLSGLSPFQGETDEETLRNIV-SMNYEFEPHFFSQTTNMAKDFIQKLLVKDQSERMTA 266          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: mylkb (myosin light chain kinase b [Source:ZFIN;Acc:ZDB-GENE-041111-150])

HSP 1 Score: 79.337 bits (194), Expect = 2.935e-15
Identity = 56/212 (26.42%), Postives = 107/212 (50.47%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKG---MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRK 2183
            + H + +Q  DAF  +S +++VME + G  L   I +E ++ L E E+ K+  QI++G+++IH+ GI+++DL P +I         +KL +F     L  E+  + +      E  +V+PE+I  E      D+WS+G I   +    + +   +D E +   + +    + D+    +S + K+FI   L  D+ AR +    F   ++++
Sbjct:    4 LHHPKLVQCMDAFEGKSDMVMVMEMISGGELFERIVDE-DFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLARRL--EDSGSLKVLFGTPE--FVAPEVINYEAISYPTDMWSIGVICYILVSGLSPFMGDNDNETL-ANVTSATWDFEDEAFDEISDQAKDFISRLLKKDMRARLTCAQCFEHSWLKQ 209          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 80.1073 bits (196), Expect = 2.377e-15
Identity = 60/208 (28.85%), Postives = 102/208 (49.04%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  K  PL E  I+   ++IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E  Y   SD   M  + L  KN   + +G  SK  K+F++ CL  D  +R +   L    FI +Y     +L+ L+
Sbjct:   76 SKLWIIMEYLGG---GSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPY---SDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELV 271          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 80.1073 bits (196), Expect = 3.065e-15
Identity = 60/208 (28.85%), Postives = 102/208 (49.04%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  K  PL E  I+   ++IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E  Y   SD   M  + L  KN   + +G  SK  K+F++ CL  D  +R +   L    FI +Y     +L+ L+
Sbjct:   76 SKLWIIMEYLGG---GSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPY---SDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELV 271          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 79.7221 bits (195), Expect = 3.251e-15
Identity = 60/208 (28.85%), Postives = 102/208 (49.04%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  K  PL E  I+   ++IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E  Y   SD   M  + L  KN   + +G  SK  K+F++ CL  D  +R +   L    FI +Y     +L+ L+
Sbjct:   76 SKLWIIMEYLGG---GSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPY---SDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELV 271          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: ULK4 (MGC80314 protein [Source:Xenbase;Acc:XB-GENE-5909791])

HSP 1 Score: 79.7221 bits (195), Expect = 4.080e-15
Identity = 49/184 (26.63%), Postives = 91/184 (49.46%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNF----------EEFAENNEIK-----------YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLN 2051
            I H   +   + +   +H  L++E   G +L + I  + + P  E  +  +   I+ GL YIH+ GI++ DL+P  I +DG   +KLTNF+ +     EN++ F           E  E+   K           Y +PE+I+  ++ + +D+WSLG IL ++   +  +  +S  E++E +++
Sbjct:   53 IRHKNVVTYHEWYETSNHEWLIVELCTGGSLETVIAQDDHLP--EETVRDFAIGIVSGLNYIHKLGILFCDLTPRKILLDGPGTLKLTNFSLSKA-EGENLEEFFAMIGLEESPTEIGESTPRKKQRNRKKGSPVYAAPEVIKGADFSIASDIWSLGCILYEMFSGQPPFFSESFSELIEKIIS 233          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:NCBI gene;Acc:548355])

HSP 1 Score: 79.337 bits (194), Expect = 4.164e-15
Identity = 60/205 (29.27%), Postives = 101/205 (49.27%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  K  PL E  I+   ++IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E  Y   SD   M  + L  KN   + +G  SK  K+F++ CL  D  +R +   L    FI +Y     +L+ L+
Sbjct:   88 SKLWIIMEYLGG---GSALDLLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFVGTP--FWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPY---SDLHPMRVLFLIPKNNPPSLQGQYSKPFKDFVEACLNKDPRSRPTARELLKHRFILRYTKKTSFLVELV 283          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 87.4261 bits (215), Expect = 3.114e-17
Identity = 71/239 (29.71%), Postives = 118/239 (49.37%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFN-QTDYLHIENID-NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND--KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYL---IGLIFKQLLNKHIYQ 2252
            +SH   IQL DAF  +S   L+ME V G  L   I +EK Y L E ++  +T+QI EG+ Y+HQ  I+++DL P +I       H +K+ +F     Y   E +  NF         ++++PE++  E      D+WS+G I   +    + +  ++D E +  ++N       D  KG+S+E K+F+   L+ + + R S       E++     P K     + L  +QLL K++ Q
Sbjct:  480 LSHVNLIQLYDAFESKSSFTLIMEYVDGGELFDRITDEK-YHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNF------GTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHL--PAKASGSNVRLRSQQLLQKYMAQ 709          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 87.0409 bits (214), Expect = 3.392e-17
Identity = 71/239 (29.71%), Postives = 118/239 (49.37%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFN-QTDYLHIENID-NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND--KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYL---IGLIFKQLLNKHIYQ 2252
            +SH   IQL DAF  +S   L+ME V G  L   I +EK Y L E ++  +T+QI EG+ Y+HQ  I+++DL P +I       H +K+ +F     Y   E +  NF         ++++PE++  E      D+WS+G I   +    + +  ++D E +  ++N       D  KG+S+E K+F+   L+ + + R S       E++     P K     + L  +QLL K++ Q
Sbjct:  410 LSHVNLIQLYDAFESKSSFTLIMEYVDGGELFDRITDEK-YHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNF------GTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHL--PAKASGSNVRLRSQQLLQKYMAQ 639          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 86.6557 bits (213), Expect = 4.907e-17
Identity = 71/239 (29.71%), Postives = 118/239 (49.37%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFN-QTDYLHIENID-NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND--KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYL---IGLIFKQLLNKHIYQ 2252
            +SH   IQL DAF  +S   L+ME V G  L   I +EK Y L E ++  +T+QI EG+ Y+HQ  I+++DL P +I       H +K+ +F     Y   E +  NF         ++++PE++  E      D+WS+G I   +    + +  ++D E +  ++N       D  KG+S+E K+F+   L+ + + R S       E++     P K     + L  +QLL K++ Q
Sbjct:  543 LSHVNLIQLYDAFESKSSFTLIMEYVDGGELFDRITDEK-YHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNF------GTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHL--PAKASGSNVRLRSQQLLQKYMAQ 772          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 80.4925 bits (197), Expect = 1.368e-15
Identity = 61/207 (29.47%), Postives = 99/207 (47.83%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLIGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Stk26 (serine/threonine kinase 26 [Source:MGI Symbol;Acc:MGI:1917665])

HSP 1 Score: 80.8777 bits (198), Expect = 1.436e-15
Identity = 61/207 (29.47%), Postives = 99/207 (47.83%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMML----NNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E++I+   K+IL+GL+Y+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++     NN      D   +K  KEFID CL  D + R +   L   +FI K      YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFLIPKNNPPTLIGD--FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELI 288          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q10056|SHK2_SCHPO (Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.937e-18
Identity = 62/228 (27.19%), Postives = 115/228 (50.44%), Query Frame = 3
Query: 1569 HSRFIQLRDAFH-DESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLIFKQLLNKHI 2246
            H   +   D+F   E H+ +VME ++  +L   IE  K   L E +I++   +  +G++++H   II+ D+   ++ +D + N+K+T+F     L   N  N +         +++PE++++ EYG K D+WSLG +++++ + E  Y R+     + ++  N         + SK LK F++ CL  D   RA+   L    F+ +   P + L  +IF +  N HI
Sbjct:  368 HPNIVTYLDSFLVRERHLWVVMEYMNAGSLTDIIEKSK---LTEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKITDFGFCARL--SNRTN-KRVTMVGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPPYLREDPIRALYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELLTHSFLNQAC-PTEDLKSIIFSRKANTHI 588          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P62343|CDPK1_PLAFK (Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) OX=5839 GN=CPK1 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 5.195e-17
Identity = 64/220 (29.09%), Postives = 114/220 (51.82%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNH---NVKLTNFNQTDYLHIENIDNFEEFAENNEIK-------YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNK-NIKYND-KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKY 2186
            + H   I+L D F D+ +  LV E   G  L   I N   +   E + +   KQIL G+ Y+H+  I++ D+ P +I ++  H   N+K+ +F  + +           F+++N+++       Y++PE++RK +Y  K DVWS G IL  +      +  ++D+++++ +   K    +ND K +S+E KE I L L  D N R +     N+++I+KY
Sbjct:  123 LDHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINRHKFD--ECDAANIMKQILSGICYLHKHNIVHRDIKPENILLENKHSLLNIKIVDFGLSSF-----------FSKDNKLRDRLGTAYYIAPEVLRK-KYNEKCDVWSCGVILYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISEEAKELIKLMLTYDYNKRITAKEALNSKWIKKY 328          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|P62344|CDPK1_PLAF7 (Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=CPK1 PE=3 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 5.195e-17
Identity = 64/220 (29.09%), Postives = 114/220 (51.82%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNH---NVKLTNFNQTDYLHIENIDNFEEFAENNEIK-------YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNK-NIKYND-KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKY 2186
            + H   I+L D F D+ +  LV E   G  L   I N   +   E + +   KQIL G+ Y+H+  I++ D+ P +I ++  H   N+K+ +F  + +           F+++N+++       Y++PE++RK +Y  K DVWS G IL  +      +  ++D+++++ +   K    +ND K +S+E KE I L L  D N R +     N+++I+KY
Sbjct:  123 LDHPNIIKLFDVFEDKKYFYLVTEFYEGGELFEQIINRHKFD--ECDAANIMKQILSGICYLHKHNIVHRDIKPENILLENKHSLLNIKIVDFGLSSF-----------FSKDNKLRDRLGTAYYIAPEVLRK-KYNEKCDVWSCGVILYILLCGYPPFGGQNDQDIIKKVEKGKYYFDFNDWKNISEEAKELIKLMLTYDYNKRITAKEALNSKWIKKY 328          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9S7U9|M2K2_ARATH (Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 7.134e-17
Identity = 60/207 (28.99%), Postives = 103/207 (49.76%), Query Frame = 3
Query: 1596 AFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQ-FGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAEN--NEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLY--PRKSDR-----EMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKY 2186
            +F+D   + L++E + G +L  F+++ K  P  +  +S   +Q+L+GL Y+H    II+ DL P ++ I+    VK+T+F  +  +      N    A        Y+SPE I   +YG K+D+WSLG ++++    +  Y  P + +      E++E +++           S EL  FI  CL  D N+R+S   L    F+ KY
Sbjct:  134 SFYDNGAISLILEYMDGGSLADFLKSVKAIP--DSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVM-----TNTAGLANTFVGTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNKY 333          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q6FN53|STE20_CANGA (Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=STE20 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.910e-16
Identity = 52/204 (25.49%), Postives = 107/204 (52.45%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND-KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            HS  +   D++  +  + +VME + G +L   +    +  L E +I    ++ L+GL+++H  G+++ D+   +I +    N+KLT+F    +    N +N +         +++PE++ ++EYG K D+WSLG +++++ + E  Y  ++    + ++  N   K  + + +S  L +F+D CL  D + RA+   L +  FI
Sbjct:  674 HSNIVNFIDSYLAKGDLWIVMEYMEGGSLTDVV---THCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFG---FCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDDPFI 871          
BLAST of Protein kinase vs. TrEMBL
Match: A0A3M7MFA3 (Non-specific serine/threonine protein kinase OS=Pyrenophora seminiperda CCB06 OX=1302712 GN=GMOD_00008989 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.468e-19
Identity = 67/209 (32.06%), Postives = 113/209 (54.07%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVIL--VMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKY-VSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            H   +   DAF  E H  L  VME + G  L   I+N  N  + E +I+    +  +GLEY+H   II+ D+   ++ +DG  NVK+T+F  +  L     +   + A      Y ++PE+++++EYG K D+WSLG + +++ + E  Y  +   + + ++  N    +K  DK +SKELK F+ +CL  DV +RAS   L + +F++
Sbjct:  614 HPNIVNFLDAFLQEEHSELWVVMEFMEGGALTDIIDN--NPSITEDQIATICFETCKGLEYLHNLNIIHRDIKSDNVLLDGRGNVKITDFGFSAKL----TEQRSKRATMVGTPYWMAPEVVKQKEYGNKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPDK-LSKELKAFLSVCLCVDVKSRASAGELISHDFLK 815          
BLAST of Protein kinase vs. TrEMBL
Match: G0S4S4 (Non-specific serine/threonine protein kinase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0023350 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 8.996e-19
Identity = 74/227 (32.60%), Postives = 123/227 (54.19%), Query Frame = 3
Query: 1569 HSRFIQLRDAF--HDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKY-VSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI-FKQL 2231
            H   +   DAF   +E  + +VME + G  L   IEN  N  + E +IS    +  +GLE++H   II+ D+   ++ +D   NVK+T+F     L     +   + A      Y ++PE+++++EYG K D+WSLG + +++ + E  Y  +   + + ++  N   ++K  +K +SKELK F+ +CL  DVN RAS   L N EF+ K+  PL  L  L+ FK++
Sbjct:  622 HPNIVNFLDAFLMDNERELWVVMEYMEGGALTDIIEN--NPVITEEQISTICLETCQGLEHLHSQNIIHRDIKSDNVLLDARGNVKITDFGFCAKL----TEAKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPSLKKPEK-LSKELKAFLSVCLCVDVNYRASAKELLNHEFL-KHGCPLASLADLLAFKRV 840          
BLAST of Protein kinase vs. TrEMBL
Match: A0A317ASU4 (Non-specific serine/threonine protein kinase OS=Pyrenophora tritici-repentis OX=45151 GN=PtrARCrB10_10491 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.423e-19
Identity = 64/212 (30.19%), Postives = 117/212 (55.19%), Query Frame = 3
Query: 1569 HSRFIQLRDAF--HDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEI----KYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            H   +   DAF   ++S + +VME + G  L   I+N  N  + E +I+    +  +GLEY+H   II+ D+   ++ +DG  NVK+T+F  +  L        E+ ++   +     +++PE+++++EYG K D+WSLG + +++ + E  Y  +   + + ++  N    +K  DK +SKELK F+ +CL  DV +RAS   L + +F++
Sbjct: 1121 HPNIVNFLDAFLQEEQSELWVVMEFMEGGALTDIIDN--NPSITEDQIATICFETCKGLEYLHNLNIIHRDIKSDNVLLDGRGNVKITDFGFSAKLT-------EQRSKRATMVGTPYWMAPEVVKQKEYGNKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPDK-LSKELKAFLSVCLCVDVKSRASAGELISHDFLK 1322          
BLAST of Protein kinase vs. TrEMBL
Match: A0A2W1H7R0 (Non-specific serine/threonine protein kinase OS=Pyrenophora tritici-repentis OX=45151 GN=A1F97_01642 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.478e-19
Identity = 64/212 (30.19%), Postives = 117/212 (55.19%), Query Frame = 3
Query: 1569 HSRFIQLRDAF--HDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEI----KYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            H   +   DAF   ++S + +VME + G  L   I+N  N  + E +I+    +  +GLEY+H   II+ D+   ++ +DG  NVK+T+F  +  L        E+ ++   +     +++PE+++++EYG K D+WSLG + +++ + E  Y  +   + + ++  N    +K  DK +SKELK F+ +CL  DV +RAS   L + +F++
Sbjct: 1138 HPNIVNFLDAFLQEEQSELWVVMEFMEGGALTDIIDN--NPSITEDQIATICFETCKGLEYLHNLNIIHRDIKSDNVLLDGRGNVKITDFGFSAKLT-------EQRSKRATMVGTPYWMAPEVVKQKEYGNKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPDK-LSKELKAFLSVCLCVDVKSRASAGELISHDFLK 1339          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5M9LNT7 (Non-specific serine/threonine protein kinase OS=Pyrenophora tritici-repentis OX=45151 GN=PtrV1_01288 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.478e-19
Identity = 64/212 (30.19%), Postives = 117/212 (55.19%), Query Frame = 3
Query: 1569 HSRFIQLRDAF--HDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEI----KYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            H   +   DAF   ++S + +VME + G  L   I+N  N  + E +I+    +  +GLEY+H   II+ D+   ++ +DG  NVK+T+F  +  L        E+ ++   +     +++PE+++++EYG K D+WSLG + +++ + E  Y  +   + + ++  N    +K  DK +SKELK F+ +CL  DV +RAS   L + +F++
Sbjct: 1138 HPNIVNFLDAFLQEEQSELWVVMEFMEGGALTDIIDN--NPSITEDQIATICFETCKGLEYLHNLNIIHRDIKSDNVLLDGRGNVKITDFGFSAKLT-------EQRSKRATMVGTPYWMAPEVVKQKEYGNKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPDK-LSKELKAFLSVCLCVDVKSRASAGELISHDFLK 1339          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 81.2629 bits (199), Expect = 1.022e-15
Identity = 62/205 (30.24%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLN-NKNIKYNDKG-MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E +I+   K+IL+GL+Y+H    I+ D+   ++ +  +  VKL +F     L    I   E F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++ +  KN      G  SK  KEF+D CL  D   R +   L   +FI K      YL  LI
Sbjct:  114 SKLWIIMEYLGG---GSALDLLRAGPFDECQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKR-ETFVGTPF--WMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFHIPKNTPPTLNGDFSKSFKEFVDSCLNKDPTFRPTAKELLKHKFIVKNAKKTSYLTELI 309          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: stk26 (serine/threonine kinase 26 [Source:NCBI gene;Acc:103024322])

HSP 1 Score: 80.4925 bits (197), Expect = 1.211e-15
Identity = 62/205 (30.24%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLN-NKNIKYNDKG-MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            S + ++ME + G    S ++  +  P  E +I+   K+IL+GL+Y+H    I+ D+   ++ +  +  VKL +F     L    I   E F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   + ++ +  KN      G  SK  KEF+D CL  D   R +   L   +FI K      YL  LI
Sbjct:   93 SKLWIIMEYLGG---GSALDLLRAGPFDECQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSESGEVKLADFGVAGQLTDTQIKR-ETFVGTPF--WMAPEVIQQSAYDSKADIWSLGITAIELAKGE---PPNSDMHPMRVLFHIPKNTPPTLNGDFSKSFKEFVDSCLNKDPTFRPTAKELLKHKFIVKNAKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: stk25b (serine/threonine-protein kinase 25-like [Source:NCBI gene;Acc:103039280])

HSP 1 Score: 80.4925 bits (197), Expect = 1.336e-15
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  +  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:   97 IIMEYLGG---GSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFVGTPF--WMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNPPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELI 288          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: stk25b (serine/threonine-protein kinase 25-like [Source:NCBI gene;Acc:103039280])

HSP 1 Score: 80.4925 bits (197), Expect = 1.379e-15
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  +  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:   93 IIMEYLGG---GSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNPPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSYLTELI 284          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 80.8777 bits (198), Expect = 2.844e-15
Identity = 56/212 (26.42%), Postives = 106/212 (50.00%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKG---MSKELKEFIDLCLIGDVNARASTNHLFNTEFIRK 2183
            + H + +Q  DAF  ++ +++V+E + G  L   I +E ++ L E E+ K+  QI++G+ +IH+ GI+++DL P +I         +KL +F     L  EN  + +      E  +V+PE+I  E      D+WS+G I   +    + +   +D E +   + +    + D+    +S E K+FI   L  D+ AR +    F   ++++
Sbjct:  521 LHHPKLVQCVDAFEGKTDIVMVLEMISGGELFERIIDE-DFELTEREVIKYMLQIVDGVSFIHKKGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRL--ENAGSLKVLFGTPE--FVAPEVINYEAISYPTDMWSIGVICYILVSGLSPFMGDNDNETLS-NVTSATWDFEDEAFDEISDEAKDFISNLLKKDMTARLTCEQCFQHPWLKQ 726          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010747.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.010e-15
Identity = 39/139 (28.06%), Postives = 76/139 (54.68%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAIL 1979
            + H   ++L   F D+++V LV+E  +   +  +++  K  P  E ++  + KQ + G+ Y+H  GI++ DL+  ++ +  + N+K+ +F     L +    +F      N   Y+SPEI  +  +G+++DVWSLG +L
Sbjct:   23 LKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLK-AKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPN---YISPEIATRGAHGLESDVWSLGCML 157          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010749.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010749.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.083e-15
Identity = 39/139 (28.06%), Postives = 76/139 (54.68%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAIL 1979
            + H   ++L   F D+++V LV+E  +   +  +++  K  P  E ++  + KQ + G+ Y+H  GI++ DL+  ++ +  + N+K+ +F     L +    +F      N   Y+SPEI  +  +G+++DVWSLG +L
Sbjct:   23 LKHPSVLELYTCFEDQNYVYLVLEMCNNGEVGRYLK-AKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLLTADMNIKIADFGLAAQLRLPEEKHFTMCGTPN---YISPEIATRGAHGLESDVWSLGCML 157          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: plk3 (polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-030131-6134])

HSP 1 Score: 78.1814 bits (191), Expect = 3.397e-15
Identity = 50/207 (24.15%), Postives = 99/207 (47.83%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLG-AILVKIHKRETLYPRKSDREMVEMMLNNKNIKYN-DKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            + H   +Q   +F DE+ + +++E  +G +L   + + K   L E E+  + +Q++ GL Y+HQ G+++ DL   + F+  +  VK+ +      L    +         N   Y++PE++ K  +G +AD+WSLG A+   +  R    P  S  ++       ++ ++N    +S   ++ +   L  D + RAS   L +  F+
Sbjct:   82 LHHRHIVQFISSFKDENFIYIILELCNGQSLAHMLRSRKV--LTETEVKYYLRQLISGLRYLHQCGVVHRDLKLGNFFVTDSMEVKIGDLGLATTLEPPEMRKRTVCGTPN---YLAPEVLNKRGHGPEADIWSLGCAVFTMLAGR----PPFSTSDLANTYACIRSGRFNFPPSLSHAARDLLTSALTPDPDLRASLLDLQSHPFL 279          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 78.1814 bits (191), Expect = 5.817e-15
Identity = 45/140 (32.14%), Postives = 80/140 (57.14%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI--DGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAI 1976
            + H + +Q  DAF  ++ +I+V+E + G  L   I +E ++ L E E  K+ +QI+EG++++H+ GI+++DL P +I       + +K+ +F     L  EN+ N +      E  +V+PE+I  E  G   D+WS+G I
Sbjct: 1446 LHHPKLVQCVDAFESKTDIIMVLELISGGELFERIIDE-DFELTERECIKYMRQIVEGVQFMHRQGIVHLDLKPENIMCLNQTGNRIKIIDFGLARKL--ENVKNLKVMFGTPE--FVAPEVINYEPIGYATDMWSVGVI 1580          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ulk4 (unc-51 like kinase 4 [Source:ZFIN;Acc:ZDB-GENE-100922-243])

HSP 1 Score: 77.7962 bits (190), Expect = 6.521e-15
Identity = 52/207 (25.12%), Postives = 104/207 (50.24%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNF-------------EEFAENNEIK--------YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNN--KNIKYNDKGMSKELKEFIDL 2114
            + H   +Q  + +   +H+ LV+E   G +L++ I  +K+ P  E  + ++   ++ GL +IH+ GII+ DL+P  I +DG  N+KL+N +       EN+  F              E A+ + ++        Y++PE+++ EE+ V +D +SLG +L ++      +  ++  E++E + N      + + +   K   EF++L
Sbjct:   53 VIHENIVQFLEWYETSNHLWLVVELCTGGSLDAVIAQDKHLP--EDVVREFGIDLVSGLLHIHELGIIFSDLTPAKIMLDGPGNLKLSNLSLARA-EGENLQEFFSLVAGEDGDSPDPEAAQGSTLQFRNKGSPVYMAPEVLKGEEFSVASDFFSLGCMLYELFTGTPPFYSENFPELMENIFNEVPATPRVSGENAKKPSPEFVNL 256          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 82.8037 bits (203), Expect = 9.070e-17
Identity = 56/191 (29.32%), Postives = 99/191 (51.83%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEK-----NYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKY-VSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKY-NDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEF 2174
            +VME + G +L   IEN       + PL E +I+   ++  +GL+++H   II+ D+   ++ +D    VK+T+F     L     D   + A      Y ++PE++++ EY  K DVWSLG + +++ + E  Y  +   + + ++  N   K  + + +S E+K F+ +CL  DV  RAST  L +  F
Sbjct:  638 VVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARL----TDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 81.2629 bits (199), Expect = 2.625e-16
Identity = 51/204 (25.00%), Postives = 105/204 (51.47%), Query Frame = 3
Query: 1569 HSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND-KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            H   +   D++  +  + ++ME + G +L   +    +  L E +I    ++ L GLE++H  G+++ D+   +I +    ++KLT+F    +    N  N +         +++PE++ ++EYG K D+WSLG +++++ + E  Y  ++    + ++  N   K  + + +S  LK+F+D CL  +   RAS   L + E+I
Sbjct:  674 HPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVV---THCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFG---FCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYI 871          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 79.337 bits (194), Expect = 8.781e-16
Identity = 55/200 (27.50%), Postives = 106/200 (53.00%), Query Frame = 3
Query: 1605 DESHVILVMENVHGITLNSFIE-------NEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKY-VSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKY-NDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            D+  + ++ME + G  L   ++        E + PL E +++   K+  +GL+++H   II+ D+   +I ++    VK+T+F       +E  +   + A      Y ++PEI+ ++ Y  K DVWSLG +L+++ + E  Y  +   + + ++ NN + K  + + +SK+ K+F+D CL  +V +RAS   L   EF+
Sbjct:  444 DDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFG----FCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFL 639          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 75.0998 bits (183), Expect = 1.588e-14
Identity = 58/215 (26.98%), Postives = 101/215 (46.98%), Query Frame = 3
Query: 1581 IQLRDAFHDE--SHVILVMENVHGITLNSFIEN--EKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDR--------EMVEMMLNN----KNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            +Q    F DE  S + + ME + G +L +  +N  ++   + E  I K  + +L GL Y+H+  +I+ D+ P +I ++    +KL +F  +     E +++           Y++PE I+ + Y V  DVWSLG  L+++      +P +SD+        E++ M+L      K+    D   SK  + FID CL  D   R S   +    +I
Sbjct:  274 VQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSG----EAVNSLAMTFTGTSF-YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGR--FPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWI 481          
BLAST of Protein kinase vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 73.559 bits (179), Expect = 7.713e-14
Identity = 58/211 (27.49%), Postives = 101/211 (47.87%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFID-GNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEY-GVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYN-DKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKY 2186
            ISH+  + L + + ++S + LV+E V G  L  ++ ++   P  E E   + KQI+EG+ Y H F I + DL P ++ +D  N  +K+ +F     +    + N           Y SPEI+    Y G  +DVWS G +L  +      +   +D  + +++L  ++ KY     +S E ++ I   L+ D   R +T  +     I+KY
Sbjct:  171 ISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLP--EREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFG----MAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF---NDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKY 372          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I8])

HSP 1 Score: 82.8037 bits (203), Expect = 3.251e-17
Identity = 56/208 (26.92%), Postives = 99/208 (47.60%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHN--VKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND-KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFI 2177
            + H   +QL+D   DE+H+ L+ME   G  L+ FI +++  P  E    K+ +Q+   L+Y+  + + +MDL P ++ +   HN  +K+ +F     LH     N E         Y++PE+I  + Y    D+WS+G IL +    E  +  K+  E+   + +++ IK      +S + ++ +   L  D   R S    F   FI
Sbjct:   72 LEHEHIVQLKDFQWDENHIFLIMEYCGGGDLSRFIHSKRALP--ERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPVLKIADFGFAQKLH----PNSEASNIRGSPLYMAPEMICCQSYDASVDLWSVGVILYETLFGEPPFKSKTFVELEAKLRSSEPIKLPPGPRVSADCRDLLIALLQRDPKQRISFEAFFTHPFI 273          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 77.411 bits (189), Expect = 1.775e-15
Identity = 46/141 (32.62%), Postives = 76/141 (53.90%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFI---DGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAI 1976
            + H   I L+D F ++SH+ LVM+ V G  L   I  + NY   E + S   +QILE  +Y+H  GI++ DL P ++     D +  + +++F  +    IE   +F + A      YV+PE+++++ YG   D WS+G I
Sbjct:   70 VRHKNIIGLKDIFDNKSHLYLVMDLVQGGELFDRIVEKGNY--TEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLS---KIEAQGSFMDTACGTP-GYVAPEVLKQQPYGKAVDCWSIGVI 204          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 77.0258 bits (188), Expect = 1.627e-14
Identity = 66/273 (24.18%), Postives = 125/273 (45.79%), Query Frame = 3
Query: 1440 KGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND--KGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLIFKQLLNKHIYQ 2252
            +G+  ++ +EV IK   I  + M T                + H   ++L   F D+++V LV+E       N ++  ++ + L E E+ +   Q+++G+ Y+H  GII+ DLS  +I +  + + K+ +F     L + +  ++      N   Y+SPEI  ++ +G+++DVWS+G +L  +   +  +    D E V   LN   +   D    +S E ++ I   L  +   R + + + +  FI       KY      +Q LN   Y+
Sbjct:   29 RGRCLATGQEVAIKM--IDKKAMRTAGMVNRVCNEVEIHCRLKHPSILELYTYFEDDNYVYLVLELAENGEANRYLR-KQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHYTMCGTPN---YISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPF----DTEAVRSTLNKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPFITNQTLNTKY--SSPTRQHLNPRAYE 289          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 73.559 bits (179), Expect = 3.491e-14
Identity = 50/190 (26.32%), Postives = 95/190 (50.00%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLY----PRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            +VME + G TL   + +     L E +++   + +L+ L ++H  G+I+ D+    I +  N  VKL++F     +  E++   +         +++PE+I ++ YG + D+WSLG +++++   E  Y    P ++ R++ ++         N   +S  L+ F+D  LI D   RA+   L N  FIR
Sbjct:  101 VVMEFLEGGTLTDIVTHTN---LSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQV-TEDMPRRKSLVGTP--YWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDL---EPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIR 281          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 73.9442 bits (180), Expect = 5.609e-14
Identity = 57/196 (29.08%), Postives = 96/196 (48.98%), Query Frame = 3
Query: 1611 SHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFN----QTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKG-MSKELKEFIDLCLIGDVNARASTNHLFNTEFIR 2180
            + + ++ME + G    S ++  K   + E+ I+   +++L+GL+Y+H    ++ D+   ++ +    +VKL +F      TD L+  N      F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN      G  SK  KEF+ LCL  D N R +   L    FI+
Sbjct:   80 TKLWIIMEYLGG---GSALDLMKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPF-------WMAPEVIKQSAYDSKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNNPPELTGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFIK 262          
BLAST of Protein kinase vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 81.2629 bits (199), Expect = 8.182e-16
Identity = 62/204 (30.39%), Postives = 98/204 (48.04%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIK---YVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  +  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I        N  +    +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:   93 IIMEYLGG---GSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR------NTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTAYLTELI 284          
BLAST of Protein kinase vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 80.4925 bits (197), Expect = 9.270e-16
Identity = 73/263 (27.76%), Postives = 120/263 (45.63%), Query Frame = 3
Query: 1386 DLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMST-NPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIF----IDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND---KGMSKELKEFIDLCLIGDVNARAST 2150
            DLYEI  ++ S +  +  K + +++      K   I+ +G S         ER    L  + H   + L+D F   S ++LV+E + G  L  FI  + N  L+E E  ++ KQILEGL ++H   I + DL P +I     +    NVKL +F      H       E  + +   +YV+PE+I  E     AD+WS+G I   +    + +   +D E +  ++   + ++ D   K  S   K+FI   L+ D   R + 
Sbjct:   11 DLYEIGEVLGSGHFGQVKKVRERATGTSWAGKFLKIRRKGGSLLGMDRTSVEREVEILQALKHPNIVLLKDVFESRSEMVLVLELISGGELFDFIAEKDN--LLETEAIQFMKQILEGLRFMHSNNIAHFDLKPENIMLSEKVSPQLNVKLIDFGLAYRFH----QGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVV-AVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTA 266          
BLAST of Protein kinase vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 80.4925 bits (197), Expect = 9.270e-16
Identity = 73/263 (27.76%), Postives = 120/263 (45.63%), Query Frame = 3
Query: 1386 DLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMST-NPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIF----IDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYND---KGMSKELKEFIDLCLIGDVNARAST 2150
            DLYEI  ++ S +  +  K + +++      K   I+ +G S         ER    L  + H   + L+D F   S ++LV+E + G  L  FI  + N  L+E E  ++ KQILEGL ++H   I + DL P +I     +    NVKL +F      H       E  + +   +YV+PE+I  E     AD+WS+G I   +    + +   +D E +  ++   + ++ D   K  S   K+FI   L+ D   R + 
Sbjct:   11 DLYEIGEVLGSGHFGQVKKVRERATGTSWAGKFLKIRRKGGSLLGMDRTSVEREVEILQALKHPNIVLLKDVFESRSEMVLVLELISGGELFDFIAEKDN--LLETEAIQFMKQILEGLRFMHSNNIAHFDLKPENIMLSEKVSPQLNVKLIDFGLAYRFH----QGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVV-AVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTA 266          
BLAST of Protein kinase vs. Ensembl Medaka
Match: stk25b (serine/threonine kinase 25 [Source:NCBI gene;Acc:101157729])

HSP 1 Score: 80.8777 bits (198), Expect = 9.467e-16
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 3
Query: 1623 LVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSD-REMVEMMLNNKNIKYNDKGM-SKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ*PLKYLIGLI 2219
            ++ME + G    S ++  +  PL E  I+   ++IL+GLEY+H    I+ D+   ++ +    +VKL +F     L    I     F       +++PE+I++  Y  KAD+WSLG   +++ K E   P  SD   M  + L  KN     +G  SK  KEF++ CL  D   R +   L   +FI +Y     YL  LI
Sbjct:   93 IIMEYLGG---GSALDLLRPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKR-NTFV--GTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGE---PPNSDLHPMRVLFLIPKNTPPTLEGPYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTAYLTELI 284          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000032394.1 (myosin light chain kinase, smooth muscle [Source:NCBI gene;Acc:101169741])

HSP 1 Score: 80.4925 bits (197), Expect = 3.336e-15
Identity = 59/213 (27.70%), Postives = 110/213 (51.64%), Query Frame = 3
Query: 1563 ISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIF-IDGNHN-VKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKG---MSKELKEFIDLCLIGDVNARAST----NHLFNTEF 2174
            + H + +Q   A+   S +++VME + G  L   I ++ N+   E   +++ +QILEG++Y+H+  II++DL P +I  +D N   +K+ +F     L  E  +       +   ++V+PE+I  E  GV+ D+WS+G I   +   E+ +   SD E +  ++   + +++ +    +S E K+FI   L  D  AR S     +H++   F
Sbjct:  506 LHHPKLVQCLAAYEARSGIVMVMEYIEGGELFERIVDD-NFEHTELTSARYMRQILEGMQYMHKQKIIHLDLKPENIVCVDTNGTQIKIIDFG----LAAELDEGKPLMVLHGTPEFVAPEVISYEPVGVETDMWSIGVICYILLSGESPFQGNSDAETL-ALVTAAHYEFDPESFEDISDEAKDFISSLLKKDRRARLSCTEALSHIWMASF 712          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074956.1 (SMESG000074956.1)

HSP 1 Score: 1227.62 bits (3175), Expect = 0.000e+0
Identity = 656/714 (91.88%), Postives = 663/714 (92.86%), Query Frame = 3
Query:   60 MKNIAILIFFLSVLIAHTETPKNTCIIDYPFRKDDFSCDNFEKICVKTDDDVCKNFLSACKQCPPTNYTVIMYQDLLKIKDEILIAKNEIRNLIVKFNKTNLNKEAKLNKILKSGDLIRNVSVTTXXXXXXXXXXXXXXX---KFKSFSKLFRTINKKKYKRVNQENIERQNSQQDSPTASNNDEMKRLIENLKDEMKQTFRNVSAASRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDAXXXXXXXXXXXXXMANFPVPEMVEMKLWQTVGQLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQV-YKTWQTVSVQSLFRDKSQHKFQCCSTETLSELTAKLAEELKCDIKNLSLFMGGEYLQTDDYLYKYNIGADKSIKYGNFAQKPDLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            MKNIAILIFFLSVLIAHTETPKNTCIIDYPFRKDDFSCDNFEKICVKTDDDVCKNFLSACKQCPPTNYTVIMYQDLLKIKDEILIAKNEI NL V FNKTNLNKEAKLNKILKSGDLIRNVSV  IIL  LILIL IL I   +FK  SKLFR I KKKYKRVNQ  IERQNSQQ SP     DEMKRLIENLK           AASRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEMKLWQTVG LKATIS ITGLRKEDLIIVKASKELDNEETVDKCGFTDCDS+QV YKTWQTVSVQSLFRDKSQHKFQCCSTETLSEL AKL +ELKCDIKNLSLFMGGEYLQ DDYLYKYNIGADKSIKY NFAQK DLYEIEPIVNSDYNSRYI+GKVKSSKEE+MIKSYNI TEGMS NPTEWLSERLRLSLLTISHSRFIQL DAF+DESHVILVMENVH ITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIH RETLYPR SDREMV+MMLNN NIKYNDKGMSKELKEFID CLIGDVNARASTNHLFNTEFIRKYQ
Sbjct:    1 MKNIAILIFFLSVLIAHTETPKNTCIIDYPFRKDDFSCDNFEKICVKTDDDVCKNFLSACKQCPPTNYTVIMYQDLLKIKDEILIAKNEILNLTVIFNKTNLNKEAKLNKILKSGDLIRNVSVAIIILHSLILILSILSILEIRFKLISKLFRNITKKKYKRVNQNEIERQNSQQCSPNIL--DEMKRLIENLK-----------AASRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEMKLWQTVGHLKATISGITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSIQVIYKTWQTVSVQSLFRDKSQHKFQCCSTETLSELKAKLVKELKCDIKNLSLFMGGEYLQPDDYLYKYNIGADKSIKYVNFAQKSDLYEIEPIVNSDYNSRYIQGKVKSSKEEIMIKSYNITTEGMSPNPTEWLSERLRLSLLTISHSRFIQLLDAFNDESHVILVMENVHRITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHTRETLYPRISDREMVDMMLNNTNIKYNDKGMSKELKEFIDRCLIGDVNARASTNHLFNTEFIRKYQ 701          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000075057.1 (SMESG000075057.1)

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 533/704 (75.71%), Postives = 570/704 (80.97%), Query Frame = 3
Query:  111 TETPKNTCIIDYPFRKDDFSCDNFEKICVKTDDDVCKNFLSACKQCP----------PTNYTVIMYQDLLKIKDEILIAKNEIRNLIVKFNKTNLNKEAKLNKILKSGDLIRNVSVTTXXXXXXXXXXXXXXXKFKSFSKLFRTINKKKYKRVNQENIERQNSQQDSPTASNNDEMKRLIENLKDEMKQTFRNVSAASRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDAXXXXXXXXXXXXXMANFPVPEMVEMKLWQTVGQLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQV-YKTWQTVSVQSLFRDKSQHKFQCCSTETLSELTAKLAEELKCDIKNLSLFMGGEYLQTDDYLYKYNIGADKSIKYGNFAQKPDLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            TE P   C    PFR++D +C ++++IC   D++ C+     C QCP              T IM Q LLK  +EI   KNE             N+E K  K L+  ++IR +  T                  +   K+   I K+  KRV QEN          P  +N     +LI  + +++KQT +NVSA SRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADR AGGSPNDCK MTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVE+KLWQTVG LKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQV YKTWQTVSVQSLFRDKSQHKFQCCSTETLS+L  KL EELKCDIKNLSLF+GGEYLQTDDYLYKYNIGADKSIKYGNFAQK DLYEIEPIVNSDYN RY KGKVKSSKEE+MIKSYNI TEGM +NPTEWL+ERLRLSLLTISHSRFIQL DAFHDESHVILVMENVH ITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQ DYL  ++I+NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIH RETLYPRKSDREMV+MMLNN NI+YNDKGMSKELK FIDLCLIGDVNARASTNHLFNTEFIRKYQ
Sbjct:    7 TENPLEKCERSQPFRREDSTCADYKEICRNPDNEECQQINLQCIQCPMKENKDETKQNIEKTQIMIQTLLKNNEEIANIKNE-------------NREIK--KTLE--NIIRQIQRTAKANPKNR--------PIQEIQKIVLLIEKQLGKRVGQEN---------EPHTTNLS--IKLILPI-NQLKQTLQNVSAGSRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRKAGGSPNDCKPMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEIKLWQTVGHLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQVIYKTWQTVSVQSLFRDKSQHKFQCCSTETLSDLKKKLVEELKCDIKNLSLFIGGEYLQTDDYLYKYNIGADKSIKYGNFAQKSDLYEIEPIVNSDYNRRYSKGKVKSSKEEIMIKSYNITTEGMRSNPTEWLNERLRLSLLTISHSRFIQLLDAFHDESHVILVMENVHRITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQADYLDKKHIENFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHTRETLYPRKSDREMVDMMLNNTNIEYNDKGMSKELKGFIDLCLIGDVNARASTNHLFNTEFIRKYQ 673          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074969.1 (SMESG000074969.1)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 473/495 (95.56%), Postives = 477/495 (96.36%), Query Frame = 3
Query:  705 MIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDAXXXXXXXXXXXXXMANFPVPEMVEMKLWQTVGQLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQVYKTWQTVSVQSLFRDKSQHKFQCCSTETLSELTAKLAEELKCDIKNLSLFMGGEYLQTDDYLYKYNIGADKSIKYGNFAQKPDLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            MIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAM MKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEMKLWQTV  LKATISDITGLRKEDLIIVKASKELDNEETVDKC FTDCDSVQVYKTWQTVSVQSLFRDKSQHKFQCCSTETLSEL AKLAEELKCDIKNLSLFM GEYLQTDDYLYKYNIGADKSIKYGNFAQK DLYEIEPIVNSDYNSRY KGKVKSSKEEVMIKSYNI TEGMSTNPTEWLSERLRLSLLTISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKW KQILEGLEYIHQFGIIYMDLSPF IFIDGNHNVKLTNFNQTDYL I   +NFEEFAENNEIKYVSPEIIRK+EYGVKADVWSLGAILVKIH RETLYPRKSDREMV+MMLNNKNI+YNDKGMSKELKEFIDLCLIGDVN RASTNHL NTEFIRKYQ
Sbjct:    1 MIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMKMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEMKLWQTVWHLKATISDITGLRKEDLIIVKASKELDNEETVDKCSFTDCDSVQVYKTWQTVSVQSLFRDKSQHKFQCCSTETLSELKAKLAEELKCDIKNLSLFMRGEYLQTDDYLYKYNIGADKSIKYGNFAQKSDLYEIEPIVNSDYNSRYSKGKVKSSKEEVMIKSYNITTEGMSTNPTEWLSERLRLSLLTISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWAKQILEGLEYIHQFGIIYMDLSPFQIFIDGNHNVKLTNFNQTDYLDISRNENFEEFAENNEIKYVSPEIIRKKEYGVKADVWSLGAILVKIHTRETLYPRKSDREMVDMMLNNKNIEYNDKGMSKELKEFIDLCLIGDVNTRASTNHLLNTEFIRKYQ 495          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000075057.1 (SMESG000075057.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 465/496 (93.75%), Postives = 476/496 (95.97%), Query Frame = 3
Query:  705 MIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKAMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDAXXXXXXXXXXXXXMANFPVPEMVEMKLWQTVGQLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQV-YKTWQTVSVQSLFRDKSQHKFQCCSTETLSELTAKLAEELKCDIKNLSLFMGGEYLQTDDYLYKYNIGADKSIKYGNFAQKPDLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLYPRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHLFNTEFIRKYQ 2189
            MIELEVQVHENDNAVKLRRQIADR AGGSPNDCK MTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVE+KLWQTVG LKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQV YKTWQTVSVQSLFRDKSQHKFQCCSTETLS+L  KL EELKCDIKNLSLF+GGEYLQTDDYLYKYNIGADKSIKYGNFAQK DLYEIEPIVNSDYN RY KGKVKSSKEE+MIKSYNI TEGM +NPTEWL+ERLRLSLLTISHSRFIQL DAFHDESHVILVMENVH ITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQ DYL  ++I+NFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIH RETLYPRKSDREMV+MMLNN NI+YNDKGMSKELK FIDLCLIGDVNARASTNHLFNTEFIRKYQ
Sbjct:    1 MIELEVQVHENDNAVKLRRQIADRKAGGSPNDCKPMTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANFPVPEMVEIKLWQTVGHLKATISDITGLRKEDLIIVKASKELDNEETVDKCGFTDCDSVQVIYKTWQTVSVQSLFRDKSQHKFQCCSTETLSDLKKKLVEELKCDIKNLSLFIGGEYLQTDDYLYKYNIGADKSIKYGNFAQKSDLYEIEPIVNSDYNRRYSKGKVKSSKEEIMIKSYNITTEGMRSNPTEWLNERLRLSLLTISHSRFIQLLDAFHDESHVILVMENVHRITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQADYLDKKHIENFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHTRETLYPRKSDREMVDMMLNNTNIEYNDKGMSKELKGFIDLCLIGDVNARASTNHLFNTEFIRKYQ 496          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074965.1 (SMESG000074965.1)

HSP 1 Score: 295.434 bits (755), Expect = 3.499e-95
Identity = 166/200 (83.00%), Postives = 176/200 (88.00%), Query Frame = 3
Query: 1377 QKPDLYEIEPIVNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPXXXXXXXXXXXXXXISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEISKWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIENIDNFEEFAENNEIKYVSPEIIRKEEYGVKA----DVWS 1964
            +K +LYEIEPIV   Y SRYIKGKV SSKEEVMIKSYNIKTEGMSTNPTEWLSERLRLSLLTISHSRFIQLRDAFHDESHVILVMENV+  TLNSFIENEKNYPL+EYEISKWTK+ILEGLEYIHQF IIYMDLSPFHIFID NHNVKL NFN+TDYL     DNF E A+NNEIKY+SP IIRKEEY VKA    D++S
Sbjct:   10 RKLNLYEIEPIVYERYYSRYIKGKVNSSKEEVMIKSYNIKTEGMSTNPTEWLSERLRLSLLTISHSRFIQLRDAFHDESHVILVMENVYRSTLNSFIENEKNYPLIEYEISKWTKEILEGLEYIHQFSIIYMDLSPFHIFIDSNHNVKLENFNRTDYLFTFRNDNFYELAQNNEIKYISPAIIRKEEYVVKAVGISDIYS 209          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK263.370e-1629.02serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
MYLK36.879e-1629.38myosin light chain kinase 3 [Source:HGNC Symbol;Ac... [more]
STK261.007e-1529.05serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK261.462e-1529.05serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
STK261.506e-1529.47serine/threonine kinase 26 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-28.823e-1526.57Serine/threonine-protein kinase max-2 [Source:Uni... [more]
gck-14.889e-1429.15Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-15.362e-1429.15Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
aak-15.432e-1425.965'-AMP-activated protein kinase catalytic subunit ... [more]
aak-15.432e-1425.965'-AMP-activated protein kinase catalytic subunit ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dsor19.842e-1425.33gene:FBgn0010269 transcript:FBtr0071313[more]
Dsor11.019e-1325.33gene:FBgn0010269 transcript:FBtr0340120[more]
Pak1.041e-1325.00gene:FBgn0267698 transcript:FBtr0334540[more]
Pak1.041e-1325.00gene:FBgn0267698 transcript:FBtr0334542[more]
Pak1.041e-1325.00gene:FBgn0267698 transcript:FBtr0334543[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk262.519e-1731.22serine/threonine protein kinase 26 [Source:ZFIN;Ac... [more]
stk25b2.817e-1631.34serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-G... [more]
stk25b5.480e-1631.34serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-240h12.41.779e-1527.09si:dkey-240h12.4 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
mylkb2.935e-1526.42myosin light chain kinase b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk252.377e-1528.85serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk253.065e-1528.85serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
stk253.251e-1528.85serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
ULK44.080e-1526.63MGC80314 protein [Source:Xenbase;Acc:XB-GENE-59097... [more]
stk254.164e-1529.27serine/threonine kinase 25 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mylk33.114e-1729.71myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Mylk33.392e-1729.71myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Mylk34.907e-1729.71myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Stk261.368e-1529.47serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
Stk261.436e-1529.47serine/threonine kinase 26 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10056|SHK2_SCHPO5.937e-1827.19Serine/threonine-protein kinase shk2 OS=Schizosacc... [more]
sp|P62343|CDPK1_PLAFK5.195e-1729.09Calcium-dependent protein kinase 1 OS=Plasmodium f... [more]
sp|P62344|CDPK1_PLAF75.195e-1729.09Calcium-dependent protein kinase 1 OS=Plasmodium f... [more]
sp|Q9S7U9|M2K2_ARATH7.134e-1728.99Mitogen-activated protein kinase kinase 2 OS=Arabi... [more]
sp|Q6FN53|STE20_CANGA2.910e-1625.49Serine/threonine-protein kinase STE20 OS=Candida g... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7MFA38.468e-1932.06Non-specific serine/threonine protein kinase OS=Py... [more]
G0S4S48.996e-1932.60Non-specific serine/threonine protein kinase OS=Ch... [more]
A0A317ASU49.423e-1930.19Non-specific serine/threonine protein kinase OS=Py... [more]
A0A2W1H7R09.478e-1930.19Non-specific serine/threonine protein kinase OS=Py... [more]
A0A5M9LNT79.478e-1930.19Non-specific serine/threonine protein kinase OS=Py... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk261.022e-1530.24serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
stk261.211e-1530.24serine/threonine kinase 26 [Source:NCBI gene;Acc:1... [more]
stk25b1.336e-1530.85serine/threonine-protein kinase 25-like [Source:NC... [more]
stk25b1.379e-1530.85serine/threonine-protein kinase 25-like [Source:NC... [more]
mylka2.844e-1526.42myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010747.11.010e-1528.06pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
ENSPMAT00000010749.11.083e-1528.06pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
plk33.397e-1524.15polo-like kinase 3 (Drosophila) [Source:ZFIN;Acc:Z... [more]
mylka5.817e-1532.14myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
ulk46.521e-1525.12unc-51 like kinase 4 [Source:ZFIN;Acc:ZDB-GENE-100... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CLA49.070e-1729.32Cdc42p-activated signal transducing kinase; member... [more]
STE202.625e-1625.00Cdc42p-activated signal transducing kinase; involv... [more]
SKM18.781e-1627.50Member of the PAK family of serine/threonine prote... [more]
MKK21.588e-1426.98MAPKK involved in the protein kinase C signaling p... [more]
HSL17.713e-1427.49Nim1p-related protein kinase; septin-binding kinas... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413993.251e-1726.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362531.775e-1532.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347071.627e-1424.18Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO458463.491e-1426.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319345.609e-1429.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk25b8.182e-1630.39serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
si:dkey-240h12.49.270e-1627.76death-associated protein kinase 2 [Source:NCBI gen... [more]
si:dkey-240h12.49.270e-1627.76death-associated protein kinase 2 [Source:NCBI gen... [more]
stk25b9.467e-1630.85serine/threonine kinase 25 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000032394.13.336e-1527.70myosin light chain kinase, smooth muscle [Source:N... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074956.10.000e+091.88SMESG000074956.1[more]
SMESG000075057.10.000e+075.71SMESG000075057.1[more]
SMESG000074969.10.000e+095.56SMESG000074969.1[more]
SMESG000075057.10.000e+093.75SMESG000075057.1[more]
SMESG000074965.13.499e-9583.00SMESG000074965.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034836 ID=SMED30034836|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2268bp
GTTATTGCGTATTTTATAATTTGTATATTAAATGTTATGTAGACTGCTAG
TTTCATAAAATGAAAAATATAGCAATACTAATCTTTTTTCTCTCCGTTCT
GATAGCGCACACGGAGACTCCAAAGAATACCTGTATAATTGACTATCCGT
TCCGGAAGGATGATTTTTCGTGTGATAATTTTGAAAAGATTTGTGTCAAA
ACAGATGATGATGTCTGCAAAAATTTTCTGAGCGCTTGTAAACAATGCCC
TCCAACCAATTATACAGTCATTATGTATCAAGATTTATTGAAGATAAAGG
ACGAAATATTAATTGCTAAAAATGAAATTCGAAATTTGATAGTAAAATTT
AACAAAACGAATCTTAATAAGGAAGCAAAACTAAACAAAATACTGAAATC
GGGAGATCTGATCAGAAATGTTTCTGTCACAACTATTATTTTGCTTTTCC
TGATCCTGATCCTCTTGATCCTGGAAATCAAATTCAAATCATTCTCTAAA
TTATTTCGGACCATCAATAAAAAAAAATACAAAAGAGTAAATCAAGAAAA
TATCGAACGGCAGAATTCTCAACAGGATTCACCAACTGCCAGTAACAACG
ATGAAATGAAAAGATTAATTGAGAACTTGAAAGATGAAATGAAACAAACA
TTTCGAAATGTCTCAGCGGCAAGCCGGAGGTTGAAATTTCGTGTAGGGAA
GGAAATGATAGAGCTGGAGGTTCAGGTCCATGAGAATGATAATGCAGTCA
AATTGAGGCGGCAAATTGCGGATAGAATAGCAGGAGGGAGTCCCAATGAC
TGCAAAGCTATGACAATGAAATACAAAGGCATCCAACTGGATAATAACAA
ATATTTATTGCCTTGTATAGATTCACCAGAAATCCCCATTTATTGTGAAT
ATGATGCGAATAATATTAATATCAATGAGATAATTATTCTCAATTTGATG
GCAAATTTTCCTGTTCCAGAAATGGTGGAAATGAAATTATGGCAAACTGT
TGGGCAGTTGAAAGCCACCATTTCAGACATAACCGGATTGAGAAAGGAGG
ACTTGATAATTGTGAAAGCATCAAAGGAATTGGACAACGAAGAAACTGTT
GATAAATGTGGCTTTACTGACTGTGATTCGGTTCAAGTTTATAAGACCTG
GCAAACTGTTTCTGTTCAATCACTGTTCAGGGACAAATCGCAGCACAAAT
TTCAATGCTGCTCAACTGAAACCCTTTCAGAGCTGACGGCCAAGCTTGCC
GAGGAACTCAAATGTGACATCAAGAATTTATCCTTGTTCATGGGAGGCGA
ATATTTGCAAACTGATGATTATCTATATAAATATAATATTGGTGCGGATA
AATCTATCAAATATGGCAATTTTGCACAGAAGCCAGATTTGTATGAGATC
GAACCAATAGTAAACAGTGATTATAACAGCAGATATATCAAAGGGAAAGT
GAAATCATCAAAAGAAGAAGTAATGATAAAATCATACAATATAAAAACCG
AAGGAATGAGCACAAATCCAACTGAATGGCTCAGTGAAAGATTGCGGCTC
TCCTTGCTAACTATTTCTCATTCAAGATTCATTCAGTTGCGGGATGCCTT
TCATGATGAATCTCATGTCATTTTAGTGATGGAAAATGTTCACGGAATCA
CTCTGAATAGCTTCATAGAAAATGAAAAGAATTATCCATTGATGGAATAT
GAAATCTCTAAATGGACCAAACAAATATTAGAGGGACTCGAATATATTCA
CCAATTCGGCATCATTTATATGGATCTCAGTCCTTTCCACATTTTCATCG
ACGGCAATCACAACGTAAAGCTGACAAATTTCAACCAGACGGATTACCTT
CACATAGAAAACATTGATAACTTTGAGGAATTTGCTGAAAATAACGAGAT
TAAATACGTTTCACCAGAAATAATACGCAAGGAAGAATATGGAGTGAAAG
CTGACGTGTGGTCATTGGGAGCAATTCTGGTCAAGATTCACAAAAGAGAG
ACTCTTTATCCTAGGAAAAGCGATCGGGAAATGGTTGAAATGATGCTCAA
TAATAAAAATATAAAGTATAATGACAAAGGAATGTCAAAGGAATTAAAGG
AATTCATTGATCTATGCCTGATTGGTGATGTGAATGCCAGAGCGTCGACC
AATCACTTATTTAATACAGAATTCATTAGGAAATATCAATAACCTCTGAA
ATATTTGATTGGTTTAATATTTAAACAATTGTTAAATAAACATATTTATC
AGCTGCATTAACTCCGCT
back to top

protein sequence of SMED30034836-orf-1

>SMED30034836-orf-1 ID=SMED30034836-orf-1|Name=SMED30034836-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=711bp
MKNIAILIFFLSVLIAHTETPKNTCIIDYPFRKDDFSCDNFEKICVKTDD
DVCKNFLSACKQCPPTNYTVIMYQDLLKIKDEILIAKNEIRNLIVKFNKT
NLNKEAKLNKILKSGDLIRNVSVTTIILLFLILILLILEIKFKSFSKLFR
TINKKKYKRVNQENIERQNSQQDSPTASNNDEMKRLIENLKDEMKQTFRN
VSAASRRLKFRVGKEMIELEVQVHENDNAVKLRRQIADRIAGGSPNDCKA
MTMKYKGIQLDNNKYLLPCIDSPEIPIYCEYDANNININEIIILNLMANF
PVPEMVEMKLWQTVGQLKATISDITGLRKEDLIIVKASKELDNEETVDKC
GFTDCDSVQVYKTWQTVSVQSLFRDKSQHKFQCCSTETLSELTAKLAEEL
KCDIKNLSLFMGGEYLQTDDYLYKYNIGADKSIKYGNFAQKPDLYEIEPI
VNSDYNSRYIKGKVKSSKEEVMIKSYNIKTEGMSTNPTEWLSERLRLSLL
TISHSRFIQLRDAFHDESHVILVMENVHGITLNSFIENEKNYPLMEYEIS
KWTKQILEGLEYIHQFGIIYMDLSPFHIFIDGNHNVKLTNFNQTDYLHIE
NIDNFEEFAENNEIKYVSPEIIRKEEYGVKADVWSLGAILVKIHKRETLY
PRKSDREMVEMMLNNKNIKYNDKGMSKELKEFIDLCLIGDVNARASTNHL
FNTEFIRKYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000626Ubiquitin-like_dom
IPR000719Prot_kinase_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 181..201
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 305..379
e-value: 7.2E-6
score: 27.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 444..711
e-value: 1.4E-43
score: 151.3
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 442..708
NoneNo IPR availablePANTHERPTHR24347:SF412CALCIUM/CALMODULIN DEPENDENT PROTEIN KINASE Icoord: 442..708
NoneNo IPR availableCDDcd01793Ubl_FUBIcoord: 314..361
e-value: 1.07931E-4
score: 39.1875
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.761
NoneNo IPR availableTMHMMTMhelixcoord: 121..143
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 462..707
e-value: 1.2E-39
score: 136.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 428..707
score: 30.209
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 307..361
score: 9.025
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 305..364
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 374..434
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 443..710