Transporter

Overview
NameTransporter
Smed IDSMED30034835
Length (bp)2828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transporter (SMED30034835) t-SNE clustered cells

Violin plots show distribution of expression levels for Transporter (SMED30034835) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transporter (SMED30034835) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transporter (SMED30034835) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034835

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034835SMESG000019713.1 SmedASXL_015043SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30034835SMESG000019713.1 dd_Smed_v4_10458_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034835SMESG000019713.1 dd_Smed_v6_10458_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034835SMESG000019713.1 dd_Smed_v4_10458_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transporter vs. Ensembl Human
Match: SLC6A5 (solute carrier family 6 member 5 [Source:HGNC Symbol;Acc:HGNC:11051])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 293/604 (48.51%), Postives = 401/604 (66.39%), Query Frame = 1
Query:  412 AVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK---LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            A  E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  ++  S +   S+     I +    +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LALCLF +W+IV+  L KGIK++GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP  +++++  +    P   I+R L+ +  P   WGP L +HR
Sbjct:  178 ATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCV--ISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP--IMFVI--KMHLAPGRFIER-LKLVCSPQPDWGPFLAQHR 766          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 487.649 bits (1254), Expect = 9.634e-161
Identity = 271/609 (44.50%), Postives = 394/609 (64.70%), Query Frame = 1
Query:  388 NANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            ++ + N    +E  K ++N +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +   L  L N +L        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA DGI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     ++I ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   25 SSPEQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASN------LTNGSRPAALPSNLSHLLNHSL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIP---LYAMFRLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 608          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 485.723 bits (1249), Expect = 2.964e-160
Identity = 270/599 (45.08%), Postives = 390/599 (65.11%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            +E  K ++N +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +   L  L N +L        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA DGI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     ++I ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   16 SEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASN------LTNGSRPAALPSNLSHLLNHSL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIP---LYAMFRLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 589          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 485.723 bits (1249), Expect = 2.964e-160
Identity = 270/599 (45.08%), Postives = 390/599 (65.11%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            +E  K ++N +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +   L  L N +L        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA DGI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     ++I ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   16 SEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASN------LTNGSRPAALPSNLSHLLNHSL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIP---LYAMFRLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 589          
BLAST of Transporter vs. Ensembl Human
Match: SLC6A9 (solute carrier family 6 member 9 [Source:HGNC Symbol;Acc:HGNC:11056])

HSP 1 Score: 487.649 bits (1254), Expect = 6.178e-160
Identity = 272/608 (44.74%), Postives = 392/608 (64.47%), Query Frame = 1
Query:  391 ANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            A   N    +E  K ++N +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +   L  L N +L        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA DGI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     ++I ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   80 AMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASN------LTNGSRPAALPSNLSHLLNHSL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVAIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIP---LYAMFRLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 662          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 394.43 bits (1012), Expect = 7.294e-126
Identity = 225/623 (36.12%), Postives = 350/623 (56.18%), Query Frame = 1
Query:  427 LKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASIS-NPLPWISCNNSWNTDYCRDRLSIVNCSL---------MKAFSNGTCYDISDKL-VGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPR--KTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCG-GWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYT--RAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESY 2247
            +++    ER  W    DFI+S +GYA+GLGN+WRFPY+CY+NGGGAF+IPY I L   G P+F+++   GQ  S G    ++  PIF G+G A  +++  + +YY V++S+A  Y++ S + + +PW +C+++WNT  CR     + C           +K  ++   ++   +  VG             +   P +E++N+ VL +S  +   G ++W LAL L   WII +LC+ KG+K TGK+VY TA FPY +L  L  RG+ L+GA  G+ FY+ PD  KL ++ VW DA  Q+FFS     G L+AL SYN+F+NN+ +  L V   NS TS+FAGFVIFS++G +A +   SV+ VA  G GL F+ YP  +  +P +  WS LFF+M++ LG+DSQF T+E   T  +D +P   R +  +  F+ +  +I + +GL   T+ G Y  QL D Y   GWA+L +  FE I+I W  G          R+   +++++G   S WW+ CW + TP++  G++LF    Y   R    +  YP+W    GW +++ S+  IPG  +++ FK        +++  ++ L  P I+      K  +  A +LE  E +
Sbjct:    2 VEATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFNVKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFKGVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNKFNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLFLGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECIAISWSLGID--------RWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLCIPGYAIWIWFKTP-----GTVQEKIKLLCRPDIE-----IKGAMENAENLELVEDF 606          
BLAST of Transporter vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 387.111 bits (993), Expect = 5.508e-123
Identity = 218/592 (36.82%), Postives = 335/592 (56.59%), Query Frame = 1
Query:  439 ENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLS----------KDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIK 2181
            ++  R  W GK DF+LS +G+AV LGNIWRFPY+C++NGGG F+IPY I + L G+P+F +++ LGQ+   G  T W    P+F GIGY +++ +  V  +YNVI+++ ++Y++ S S  LPW SCNNS+N+  C +     + + M   +N +                        +   AEEYF    L L           + VT +G V+W +AL LF  ++I +  + KGI ++GK+V+FTA+FPY VL ILF RGV L G  +GI +Y+ P+ + L   SVW+DAA Q+FFSL   +G L+A SSYN FHNN+  D L  +  N ATS  +GFVIFS LG+++ + G  +  VA +G GL F++YPEA++TMP +  WS+LFF+ML+TLGLDS F   E +ITG  D +PI  + R+ + +         +G+ + T+ G   ++ +  Y   W +L+    E + I ++YG          +F  D++ ++G    N+W+ CW    P ++  +I  ++ +Y    Y D  YP  A+ +G +  +   +FIP   +Y     R     ++I    Q +T+P  K
Sbjct:   36 KDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKNGGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLFKGIGYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQS--------------------VSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYFSMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIFSVLGYMSCKSGKPIEAVAQEGPGLVFVVYPEALSTMPYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLSDEFPILKKNREVF-VGCLFAFYMVIGIAMCTEGGILIMEWLIIYGTTWGLLIAVFCEAMVIAYIYGL--------RQFVHDVKEMMGFRPGNYWKFCWSCAAPFILLSMITSNFINYQALTYQDYTYPTAANVIGIIFALSGASFIPLVGIYKFVNARG----NTISEKWQRVTMPYRK 594          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-3 (Sodium- and chloride-dependent betaine transporter [Source:UniProtKB/Swiss-Prot;Acc:G5EBN9])

HSP 1 Score: 377.867 bits (969), Expect = 1.294e-119
Identity = 206/570 (36.14%), Postives = 317/570 (55.61%), Query Frame = 1
Query:  421 EYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTY-CGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGD-KIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY 2124
            E  +  E  +RG W GK DF++S + YAVGLGN+WRFPY+CY+NGGG+F++ Y+IF  L  +PIFL++V +GQ+   G    W   P+F G+G   V+I+ +   Y+ VI+++A++YM +SI+   PW +CNN WN                    + TC    +    L              +   E+++   VL+ + D++  G +QW+L   +  +W+IV+  L KGI    K VYF A+FPY ++ IL  RG+ L+GA  GI FY+ P+  +L D +VWKDA  Q+F+S    +G LIAL S+N+F++N  +D + +   N  TSI AGF +FS LG+++      +S +   G+GLAF+ YPE  + +P   ++++LFF+M+  LGLDSQ   +E + T   D +PI LR  K   + +F +  F +G+P+ T SG +WL L D Y   G+A+L +  FEV  +G  YG    N +K +     I   L + I   W+ C     P     + +F    Y   KY D K +P WA+  GW ++  S+  IPG  +Y +F   ++
Sbjct:   20 EQSQHSEEPDRGQWTGKFDFLMSMVAYAVGLGNVWRFPYLCYKNGGGSFLVVYMIFFCLAAVPIFLMEVTVGQYLQKGAMEMWLMCPLFRGVGIGNVVIAFMCIAYFCVIVAWAMFYMISSIAWVFPWETCNNYWN--------------------DATCVTGKENFTELARIKALVASAGGHTQTSVEQFWEKRVLHDTGDISEFGGIQWELFFIMAAAWLIVYFALWKGITQARKFVYFCALFPYVLIFILLIRGLTLEGAGTGIYFYLKPNATRLLDTAVWKDAGTQVFYSYGVGFGALIALGSHNKFNHNCFKDAITMCFINGCTSITAGFAVFSILGYMSHVAQKDISEIVKPGVGLAFLAYPEVASNLPMKQVFAVLFFLMITILGLDSQVCMMEGLFTALEDAFPI-LRKYKKQSLGIFCLFFFCIGIPMVTHSGSHWLTLFDAYGASGYALLFVVFFEV--VGLAYGFGAHNIRKAL--HEMIGVTLPKGIEYVWKFC----APATSLVLFVFCVVYYHPVKYPDGKDFPFWANAFGWFLSSCSMVVIPGYAIYYLFFTNKH 560          
BLAST of Transporter vs. Ensembl Celegans
Match: mod-5 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7])

HSP 1 Score: 365.925 bits (938), Expect = 2.636e-114
Identity = 237/653 (36.29%), Postives = 354/653 (54.21%), Query Frame = 1
Query:  214 KLHKIFDINLSK---AMKSEDKKSIIDHDQMINDDNV-ENLPKKTKNIPVVLD---SIQVSMNGCNANDTNVNAVNE----YLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASIS----NPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTI--IGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVS-LVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFD--YTRAKYGDKIYPIWADFLGWMMTVLSLAFIPG-TVVYLV 2106
            K H+     LS    +M S  +   +     +      E +P    + P+ L    S  +  N   A    +    E     L+   +  R  W  K +F+L+ +GYAV LGNIWRFP +CY++GGGAF+IPY I L + G+P+F +++ LGQF  +G  + W +  P+F GIGY +  I T +A++YN II+ AVY+   S+S    + +PW SC N WNT  C D L   N ++ +   NGT                           P+EEY+  +VL + K      +G V+  +A+CL   +I+V+  L KG +S+GKIV+ TA  PY +L IL  RG+ L GA +G+ +Y+ PD +KL D +VW  AA QIFFSL   +G L+ALSSYN F+NN  RD +  +I N ATS F+G V+FS LG+++      ++ +V +    L FI+YP+A+ATM  S  WS +FFVMLITLG+DS F  IE  ITGF D      + RK WF+L+  II +FL  P  +  G + +  +D Y    ++L I   E+I++ W YG          +F +DI  +LG     +WR+CW   +P  +S I + + ++  +   +     +P W+  LGW + +LS+  IP   ++YL+
Sbjct:   10 KQHQQLQAELSSGAASMLSAPESRRVSRSMSVKAPTASEYMPLSVADKPLTLTVSTSHSIDPNEPIAALGGLTPTKEGRVAALRRRSSMVRDKWATKMEFLLAVVGYAVDLGNIWRFPSVCYKHGGGAFLIPYFIMLMIGGLPMFYMELVLGQFHRSGCVSIWRKVCPLFRGIGYGICCICTFIAIFYNAIIAQAVYFAIVSLSKIWDSEVPWASCGNPWNTPRCSDDL---NVTISR---NGT-----------------------PLTTPSEEYYLYKVLEVQKSTGFDDLGGVKTSMAVCLLAVFIMVYFALWKGPQSSGKIVWVTATAPYIILSILLIRGLLLPGAKNGLYYYVTPDFEKLKDPAVWSAAATQIFFSLGPGFGVLLALSSYNDFNNNCYRDAVTTSIINCATSFFSGCVVFSTLGYMSLLTNKPINEVVGEHDASLIFIVYPQALATMDYSCFWSFIFFVMLITLGIDSTFAGIEAFITGFCDESRFLSKNRK-WFVLVICIIYYFLSFPAISYGGQFVIPFLDEYGVSLSVLFIVTCEMIAVCWFYGVD--------QFSKDIRAMLGFYPGIYWRVCWT-CSPVFISVIFIMTVYNSSFKPIQMASYTFPWWSVILGWFLRLLSVLAIPVFAIIYLL 623          
BLAST of Transporter vs. Ensembl Celegans
Match: snf-6 (Sodium-dependent acetylcholine transporter [Source:UniProtKB/Swiss-Prot;Acc:O76689])

HSP 1 Score: 327.405 bits (838), Expect = 2.464e-99
Identity = 196/634 (30.91%), Postives = 331/634 (52.21%), Query Frame = 1
Query:  436 EENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKA--FSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADK-GMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILG--RPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQNNHNE 2322
            +EN  RGNW  K D++L+ +G+  G+G+ W+FP++ +++GG AF++PYL  L L  +P+F +++ LGQF+S+   + W+  P+F GIG+A V IS   AV++N+I ++ ++Y+  S S  +PW +C NSW+ + C     I  C  M      NG+C  I +      NET   I       +P+ +YF N+VL LSK V   G + W L LC+   WI VFLCL +G+KS+GK+VY   I P+ +L +L  R + LDG++  + +++ P  + L D  VW +AA Q F+S+S   GGL  ++SY+RFHNNI +D  +V I +   S+    + FS +G        S+     + G  L F+   EA+A +  + +++ LFF+M++ +   +Q   +ET+++   D YP  LR  +   +     +   L +P    SG +W++L+  +   W +++I   E ++I WVYG              + + I+G   P   +W++ +++I P +   I+ F W D+   +Y    +P W+    W +    L  IP   ++     +      +I +    +  P   WGP++  HR        +     I  ARRL     V +++ +    E
Sbjct:   59 DENRIRGNWSNKSDYLLAVIGFTAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFFNIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRI-QCKEMNGTLLVNGSC--IVEHASS--NETTV-IPLHDLGSIPSLKYFQNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFLTPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAISLDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALFILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVD--------NMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLAILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAK-----GTITQKWWRVLYPDDAWGPAMAIHR-------AEKFPLQIPEARRLLLPPEVEIASSRGVLQE 666          
BLAST of Transporter vs. Ensembl Fly
Match: GlyT (gene:FBgn0034911 transcript:FBtr0301162)

HSP 1 Score: 540.806 bits (1392), Expect = 6.472e-175
Identity = 287/614 (46.74%), Postives = 387/614 (63.03%), Query Frame = 1
Query:  436 EENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWE-YAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCY-DISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNW---WRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLV-FKERRYNPYH-SIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYID 2256
            E  +ERG W G+ DF+LS LGY+VGLGN+WRFPY+CY NGGGAF+IP+ I L + G+P+  +++  GQ+ + GP   +  + P+F G+G  M+++S +V +YYN+II++ ++YMFAS +  LPW +C  +W+T YC        C      +NGT Y              +  +     ++ PAEEYFNN VL LSK +   G+++  LA CLF +W IVFLCL KG++S+GK+VYFTA+FPY VL+ILF RGV L GA  GI FY+ PD K+L++A VW DAA QIFF+LS +WGGLI LSSYN+F NN  +D+LIV   N ATS FAG VIFS +G LA  L   V  V D+G GLAFI+YPE V  +P S +W++LFFVML+TLGLDSQF  +ETV T  +D +P  LR  K W +L   I  +  GL  TT SG YWLQLMD Y   W++LLI I E I I W+YG          RF  DI+ ++G+    W   W + W+YITP  +  I+ F+W +Y  AKYG  +YP+WAD +GW++ +L     P  V++LV F+E    P   S +  ++ L  PT +WGP+    R     H E  +S   D
Sbjct:   52 ESEHERGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELSFGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPAWSTKYCFSYAQADQCEA----TNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKGIEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGILFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFFAGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQFALMETVTTAILDRFP-NLRQYKIWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVLLIAISECILIAWIYGS--------QRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPAKYGHYVYPMWADAVGWIVGLL-----PVLVIFLVAFQEIWRAPMSLSFRDRIKHLLQPTAEWGPA---GRPCVNLHAERYQSQNYD 644          
BLAST of Transporter vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0330002)

HSP 1 Score: 457.988 bits (1177), Expect = 1.262e-149
Identity = 240/565 (42.48%), Postives = 350/565 (61.95%), Query Frame = 1
Query:  442 NNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSN-GTCYDISDKLVGLWNETLFNIITQKTRKL--------PAEEYFNNEVLNLSKDVTI--IGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVY 2100
            ++ER  W GK DF+LS +G+AV L N+WRFPY+CY+NGGGAF++PY I L + G+P+F +++ LGQ    G  TCW    P+F GIGYA+V+I+  V  YYNVII++++ + FAS +N LPW SCNN WNT  CR   S  N S +    N    Y + ++ + L+NET  N  +  T  +         A EYFN  +L L++   I  +GA++W +ALCL   ++I +  L KGI ++GK+V+FTA+FPY VLLIL  RG+ L G+  GI +Y+ P+   +  A VW DAA Q+FFSL   +G L+A +SYN++HNN+ +D L+ +  NSATS  AGFVIFS LG++A  LG  +  VA +G GL F++YP A+ATMP S  W+++FF+ML+TLGLDS F   E +IT   D +P   R R+ + +     + F +GL   T+ G Y+  L+D Y  G++IL+   FE I++ W+YG          RF  DI  ++G P   +W++CW+++ P  +  I ++    Y    Y D +YP WA+ LGW +   S+  IP   ++
Sbjct:   24 SDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFES-QNASRVPVIGNYSDLYAMGNQSL-LYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELF-VAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGT--------NRFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIF 577          
BLAST of Transporter vs. Ensembl Fly
Match: DAT (gene:FBgn0034136 transcript:FBtr0087125)

HSP 1 Score: 457.218 bits (1175), Expect = 1.393e-149
Identity = 240/565 (42.48%), Postives = 350/565 (61.95%), Query Frame = 1
Query:  442 NNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSN-GTCYDISDKLVGLWNETLFNIITQKTRKL--------PAEEYFNNEVLNLSKDVTI--IGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVY 2100
            ++ER  W GK DF+LS +G+AV L N+WRFPY+CY+NGGGAF++PY I L + G+P+F +++ LGQ    G  TCW    P+F GIGYA+V+I+  V  YYNVII++++ + FAS +N LPW SCNN WNT  CR   S  N S +    N    Y + ++ + L+NET  N  +  T  +         A EYFN  +L L++   I  +GA++W +ALCL   ++I +  L KGI ++GK+V+FTA+FPY VLLIL  RG+ L G+  GI +Y+ P+   +  A VW DAA Q+FFSL   +G L+A +SYN++HNN+ +D L+ +  NSATS  AGFVIFS LG++A  LG  +  VA +G GL F++YP A+ATMP S  W+++FF+ML+TLGLDS F   E +IT   D +P   R R+ + +     + F +GL   T+ G Y+  L+D Y  G++IL+   FE I++ W+YG          RF  DI  ++G P   +W++CW+++ P  +  I ++    Y    Y D +YP WA+ LGW +   S+  IP   ++
Sbjct:   24 SDERETWSGKVDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYGIMLVVGGIPLFYMELALGQHNRKGAITCWGRLVPLFKGIGYAVVLIAFYVDFYYNVIIAWSLRFFFASFTNSLPWTSCNNIWNTPNCRPFES-QNASRVPVIGNYSDLYAMGNQSL-LYNETYMNGSSLDTSAVGHVEGFQSAASEYFNRYILELNRSEGIHDLGAIKWDMALCLLIVYLICYFSLWKGISTSGKVVWFTALFPYAVLLILLIRGLTLPGSFLGIQYYLTPNFSAIYKAEVWVDAATQVFFSLGPGFGVLLAYASYNKYHNNVYKDALLTSFINSATSFIAGFVIFSVLGYMAHTLGVRIEDVATEGPGLVFVVYPAAIATMPASTFWALIFFMMLLTLGLDSSFGGSEAIITALSDEFPKIKRNRELF-VAGLFSLYFVVGLASCTQGGFYFFHLLDRYAAGYSILVAVFFEAIAVSWIYGTN--------RFSEDIRDMIGFPPGRYWQVCWRFVAPIFLLFITVYGLIGYEPLTYADYVYPSWANALGWCIAGSSVVMIPAVAIF 577          
BLAST of Transporter vs. Ensembl Fly
Match: Gat (gene:FBgn0039915 transcript:FBtr0089972)

HSP 1 Score: 449.899 bits (1156), Expect = 1.242e-146
Identity = 247/589 (41.94%), Postives = 356/589 (60.44%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYC-GGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-----NPYHSIKRILQDLT 2166
             + +K E+  +RG+W  K DFILS +G A+GLGN+WRFPY+CY+NGGGAF++PY+I LFL G+P+F +++ LGQ  + G    ++ APIF GIGYA  ++S  + VYY VI+++AV+Y F S+   +PW +CNN WNT  C  +    N        NGT   +        + +  NI + +    P +E++    L +S  +  IG ++W+LA  L   WI+ + C+ KG+K TGK+VYFTA+FPY +L IL  RG+ L GA++GI FYIIP+  KL+++ VW DA  QIFFS     G L+AL SYN+F NN+ +D LIV   NS+TS+FAGFVIFS +G +A      V+ VA  G GLAF++YP AV  +PGS +WS LFF ML+ +GLDSQF T+E  IT  +D +P  LR RK  FI +   + + +GL   T+ G Y  Q++D+Y   G+ +L +  FE +SI W YG          RF   I+ ++G   + WW+ CW   TP +  G+  F+   +T  KY D  YP WA   GW   + S+ +IP   +Y+ +  +R          ++ RI +D+T
Sbjct:   47 QQLVKIEQLPDRGSWSSKMDFILSVVGLAIGLGNVWRFPYLCYKNGGGAFILPYIITLFLAGIPMFFMELALGQMLTIGGLGVFKIAPIFKGIGYAAAVMSCWMNVYYIVILAWAVFYFFMSMRADVPWRTCNNWWNTVNCVSQYERKNLHCWDKIINGTTQKVC-------SVSALNITSLELTD-PVKEFWERRALQISHGIEEIGNIRWELAGTLLLVWILCYFCIWKGVKWTGKVVYFTALFPYVLLTILLVRGITLPGALEGIKFYIIPNFSKLTNSEVWIDAVTQIFFSYGLGLGTLVALGSYNKFTNNVYKDALIVCTVNSSTSMFAGFVIFSVIGFMAHEQQRPVADVAASGPGLAFLVYPSAVLQLPGSPMWSCLFFFMLLLIGLDSQFCTMEGFITAIIDEWPQLLRKRKEIFIAIVCALSYLVGLTCITQGGMYIFQILDSYAVSGFCLLWLIFFECVSISWCYGVD--------RFYDGIKDMIGYYPTVWWKFCWCVTTPAICLGVFFFNIVQWTPVKYLDYSYPWWAHAFGWFTALSSMLYIP---LYMFWLWKRTPGELSEKIRALVRIDEDVT 616          
BLAST of Transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 425.631 bits (1093), Expect = 1.803e-137
Identity = 254/653 (38.90%), Postives = 360/653 (55.13%), Query Frame = 1
Query:  259 SEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEY-APIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKD--VTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            S+DK+S  + D    DD     P K      V D +   +    AN+  +  V     S     R  W  K +F+L+ +G+AV LGN+WRFPY+CY+NGGGAF++PY +FL   G+P+F +++ LGQF   G  + W+   P   G+GYA+ +I   + +YYN II +AVYY+FAS ++ LPW SC+N WNT+ C    S                           E    + T      PA+E+F  +VL   K   +  +G V+  LALC+FG +++V+  L KG++S GK+V+ TA+ PY VL+IL  RGV L GA +GI +Y+ P+  KL ++ VW DAA+QIFFSL   +G L+ALSSYN+F+NN  RD LI +  N  TS  AGFVIFS LG++A    TS+  V  +G GL FI+YPEA+ATM GS  WSI+FF+MLITLGLDS F  +E +IT   D YP  +  R+  F+LL +  +F   LP  T  G   +  ++ Y  G AIL +   E   + W YG          RF  D+E +LG     +WR+CW YI+P  +  I +FS   Y      +  YP W+  +GW +T  S+  IP  ++Y  F   +       ++ LQ+   P    G  +P  +
Sbjct:   25 SDDKESPNNEDDSNEDDGDHTTPAK------VTDPLAPKL----ANNERILVV-----SVTERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTS---------------------------ENFTELATS-----PAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIFSVLGYMAYVQKTSIDKVGLEGPGLVFIVYPEAIATMSGSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVD--------RFSSDVEQMLGSKPGLFWRICWTYISPVFLLTIFIFSIMGYKEMLGEEYYYPDWSYQVGWAVTCSSVLCIPMYIIYKFFFASK----GGCRQRLQESFQPEDNCGSVVPGQQ 618          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 293/596 (49.16%), Postives = 400/596 (67.11%), Query Frame = 1
Query:  439 ENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDR--LSIVNCSL----MKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYLI L L G+PIFL++V LGQF S GP + W+  P   G G AM+IIS L+A+YYN+I+ + +YY+FAS+   LPW +C N WNT  C+D+  L +  C L    + +  N T + +S  +VG  ++ L   +  KT   P+EEYF   VL++SK +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A  L   +  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L+  +  F LG P+ T+SG Y LQL+DT+   +++++I IFE++ I ++YG          RF  DIE ++G   + +WR+CW ++TPT+++ I+  S + +    Y D  YP W+  LGW+M + S+ +IP     ++F  + +    S+   L+ +  P   WGP L KHR
Sbjct:  173 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKN-TTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGL--------QRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIP-----IMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 754          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 293/596 (49.16%), Postives = 400/596 (67.11%), Query Frame = 1
Query:  439 ENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDR--LSIVNCSL----MKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYLI L L G+PIFL++V LGQF S GP + W+  P   G G AM+IIS L+A+YYN+I+ + +YY+FAS+   LPW +C N WNT  C+D+  L +  C L    + +  N T + +S  +VG  ++ L   +  KT   P+EEYF   VL++SK +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A  L   +  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L+  +  F LG P+ T+SG Y LQL+DT+   +++++I IFE++ I ++YG          RF  DIE ++G   + +WR+CW ++TPT+++ I+  S + +    Y D  YP W+  LGW+M + S+ +IP     ++F  + +    S+   L+ +  P   WGP L KHR
Sbjct:  165 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKN-TTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGL--------QRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIP-----IMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 746          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a5 (solute carrier family 6 member 5 [Source:ZFIN;Acc:ZDB-GENE-050105-2])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 293/596 (49.16%), Postives = 400/596 (67.11%), Query Frame = 1
Query:  439 ENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDR--LSIVNCSL----MKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYLI L L G+PIFL++V LGQF S GP + W+  P   G G AM+IIS L+A+YYN+I+ + +YY+FAS+   LPW +C N WNT  C+D+  L +  C L    + +  N T + +S  +VG  ++ L   +  KT   P+EEYF   VL++SK +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A  L   +  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L+  +  F LG P+ T+SG Y LQL+DT+   +++++I IFE++ I ++YG          RF  DIE ++G   + +WR+CW ++TPT+++ I+  S + +    Y D  YP W+  LGW+M + S+ +IP     ++F  + +    S+   L+ +  P   WGP L KHR
Sbjct:  173 ENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLIMLGLAGIPIFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPWATCKNEWNTVECKDKDMLLLDTCILRDRNITSIKN-TTFCLSANVVGNLSKLLNVTVDNKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAACLFLAWLIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGSGILYFITPKWEKLNDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIESVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPQFTLVCCLSFFVLGFPMITESGMYMLQLVDTFAASYSLVIIAIFELVGISYIYGL--------QRFCEDIEMMIGFQPNKFWRVCWAFVTPTILTFILALSLYQWKVMTYEDYTYPNWSMVLGWLMVICSVIWIP-----IMFAIKMHLAPGSLIERLKLVCSPQPDWGPFLMKHR 754          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a14 (solute carrier family 6 member 14 [Source:ZFIN;Acc:ZDB-GENE-130411-2])

HSP 1 Score: 500.745 bits (1288), Expect = 2.085e-166
Identity = 287/629 (45.63%), Postives = 383/629 (60.89%), Query Frame = 1
Query:  337 KNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYI--IPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPIS---NWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            KNI  VL    V   G   +    +     ++++EN++RGNW  K +++LS +GYAVGLGN+WRFPY+ Y++GGGAF+IPY I L + G+P+F ++   GQF S GP   W+  PI  G+G  M+++ST VA+YYNVII+Y++YY+FAS  +PLPW                SI NC       N T  +IS   V   N +   I  Q      +E+Y++   L  S  +   G V W LALCL  SWI+V   L KGIKS+GK+VYFTA FPY VLLIL  RG  L+GA DGI FYI    +L KL++A VWKDAA QIFFSLS +WGGL+ALSSYN+F+NN  +D+++V + N  TSIFAGF IFS LGH+A      VS VAD G  LAFI YP+A++ +P S +WSILFF MLITLGLDSQF  IE + T  +D YP  L+ ++        IILF LGLP  T++G YW+ L+DT+  GW +L+ G+ EV+ +  +YG          RF +DIE ++G   S    WWR CW +ITP ++S I+++S + +T   Y    YP W   LGW +T  SL +IP   V+ V K R       + + ++    PT  WGP L  HR
Sbjct:    7 KNIRGVLFKNSV---GDEQDKDKSDKAEHVVQNDENSDRGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYTIMLAVSGLPLFFMESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVIIAYSIYYLFASFQDPLPW----------------SIKNC-------NTTASNISTAAV---NVSCGQISGQSL----SEKYWDEVALQRSSSMDETGPVVWHLALCLLLSWILVGAALFKGIKSSGKVVYFTATFPYIVLLILLIRGATLEGAKDGIEFYIGSQSNLTKLAEAEVWKDAATQIFFSLSIAWGGLMALSSYNKFYNNCYQDSIVVCVTNCGTSIFAGFAIFSVLGHMAHVYQRPVSEVADAGFALAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVISTCLLDAYPEVLKSKRGLVTTAVCIILFLLGLPCVTRAGIYWVNLIDTFSAGWILLVAGLLEVLGLCILYGGN--------RFIKDIEMMIGTKSSLFWLWWRACWFFITPVVLSIILIWSLYTFTSPTYSSVAYPDWGISLGWCITAFSLMWIPIVAVWKVCKAR-----GGLWQRIKSACSPTEDWGPYLECHR 589          
BLAST of Transporter vs. Ensembl Zebrafish
Match: slc6a9 (solute carrier family 6 member 9 [Source:ZFIN;Acc:ZDB-GENE-050105-3])

HSP 1 Score: 492.656 bits (1267), Expect = 8.709e-163
Identity = 274/605 (45.29%), Postives = 391/605 (64.63%), Query Frame = 1
Query:  397 DTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D N     E +K +EN+ RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQFTS G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C   +S          +N T  ++S  + G+       I+ +  R  P+EEY+ N VLN+S  +   G V+  +  CL  SW +VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I+++ N  TS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT+  L   II F LG+PLTT++G YWL LMD Y   +++++I     I I +VYG           + +D+E +LG P   ++R+CW+Y++P +++ I++F+   Y    Y D +YP W+  +G+ M + S+  IP   +Y +FK         ++R L++   P   WGP+L +HR
Sbjct:   13 DQNGAVPGEPVKRDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVVSTHR-------ANATFANMSAVVSGV-----TEIVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAVSWFVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCGTSVYAGFVIFSILGFMAHHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAVVDEIGTDWIIKNKTYVTLGVAIIGFLLGVPLTTQAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGH--------KNYFKDVEMMLGFPPPIFFRICWRYVSPFIITFILIFTVIQYKPITYNDYVYPGWSLVIGFAMALSSVICIP---IYALFKIAMSEGSTFLER-LKNSVKPDPDWGPALQEHR 593          
BLAST of Transporter vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 521.546 bits (1342), Expect = 5.204e-174
Identity = 283/621 (45.57%), Postives = 401/621 (64.57%), Query Frame = 1
Query:  388 NANDTNVNAV-NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
            +AN +   AV  E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+ C   LS  + +     S  +  +++  L    N+TL        R  P+EEY+   VLN+S D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG           + +DIE +LG P   +++ CW++ +P ++  I++F+   Y   KY D +YP WA  +G++M + S+  IP   +Y VF+  R   +  ++R L++   P+  WGP+L +HR    R+ + S S
Sbjct:    3 SANRSTNGAVPGEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGL----NQTL-------KRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIP---LYAVFRVWRSEGHTFLQR-LKNAVKPSKDWGPALLEHR--TGRYAQISSS 598          
BLAST of Transporter vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 520.005 bits (1338), Expect = 2.061e-173
Identity = 281/621 (45.25%), Postives = 397/621 (63.93%), Query Frame = 1
Query:  385 CNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
            C     N     E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+ C   LS  + +     S  +  +++  L    N+TL        R  P+EEY+   VLN+S D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG           + +DIE +LG P   +++ CW++ +P ++  I++F+   Y   KY D +YP WA  +G++M + S+  IP   +Y VF+  R   +  ++R L++   P+  WGP+L +HR    R+ + S S
Sbjct:    5 CGEGILNGAVPGEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGL----NQTL-------KRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIP---LYAVFRVWRSEGHTFLQR-LKNAVKPSKDWGPALLEHR--TGRYAQISSS 600          
BLAST of Transporter vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 519.62 bits (1337), Expect = 2.473e-173
Identity = 279/610 (45.74%), Postives = 395/610 (64.75%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
             E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+ C   LS  + +     S  +  +++  L    N+TL        R  P+EEY+   VLN+S D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG           + +DIE +LG P   +++ CW++ +P ++  I++F+   Y   KY D +YP WA  +G++M + S+  IP   +Y VF+  R   +  ++R L++   P+  WGP+L +HR    R+ + S S
Sbjct:   14 GEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGL----NQTL-------KRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIP---LYAVFRVWRSEGHTFLQR-LKNAVKPSKDWGPALLEHR--TGRYAQISSS 598          
BLAST of Transporter vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 519.235 bits (1336), Expect = 2.870e-173
Identity = 279/610 (45.74%), Postives = 395/610 (64.75%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
             E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+ C   LS  + +     S  +  +++  L    N+TL        R  P+EEY+   VLN+S D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG           + +DIE +LG P   +++ CW++ +P ++  I++F+   Y   KY D +YP WA  +G++M + S+  IP   +Y VF+  R   +  ++R L++   P+  WGP+L +HR    R+ + S S
Sbjct:    7 GEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGL----NQTL-------KRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIP---LYAVFRVWRSEGHTFLQR-LKNAVKPSKDWGPALLEHR--TGRYAQISSS 591          
BLAST of Transporter vs. Ensembl Xenopus
Match: mxd4 (MAX dimerization protein 4 [Source:Xenbase;Acc:XB-GENE-6257573])

HSP 1 Score: 519.235 bits (1336), Expect = 3.304e-173
Identity = 279/610 (45.74%), Postives = 395/610 (64.75%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
             E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+ C   LS  + +     S  +  +++  L    N+TL        R  P+EEY+   VLN+S D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG           + +DIE +LG P   +++ CW++ +P ++  I++F+   Y   KY D +YP WA  +G++M + S+  IP   +Y VF+  R   +  ++R L++   P+  WGP+L +HR    R+ + S S
Sbjct:   11 GEATKKDENPKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRILPWTYCNNLWNTENCAGVLSPNSSATFNISSQHSLLNLTMGL----NQTL-------KRTSPSEEYWRRHVLNISGDIGDFGEVRLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGILYYLTPQWDKILHAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAIVDEIGSDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RNYFKDIEMMLGFPPPLFFQFCWRFFSPAIIFFILIFTVIQYRPIKYNDYVYPDWALTIGFLMALSSVICIP---LYAVFRVWRSEGHTFLQR-LKNAVKPSKDWGPALLEHR--TGRYAQISSS 595          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 300/625 (48.00%), Postives = 404/625 (64.64%), Query Frame = 1
Query:  358 DSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK-----LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-NPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D I   + G  A  T    + E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  +    L+ +   G    I  K     +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP     ++F  + Y  P   I+R L+ +  P   WGP L +HR
Sbjct:  158 DGIASVLPGSVATTT----IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKL----LLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP-----IMFVIKMYLAPGRFIER-LKLVCSPQPDWGPFLAQHR 760          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 300/625 (48.00%), Postives = 404/625 (64.64%), Query Frame = 1
Query:  358 DSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK-----LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-NPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D I   + G  A  T    + E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  +    L+ +   G    I  K     +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP     ++F  + Y  P   I+R L+ +  P   WGP L +HR
Sbjct:  158 DGIASVLPGSVATTT----IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKL----LLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP-----IMFVIKMYLAPGRFIER-LKLVCSPQPDWGPFLAQHR 760          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a5 (solute carrier family 6 (neurotransmitter transporter, glycine), member 5 [Source:MGI Symbol;Acc:MGI:105090])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 300/625 (48.00%), Postives = 404/625 (64.64%), Query Frame = 1
Query:  358 DSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK-----LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-NPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D I   + G  A  T    + E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  +    L+ +   G    I  K     +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP     ++F  + Y  P   I+R L+ +  P   WGP L +HR
Sbjct:  158 DGIASVLPGSVATTT----IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKL----LLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP-----IMFVIKMYLAPGRFIER-LKLVCSPQPDWGPFLAQHR 760          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 485.337 bits (1248), Expect = 3.788e-160
Identity = 272/599 (45.41%), Postives = 390/599 (65.11%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            +E  K ++N  RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +S  L  L+N TL        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA  GI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     +SI ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   16 SEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASN------LTNGSRPAALSGNLSHLFNYTL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIP---LYALFQLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 589          
BLAST of Transporter vs. Ensembl Mouse
Match: Slc6a9 (solute carrier family 6 (neurotransmitter transporter, glycine), member 9 [Source:MGI Symbol;Acc:MGI:95760])

HSP 1 Score: 485.337 bits (1248), Expect = 3.788e-160
Identity = 272/599 (45.41%), Postives = 390/599 (65.11%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT-CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            +E  K ++N  RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +P+F G+GY M+++ST + +YYNV+I  A YY F+S+++ LPW  CNN WNT  C   L   N       +NG+    +S  L  L+N TL        R  P+EEY+   VL LS D+   G V+  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RGV L+GA  GI +Y+ P   K+ +A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD V   ++  +KT+  L   +  F LG+PLT+++G YWL LMD Y   +++++I     +SI ++YG   +       FQ DI+ +LG P   ++++CW++++P ++  I++F+   Y    Y    YP WA  +G++M + S+  IP   +Y +F+  R +    ++R L++ T P+  WGP+L +HR
Sbjct:   16 SEATKKDQNLTRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDASN------LTNGSRPAALSGNLSHLFNYTL-------QRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVISCIMCVSIMYIYGHRNY-------FQ-DIQMMLGFPPPLFFQICWRFVSPAIIFFILIFTVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIP---LYALFQLCRTDGDTLLQR-LKNATKPSRDWGPALLEHR 589          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q9Y345|SC6A5_HUMAN (Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 293/604 (48.51%), Postives = 401/604 (66.39%), Query Frame = 1
Query:  412 AVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK---LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            A  E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  ++  S +   S+     I +    +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LALCLF +W+IV+  L KGIK++GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP  +++++  +    P   I+R L+ +  P   WGP L +HR
Sbjct:  178 ATQEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCV--ISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLALCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP--IMFVI--KMHLAPGRFIER-LKLVCSPQPDWGPFLAQHR 766          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|Q761V0|SC6A5_MOUSE (Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 300/625 (48.00%), Postives = 404/625 (64.64%), Query Frame = 1
Query:  358 DSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK-----LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-NPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D I   + G  A  T    + E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  +    L+ +   G    I  K     +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP     ++F  + Y  P   I+R L+ +  P   WGP L +HR
Sbjct:  166 DGIASVLPGSVATTT----IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKL----LLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQTNKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFKPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP-----IMFVIKMYLAPGRFIER-LKLVCSPQPDWGPFLAQHR 768          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|P58295|SC6A5_RAT (Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 299/625 (47.84%), Postives = 404/625 (64.64%), Query Frame = 1
Query:  358 DSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDK-----LVGLWNETLFNIITQ--KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRY-NPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D I   + G  A  T    + E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL+ L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYNVII Y ++Y+FAS  + LPW SCNN WNT  C+D+  +    L+ +   G    I  K     +    N T+ N  +Q  KT    +EEYF   VL +S  +   G ++W LA CLF +W+IV+  L KGIK++GK+VYFTA FPY VL+IL  RGV L GA  GI ++I P  +KL+DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDTLIVT  NSATSIFAGFVIFS +G +A     ++  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L   I  F +G P+ T+ G Y  QL+DTY   +A+++I IFE++ I +VYG          RF  DIE ++G   + +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  LGW+M   S+ +IP     ++F  + Y  P   I+R L+ +  P   WGP L +HR
Sbjct:  166 DGIASVLPGSVATTT----IPEDEQGDENKARGNWSSKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLMMLALAGLPIFFLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKL----LLDSCVIGDHPKIQIKNSTFCMTAYPNLTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIRWPLAFCLFLAWVIVYASLAKGIKTSGKVVYFTATFPYVVLVILLIRGVTLPGAGAGIWYFITPKWEKLTDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTLIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSISDEFPKYLRTHKPVFTLGCCICFFIMGFPMITQGGIYMFQLVDTYAASYALVIIAIFELVGISYVYGL--------QRFCEDIEMMIGFQPNIFWKVCWAFVTPTILTFILCFSFYQWEPMTYGSYRYPNWSMVLGWLMLACSVIWIP-----IMFVIKMYLAPGRFIER-LKLVCSPQPDWGPFLAQHR 768          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|A7Y2X0|SC6A5_XENLA (Sodium- and chloride-dependent glycine transporter 2 OS=Xenopus laevis OX=8355 GN=slc6a5 PE=2 SV=1)

HSP 1 Score: 545.043 bits (1403), Expect = 2.138e-180
Identity = 294/655 (44.89%), Postives = 418/655 (63.82%), Query Frame = 1
Query:  283 DHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRD--RLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKL--PAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLED 2235
            D +Q    +++E    K   +P+   ++ +  +G  +        +E  + +EN  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL  L L G+PIF ++V LGQF S GP + W+  P   G G AM+IIS L+A+YYN+I+ Y ++Y+FAS+   LPW SCNN WNT  C+D  RL + +C ++ +  N    + +  +    N T+ N  +   +     +EEYF   +L +S  +   G ++W L  CLF +WIIV+  L KGIK++GK+VY TA FPY VL+IL FRGV L GA DGI ++I+P  +KL DA+VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN+ RDTLIVT  NSATSIFAGFVIFS +G +A  L   +  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P  LR  K  F L+  +  F +G P+ T+ G Y LQL+D Y   +++++I IFE++ I ++YG          RF  DIE ++G   S +W++CW ++TPT+++ I+ FS++ +    YG   YP W+  +GW+M   S+ +IP   V  +F      P   I+R L+ +  P   WGP L KHR    +++ D
Sbjct:  130 DTNQGFGKNSLEQNNAKGDWVPISQSTVVLGTDGNTSVFPGTLTGDE--EGDENKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFKNGGGAFLIPYLTMLALAGLPIFYLEVALGQFASQGPISVWKAIPALQGCGIAMLIISVLIAIYYNIIMCYTIFYLFASLVYVLPWASCNNPWNTPDCKDKDRLLLDSC-IISSQPNIQIKNSTFCMTAYPNLTMVNFTSHGNKSFVSGSEEYFKYNMLKISAGIEYPGEIRWPLVFCLFLAWIIVYASLAKGIKTSGKVVYSTATFPYVVLVILLFRGVTLPGAGDGIWWFIMPKWEKLMDATVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNLYRDTLIVTCINSATSIFAGFVIFSVIGFMAHILNVDIEKVADQGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKLLRTHKPLFTLVCCVAFFIMGFPMITQGGIYMLQLVDNYAASYSLVIIAIFELVGISYIYGL--------QRFCEDIEMMIGFQPSRFWKICWAFVTPTILTFILGFSFYQWEPMTYGSYHYPSWSMVMGWLMLACSVIWIPIMFVIKMF----LAPGTFIER-LKLVCSPQPDWGPFLAKHRGERYKNMID 768          
BLAST of Transporter vs. UniProt/SwissProt
Match: sp|A7Y2W8|SC6A9_XENLA (Sodium- and chloride-dependent glycine transporter 1 OS=Xenopus laevis OX=8355 GN=slc6a9 PE=2 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 1.218e-167
Identity = 272/610 (44.59%), Postives = 396/610 (64.92%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSES 2244
            +E  K +EN +RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQF S G    W  +PIF G+GY M+++ST + +YYNV+I  A YY FAS++  LPW  CNN WNT+         NC+ + + ++   +++S +   L      N   ++T   P+EEY+   VL +S+D+   G VQ  L  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ L+GAI+GI +Y+ P   K+  A VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WSILFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   II F LG+PLTT++G YWL LMD Y   +++++I     I++ ++YG          ++ +DIE +LG P   ++++CW++I+P ++  I++F+   Y   +Y D +YP WA  +G++M + S+  IP   +Y +FK         ++R L++   P+  WGP+L +HR      +  + S
Sbjct:   11 SEATKKDENLKRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRVSPIFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFASMNRVLPWTYCNNLWNTN---------NCAGVLSPNSSASFNLSSQQNLLNLTLGLNQTLKRTS--PSEEYWRRHVLKISEDIGDFGEVQLPLLGCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAINGILYYLTPQWDKILHAMVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSIIISITNCATSVYAGFVIFSILGFMATHLGVDVSEVADHGPGLAFVAYPEALTLLPISPLWSILFFFMLILLGLGTQFCLLETLVTAVVDEIGNDWIIRWKTLVTLGVAIIGFLLGIPLTTQAGIYWLLLMDNYAASFSLVIISCIMCIAVMYIYGH--------RKYFKDIEMMLGFPPPLFFQICWRFISPGIIFFILIFTVIQYRPIQYNDYLYPDWAITIGFLMALSSVICIP---LYAIFKIWCSEGDTFLQR-LKNAVKPSKDWGPALQEHRTGRYAQMSSTRS 597          
BLAST of Transporter vs. TrEMBL
Match: A0A267H0B7 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022485g3 PE=3 SV=1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 356/689 (51.67%), Postives = 467/689 (67.78%), Query Frame = 1
Query:  286 HDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKY---GDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLED---SESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR 2334
             D+ I +   +  PK+       L  +       +A +  VN        +EN ERGNW G+ DF+LS LGYAVGLGN+WRFPY+C+ NGGGAF +PY+IFL L G+P+FL+D+ LGQFTS GP TCWE+APIFTG+GYAM  +ST+V +YYN+II+ ++YY+FAS+++ LPW SC+N+WNT  C  RL +V C+L     NGTCY+   KL+GL+NE+LF  +T+  R LPA+EYFN+EVL  S D+   G+  WKL +CL  SWI+++ C++KGIKS+GK+VYFTA+FPY VLLILFFRGV L+ AI+GI FYI+PD   L  A VWKDAA QIFFSLS SWGGL++LSSYNRFHNN+IRDT  VT  N  TS+FAGFVIFS++GHLA  L   V  V+  G GLAFIIYPEA+  +PGS  W+ILFF M++ LG+DSQF  +ET+IT   D +   LR  K   I +  +++F LGLP T   G Y + ++D+Y G W ILLIG FE +++GWVYGRPGF   K  RF  DI  I+ RPIS  WR  WQYI+P L+  II+F+W DY R++Y       YP WAD LGW++ + ++  I GT +  +F E    P+   K+ L  L++P+ KWGP+LP HRLL A +LE       +Y+D  + +KY D      E  N +    R
Sbjct:   79 RDRQIRELRAQLAPKEP------LQGLGNFTAAASAGEAPVN-----YSVDENPERGNWSGRLDFLLSCLGYAVGLGNVWRFPYLCFINGGGAFFVPYIIFLLLCGVPVFLLDLSLGQFTSEGPATCWEFAPIFTGVGYAMTYLSTIVGIYYNMIIAISIYYLFASMNSDLPWSSCDNAWNTPLCSSRLPLVTCNLSDQQLNGTCYN-GTKLLGLYNESLFTQVTKLHRILPADEYFNHEVLKTSSDINKFGSPDWKLVMCLLLSWIVIYCCMVKGIKSSGKVVYFTALFPYVVLLILFFRGVTLENAIEGIRFYILPDFSALGKARVWKDAAGQIFFSLSCSWGGLMSLSSYNRFHNNVIRDTFFVTSANCLTSVFAGFVIFSFIGHLAGNLKVPVKDVSQSGFGLAFIIYPEAMKLLPGSTFWAILFFFMILNLGVDSQFAMVETLITSLCDQFR-GLRRHKPPVIAVVSVVMFLLGLPFTCSGGLYLMNIVDSYAGSWTILLIGFFECVTVGWVYGRPGFG--KFHRFSEDIGLIMQRPISPIWRYLWQYISPALIMAIIIFNWVDYGRSEYTAGAGDFYPGWADALGWLIAIATVLIIFGTGLLKLFMEPSGTPW---KQRLLGLSIPSYKWGPALPSHRLLMASYLEKLGALRHFYLDPVKLIKYTDVFPSEQEFQNLDSAAQR 749          
BLAST of Transporter vs. TrEMBL
Match: A0A267F597 (Transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022485g1 PE=3 SV=1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 356/689 (51.67%), Postives = 466/689 (67.63%), Query Frame = 1
Query:  286 HDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKY---GDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLED---SESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR 2334
             D+ I +   +  PK+       L  +       +A +  VN        +EN ERGNW G+ DF+LS LGYAVGLGN+WRFPY+C+ NGGGAF +PY+IFL L G+P+FL+D+ LGQFTS GP TCWE+APIFTG+GYAM  +ST+V +YYN+II+ ++YY+FAS+++ LPW SC+N+WNT  C  RL +V C+L     NGTCY+   KL+GL+NE+LF  +T+  R LPA+EYFN+EVL  S D+   G+  WKL LCL  SWI+++ C++KGIKS+GK+VYFTA+FPY VLLILFFRGV L+ AI+GI FYI+PD   L  A VWKDAA QIFFSLS SWGGL++LSSYNRFHNN+IRDT  VT  N  TS+FAGFVIFS++GHLA  L   V  V+  G GLAFIIYPEA+  +PGS  W+ILFF M++ LG+DSQF  +ET+IT   D +   LR  K   I +  +++F LGLP T   G Y + ++D+Y G W ILLIG FE +++GWVYGRPGF      RF  DI  I+ RPIS  WR  WQYI+P L+  II+F+W DY R++Y       YP WAD LGW++ + ++  I GT +  +F E    P+   K+ L  L++P+ KWGP+LP HRLL A +LE       +Y+D  + +KY D      E  N +    R
Sbjct:   80 RDRQIRELRAQLAPKEP------LQGLGNFTAAASAGEAPVN-----YSVDENPERGNWSGRLDFLLSCLGYAVGLGNVWRFPYLCFINGGGAFFVPYIIFLLLCGVPVFLLDLSLGQFTSEGPATCWEFAPIFTGVGYAMTYLSTIVGIYYNMIIAISIYYLFASMNSDLPWSSCDNAWNTPLCSSRLPLVTCNLSDQQLNGTCYN-GTKLLGLYNESLFTQVTKLHRILPADEYFNHEVLKTSSDINKFGSPDWKLVLCLLLSWIVIYCCMVKGIKSSGKVVYFTALFPYVVLLILFFRGVTLENAIEGIRFYIVPDFSALGKARVWKDAAGQIFFSLSCSWGGLMSLSSYNRFHNNVIRDTFFVTSANCLTSVFAGFVIFSFIGHLAGNLKVPVKDVSQSGFGLAFIIYPEAMKLLPGSTFWAILFFFMILNLGVDSQFAMVETLITSLCDQFR-GLRRHKPPVIAVVSVVMFLLGLPFTCSGGLYLMNIVDSYAGSWTILLIGFFECVTVGWVYGRPGFG--NFHRFSEDIGLIMQRPISPIWRYLWQYISPALIMAIIIFNWVDYGRSEYTAGAGDFYPGWADALGWLIAIATVLIIFGTGLLKLFMEPSGTPW---KQRLLGLSIPSYKWGPALPSHRLLMASYLEKLGALRHFYLDPVKLIKYTDVFPSEQEFQNLDSAAQR 750          
BLAST of Transporter vs. TrEMBL
Match: T1FPK8 (Transporter OS=Helobdella robusta OX=6412 GN=20210755 PE=3 SV=1)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 333/656 (50.76%), Postives = 443/656 (67.53%), Query Frame = 1
Query:  430 KSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISN--PLPWISCNNSWNTDYCRDRLSIVNCSLMKAF--SNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLA----------------ARHLEDSESYY--IDVARRLKYGDFVHLSNEQNNHNEPHN 2331
             ++EN ERGNW GK DF+LS LGYAVGLGN+WRFPY+CYRNGGGAF+IPY I L L+GMP+F +++ LGQFTS GP  CWE+AP+F G+G A +++S LV++YYN+II+++++Y+F+S  N   +PW SC+N WNT YC DR+  V C+       +NGTC   +  LVG+W+   F  +T   RK P+EEY+ N VL LS  +  +G ++W L L L  +WII FLC+IKGIK+TGK+VYFTA+FPY VLLILF RGV L GA  GI +Y+ PD  +L DA VW DAA Q+FFS+S  WGGLI LSSYNRFHNN +RDT+IVT+ N AT IFAGFVIFS+LG +A  +G SV  V D G GLAFI+YP+AV  MP S +WSILFF+ML+TLGLDSQF T+ETV+T  +D  P+ LR +K W ++   ++LF LGLPL T+ G Y LQLMD+Y  GW +LLIG+ E I++ WVYG          R   D+E +LGR    WW++CW+++TP  +  +++F+W DY  A YG  +YP WAD +GW M++ S+ +IP   V+ + KE       SI + +  LT+PT  WGP+LPKHR+L                   ++ D+  +    D +R+         S   NNH+ P N
Sbjct:   12 SNDENVERGNWSGKLDFLLSLLGYAVGLGNVWRFPYLCYRNGGGAFLIPYTIVLVLVGMPMFYLELVLGQFTSCGPLNCWEFAPLFQGLGMAQLVVSILVSIYYNMIIAWSLFYLFSSFINITNVPWSSCSNPWNTPYCYDRMPDVPCNSSNDIQEANGTCTH-NGVLVGVWDVQTFQNLTNLKRKTPSEEYYINRVLGLSSGIEELGELRWDLVLSLVLAWIISFLCMIKGIKTTGKVVYFTALFPYVVLLILFGRGVSLQGANQGILYYLKPDFNRLKDARVWNDAAIQMFFSMSNCWGGLITLSSYNRFHNNCMRDTIIVTLSNWATGIFAGFVIFSFLGFMAHSMGVSVDKVVDSGPGLAFIVYPDAVTKMPISSLWSILFFLMLLTLGLDSQFATLETVLTSILDQLPM-LRRKKMWVVMFMCLLLFLLGLPLCTRGGSYLLQLMDSYSSGWGLLLIGVIECIALAWVYGCN--------RLYNDMEVMLGRKDVVWWKICWRFLTPAFILFVLIFTWADYKPATYGSYVYPRWADVMGWSMSLCSVIWIPIVAVWKICKEYD----GSICKRIYLLTIPTRSWGPALPKHRMLVNYVDGFQVYPDKPTFQLSNVHDNAGFENAADSSRQSNSTPQPLASTTDNNHHHPMN 653          
BLAST of Transporter vs. TrEMBL
Match: A0A210Q779 (Transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12079 PE=3 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 338/695 (48.63%), Postives = 463/695 (66.62%), Query Frame = 1
Query:  214 KLHKIFDINLSKAMKSEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMN----------------GCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTT------------KSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLL 2214
            KL  +  I+    +    + S+   +  +ND + E+    ++  P    +I+ SMN                G    +   ++  +    +EN ERGNW G+ DF+LS LGYAVGLGN+WRFPY+CYRNGGGAF+IP++I + +IG+P+F ++  LGQF S+GP TCW++AP+F G+G AMVI+S   ++YYN+I+++A +YMFAS ++ LPW  CNN WN+  C  +L +V C + + F NG+C+ +S K  GLWN+TLF   T + R  PAEEYFNN  L LS  +   G  +W+L LCL  +W + FLCLIKGIK+TGK+VYFTAIFPY VL+ILFFRG+ L+GA  G+ +YI+P+  +L DA VWKDAA QIFFS+S + GGL+ LSSYNRFHNNI++D++IV++G++ T IFAGFVIFSYLG +A +L   V  VA  G GLAF++YPEAV  +P   +WSILFF MLITLGLDSQF  +ETV+TG +D +P +LRP+KT  IL   I+ FFLGLPLT               G Y LQLMD Y GGW +L+IG+FE I + +VYG          RF +DIET+LG  +  WW++CW  I+P  +  + +F++ DYT ++YGD  YP WAD LGW+M  LS+  IP T++Y + KE   +    I+++ + L  PT +WGP+L KHR L
Sbjct:   32 KLPDLVGIDYPVKLPGRRQNSV--SNDALNDADSESTSVDSRINP---RNIKTSMNPGVYRPKRGHSRTPSRGTMMTEETTDSRKQIFGVDENEERGNWSGRFDFLLSLLGYAVGLGNVWRFPYLCYRNGGGAFLIPFIIMMIIIGVPLFFMEACLGQFCSSGPMTCWKFAPLFKGVGIAMVIVSAGTSMYYNMILAWAYFYMFASFTSTLPWQGCNNYWNSKDCSLKLPLVKCEVGEKFLNGSCF-VSGKFKGLWNDTLFTNATGRKRISPAEEYFNNRALGLSDGLEDFGQPRWELVLCLLLAWFVCFLCLIKGIKTTGKVVYFTAIFPYVVLVILFFRGITLEGAGKGVYYYIVPEWGRLLDARVWKDAAVQIFFSMSIAGGGLVTLSSYNRFHNNILKDSVIVSLGDTLTCIFAGFVIFSYLGFMANKLNVEVKDVAKDGAGLAFVVYPEAVTNLPPPPLWSILFFFMLITLGLDSQFAMLETVLTGVLDQFP-HLRPKKTLVILCICIVFFFLGLPLTELTFCLPCMSSLLPGGMYLLQLMDNYVGGWTLLIIGLFENICVAYVYGV--------NRFLKDIETMLGFKMVMWWKICWWVISPVTLVALFIFTFVDYTPSEYGDYKYPGWADALGWIMAFLSVLAIPITMLYKISKEDDED--GCIEKV-KLLLTPTREWGPALVKHRKL 708          
BLAST of Transporter vs. TrEMBL
Match: A0A210Q798 (Transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12084 PE=3 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 322/637 (50.55%), Postives = 438/637 (68.76%), Query Frame = 1
Query:  433 SEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKA--FSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARR------LKYGDFVHLSNEQNNHN 2319
             +EN ERGNW G+ DF+LS LGY+VGLGNIWRFPY+CY+NGGGAF+IPY+I L ++G+P+F ++  +GQF+S GP +CW +AP+F G+G AMVIIS +V +YYN+I+S+A+ Y FAS ++ LPW +C N WNT  C  +L  VNC++ +   ++NGTCY+  +K VGLWN T F   T + R  P+EEY+NN VL +S  +  +G  +W+L L LFG+W + FLCLIKGIK+TGK+VYFTAIFPY VL+ILFFRGV L  A +GI FYI+P   KL DA VW+D A Q+F+SL   WGGLIALSSYNRFHNNI+ D +IV++G+  TSIF GFV+FSYLG++A +LG  V  VA  G GLAF++YPEAV  +P   +WS+LFF MLITLGLDS+F  +ETV+TG  D +P  LRP+K++ IL   I  F LGLP+TT  G YWLQL+D Y G W++L+IG+ E++ I  +YG          RF  DIE + G   S WW++CW  I+P  M  I++FS+ DY+   Y   +YP WA+ LGW++++ S+ FIP  ++Y + KE   N    +   ++ L  P+  WGP+L KHR L    ++  E + +D  +       + YG    +SN Q   +
Sbjct:  103 EDENEERGNWTGRFDFLLSMLGYSVGLGNIWRFPYLCYKNGGGAFLIPYVIMLLVVGIPLFYLETCIGQFSSRGPLSCWGFAPLFQGLGVAMVIISGIVTLYYNMIVSWAILYFFASFTSSLPWSTCENPWNTKDCSLKLPRVNCTVTEGVKYTNGTCYN-REKFVGLWNTTQFTTSTGRLRITPSEEYWNNYVLGISSGIDDMGPPRWQLTLSLFGAWFLCFLCLIKGIKTTGKVVYFTAIFPYVVLIILFFRGVTLPNASEGIYFYIVPTFDKLLDAKVWRDGAVQVFYSLGPGWGGLIALSSYNRFHNNILGDAIIVSLGDGLTSIFGGFVVFSYLGYMAGQLGVGVKDVARSGAGLAFVVYPEAVNNLPPPTLWSLLFFFMLITLGLDSEFAMLETVLTGLTDYFP-SLRPKKSFVILFVCIFCFLLGLPITTSGGMYWLQLLDHYVGSWSLLVIGLTELMVINLIYGI--------NRFLSDIEVMQGYRPSIWWKICWLGISPAGMVFILVFSFVDYSPITYDAYVYPAWAEALGWLLSLCSIIFIPIVIIYKISKE---NDEKGLINKVKLLLAPSRDWGPALVKHREL----VDYVEGFVLDPEKEKQELSFINYGYNTSVSNLQTTSS 722          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:103047067])

HSP 1 Score: 496.123 bits (1276), Expect = 2.001e-164
Identity = 281/629 (44.67%), Postives = 386/629 (61.37%), Query Frame = 1
Query:  388 NANDTNVNAV---NEYLKSE-ENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCN-------NSWNTDYCRDRLSIVNCSLMK------AFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYI--IPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPIS---NWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
             A+D   NAV   + ++ +E EN ERGNW  K +++LS +GYAVGLGN+WRFPY+ Y++GGGAF+IPY+I L + G+P+F ++   GQF S GP   W+  PI  G+G  M+++ST VA+YYNVI++Y++YY+FAS   PLPW +C+       N   T+YC    +  N SL+       A  N +C +               +I     +  +E+Y++   L  +  +   G V W LALCL   WI++   L KGIKS+GK+VYFTA FPY VLLIL  RGV L+GA +GI +YI    +L KLS+A VWKDAA QIFFSLS +WGGL AL+SYN+FHNN  +D++IV + N  TSIFAGF IFS LGH+A   G  VS VA  G GLAFI YP+A++ +P S +WSILFF MLITLGLDSQF  IE + T   D YP +L+ ++    ++  ++LF LGLP  T +G YW+ L+DT+  GW +L+ G+ EV  +  +YG          RF +DIE ++G   +    WWR CW +ITP ++  I+ +S + +T   YG   YP W   LGW MT   L +IP   V+ + K         + + ++   VPT  WGP L +HR
Sbjct:   18 TASDEAKNAVKSQDPHVGTEDENAERGNWSSKREYMLSMIGYAVGLGNVWRFPYLAYKHGGGAFLIPYVIMLSIAGLPLFFLESSFGQFCSQGPINVWKAVPILQGVGITMMLVSTFVAIYYNVILAYSIYYLFASFQYPLPWSNCSGWSDMGCNINATEYCNT--TSYNGSLVALNRSAGADGNQSCPE--------------ELIVSTPLQTISEQYWDVVALQRTSSMDETGPVVWHLALCLLLGWIMIGAALFKGIKSSGKVVYFTATFPYAVLLILLIRGVTLEGARNGIEYYIGSQSNLTKLSEAEVWKDAATQIFFSLSIAWGGLTALASYNKFHNNCYKDSIIVCVTNCGTSIFAGFAIFSILGHMAHVYGKPVSEVAQAGFGLAFIAYPDALSKLPISPLWSILFFFMLITLGLDSQFAGIEVITTCLQDAYPKFLKSKRGLITVIICVVLFLLGLPCVTGAGIYWVNLIDTFVAGWILLVAGLLEVFGLSCIYGGN--------RFIKDIEMMIGNKSAIFWIWWRSCWFFITPFVLLVILGWSVYTFTAPTYGTVEYPEWGIALGWCMTAFCLMWIPIVAVWRIAKAS-----GGLWQRIKSTCVPTEDWGPYLERHR 617          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 492.656 bits (1267), Expect = 6.359e-163
Identity = 275/613 (44.86%), Postives = 393/613 (64.11%), Query Frame = 1
Query:  373 SMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            S   C A D N     E +K +EN+ RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQFTS G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C     +V    +    N +  +IS  + G+       ++ +  R  P+EEY+ N VLN+S  +   G V+  +  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ L+GAI GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I+++ N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT       ++ F LG+PLTT++G YWL LMD Y   +++++I     I I +VYG           + +D+E +LG P   ++R+CW++I+P ++S I++F+   Y    Y D +YP W+  +G+ M + S+  IP   VY +FK         ++R+   L  P   WGP+L +HR
Sbjct:    6 STMACRA-DQNGAVPGEQVKKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCS---GVVGSQRL----NASIANISAVVSGV-----TEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGH--------RNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIP---VYALFKIATSEGSTFLERLKYSLK-PHPSWGPALQEHR 593          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:103034591])

HSP 1 Score: 489.189 bits (1258), Expect = 1.553e-161
Identity = 270/598 (45.15%), Postives = 388/598 (64.88%), Query Frame = 1
Query:  418 NEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
             E +K +EN+ RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM PY I L   G+P+F +++  GQFTS G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C     +V    +    N +  +IS  + G+       ++ +  R  P+EEY+ N VLN+S  +   G V+  +  CL  SW++VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ L+GAI GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I+++ N ATS++AGFVIFS LG +A  LG  VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT       ++ F LG+PLTT++G YWL LMD Y   +++++I     I I +VYG           + +D+E +LG P   ++R+CW++I+P ++S I++F+   Y    Y D +YP W+  +G+ M + S+  IP   VY +FK         ++R+   L  P   WGP+L +HR
Sbjct:   16 GEQVKKDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMFPYFIMLVFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCS---GVVGSQRL----NASIANISAVVSGV-----TEVVNRTKRTSPSEEYWRNYVLNISDGIGNFGEVRLPILGCLAISWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLEGAISGIKYYLTPQWQKILDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISVTNCATSVYAGFVIFSILGFMAHHLGVDVSQVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTIITFGVAVVGFLLGVPLTTRAGIYWLLLMDNYAASFSLVIISCIMCICIMYVYGH--------RNYFKDVEMMLGFPPPIFFRICWRFISPLIISFILIFTVIQYKPITYNDYVYPRWSLVIGFCMALSSVICIP---VYALFKIATSEGSTFLERLKYSLK-PHPSWGPALQEHR 589          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a11b (solute carrier family 6 member 11 [Source:NCBI gene;Acc:103035223])

HSP 1 Score: 442.965 bits (1138), Expect = 2.986e-144
Identity = 252/618 (40.78%), Postives = 355/618 (57.44%), Query Frame = 1
Query:  337 KNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP--RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCG-GWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGD-KIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPT 2175
            K IP++      +M+   A++TN+   N+    +  NERG W  K +F+LS  G  +GLGN+WRFPY+CY+NGGGAF +PY+IF    G+P+F ++  LGQFTS G  TCW +  P+F GIGYA  +I   + VYY VI+S+A++Y+    +  LPW +C + WNT+ C D            F+N +  ++                T      P  E++   VL++S  +  +G ++W+LALCL  +WII + C+ KG KSTGK+VY TA FPYF+L+IL  RG+ L GA DGI FY+ PD+ +LSD  VW DA  QIFFS +   G L AL SYN ++NN  RD +++   NS TS  AGF IFS LG +A      +  VA+ G GLAFI YP+AV  MP + +W+  FFVMLI LGLDSQF  +E+++T  VD+YP   R   R+   IL   ++ + LGL + T+ G Y  QL D+Y   G  +L + IFE I IGWVYG          RF  +IE ++G     + + CW+ +TP + SGI LF    Y   KY +   YP W   +GW M + S+  IP  ++  ++K        +    ++ LT P 
Sbjct:    5 KTIPIINGKPDDAMDA-EASNTNLVRSND---KKVVNERGQWNNKIEFVLSVAGEIIGLGNVWRFPYLCYKNGGGAFFVPYVIFFVCCGIPVFFLETALGQFTSEGGITCWRKVCPLFEGIGYATQVIEAHLNVYYVVILSWAIFYLLNCFTTELPWANCGHYWNTENCVD------------FNNASIENL----------------TNPYATSPVMEFWERRVLSISDGIEHVGKLRWELALCLLVAWIICYFCIWKGPKSTGKVVYVTATFPYFMLVILLIRGITLPGAADGIKFYLYPDISRLSDPQVWVDAGTQIFFSYAICLGCLTALGSYNSYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQNVPIEAVAESGPGLAFIAYPKAVTMMPWAPLWAFFFFVMLIFLGLDSQFVCVESLVTAVVDMYPKTFRVGYRRELLILGMSVVSYLLGLTMLTEGGMYVFQLFDSYAASGMCLLFVAIFESICIGWVYGSD--------RFYMNIEDMIGYKPIFFIKWCWKILTPGICSGIFLFFLIKYKPLKYNNVYTYPDWGYGIGWTMAMSSMVCIPLGIIIQIWKTE-----GTFMERIKKLTTPA 577          
BLAST of Transporter vs. Ensembl Cavefish
Match: slc6a1l (solute carrier family 6 member 1, like [Source:ZFIN;Acc:ZDB-GENE-041210-296])

HSP 1 Score: 441.425 bits (1134), Expect = 8.064e-144
Identity = 246/567 (43.39%), Postives = 336/567 (59.26%), Query Frame = 1
Query:  421 EYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTY-CGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKER 2118
            E  K  E  +RG W GK DF+LS +GYA+GLGN+WRFPY+C +NGGGAF+IPY   L   G+P+FL++  LGQ+TS G    W+  P+  G+G A  ++S  + +YY +IIS+A+YY+F+S ++ LPW SC N WNT+ C              FSN   Y + D           N+ +  T      E++   +  L+  +   G ++W L   L  +W++V+  + KG++ TGK+VYF+A +PYF+L ILFFRGV L GAIDG+ FYI PD  KL  + VW DAA QIFFS     G LIAL SYN F+NN+ RD +IV   NS TS+FAG VIFS +G ++      +  +A  G GLAF+ YP+AV  +P S +WSILFF ML+ LGLDSQF T+E  IT  +D YP  LR RK  FIL+  II F +GL   T+ G Y  +L D Y   G  +L +  FE ++I W YG          RF  +IE ++G     WW+LCW Y TP +  G+  FS  + T    G  +YP W   +GW+M + S+  IPG V+Y+    +
Sbjct:   34 EEEKKSELPDRGTWKGKFDFLLSCIGYAIGLGNVWRFPYLCGKNGGGAFLIPYFTTLVFAGIPLFLLETALGQYTSVGGLGVWKLIPMMKGVGLAAAVLSFWLNIYYIIIISWALYYLFSSFTSELPWQSCENPWNTESC--------------FSN---YSLPDTT---------NLTSAVT------EFWERNMHQLTDGLEEPGELRWPLVGTLALAWVLVYFSIWKGVEWTGKVVYFSATYPYFMLFILFFRGVTLPGAIDGVLFYITPDFNKLLKSEVWLDAATQIFFSYGLGLGSLIALGSYNPFNNNVYRDAVIVCCINSFTSMFAGIVIFSIVGFMSNITKKPIQELAASGPGLAFLAYPQAVTQLPMSSLWSILFFSMLLMLGLDSQFCTVEGFITALMDEYPSVLRKRKKVFILIVCIISFLIGLSNITQGGLYVFKLFDYYSASGMCLLFLVFFETVAIAWFYGAD--------RFYSNIEEMIGYRPCGWWKLCWLYFTPLICLGVFTFSAIEMTPLTLGKYVYPAWGQGIGWLMALSSMVLIPGYVIYMFLSTK 560          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 446.047 bits (1146), Expect = 3.150e-147
Identity = 241/565 (42.65%), Postives = 340/565 (60.18%), Query Frame = 1
Query:  430 KSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNII-RDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTY-CGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKER 2118
            K +E   RG W G+ DF++S +GYA+GLGN+WRFPY+C +NGGGAF+IPY + L   G+P+FL++  LGQ+TS G    W+ AP+F G+G A V+IS  + +YY VIIS+A+YY++ S ++ LPW  CNN WNTD C    SI++ +           +++  +V  W   +                       LS  +   G V+  LA+ L  SW++V+ C+ KG+  TGK+VYF+A FPY +L +LFFRG+ L GA +GI FYI PD ++L+D++VW DAA QIFFS     G L+AL SYN FHNN+  RD++IV   NS TS+FAGFVIFS +G ++      V  +A  G GLAF+ YP+AV  +P S +WSILFF ML+ LGLDSQF T+E  +T   D YP YLR  K  FI +  +I + +GL   T+ G Y  ++ D Y   G ++L +  FE I+I W YG          RF  +I  ++G  +  WW +CW + TP ++ G+ +FS  + T    G   YP+W   +GW M + S+  IPG +VYL    +
Sbjct:    3 KKKELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVVISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSILDTT-----------NLTSTVVEFWERNMH---------------------QLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKPVKELAASGPGLAFLAYPQAVTQLPISPLWSILFFSMLLMLGLDSQFCTVEGFVTALSDEYPQYLRGHKEIFIAVICVISYIIGLANITQGGLYVFKMFDYYSASGMSLLFLVFFETIAISWCYGVD--------RFNDNICEMIGHKVHKWWNICWVFFTPLVVVGVFMFSVVEMTPLTLGSYTYPMWGQGMGWFMALSSMLLIPGYMVYLFLVSK 527          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 345.125 bits (884), Expect = 8.939e-109
Identity = 210/522 (40.23%), Postives = 301/522 (57.66%), Query Frame = 1
Query:  559 GAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWE-YAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNL--SKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVA-DKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFK 2112
            GAF+IPY +     G+P+F +++ LGQF  NG  + W    PIF G+G+A+ II+  VA YYN II++A+YY+++S ++ LPW  C+N WNT         VNC+        + +D +    G            K  + PAEE++   VL +  SK +  +G ++W+L LCLF  + IV+  L KG+K++GK+V+ TA FPY VL IL  RG  L GA  G+ FY+ P+ KKL    VW DAA QIFFSL   +G L+AL+SYN+F+NN  RD L+ +  N  TS  +GFVIF+ LG++A+     V  VA D G  L FI YPEA+A M GS  W+ILFF+M+ITLGLDS F  +E +IT  +D YP     R+ +F+L  V I F   L   T  G Y ++L++ +  G +I+ I + E I++ W YG          RF  DI ++LG     +WRLCW  I+P  +S I++         K  D  +P W+  LG+ +   S  F+P   +Y+ +K
Sbjct:    1 GAFLIPYCLMAVFGGIPLFYMELALGQFHRNGAISIWRRICPIFKGVGFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNT---------VNCT--------SYFDTTGVAWG------------KHSRSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIFTVLGYMAEMRNVEVEDVAKDMGPSLLFITYPEAIANMMGSTFWAILFFMMMITLGLDSTFGGLEAIITAVMDEYPSLFSKRREYFVLGLVTICFMGALSTLTYGGAYIVKLLEEFGSGCSIIGIVLLEAIAVSWFYGVK--------RFCADIHSMLGFSPGYFWRLCWVAISPLFLSFIVVSFLTGSKPLKLFDYDFPDWSMILGYFIAASSFMFVP---LYMAYK 482          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008631.1 (pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 gene:ENSPMAG00000007785.1 transcript:ENSPMAT00000008631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.664 bits (753), Expect = 5.521e-90
Identity = 193/521 (37.04%), Postives = 301/521 (57.77%), Query Frame = 1
Query:  559 GAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNP-LPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYL--RPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCG-GWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILG-RPIS-NWWRLCWQYITPTLMSGIILFSWFDYTRAKY-GDKIYPIWADFLGWMMTVLSLAFIPGTVVY 2100
            GAF++PY + +  +G+P+F ++V LGQ T  G    W+  P+FTG+G A +++  L  +YY V++++++YY+  S++   LPW  C   W T  C D L     +   +     C D +                      PA E++   VL +S  +  +G+V W++ LCL   W++V+  + KGIK +GK+VY T   PY +LL+L  +GV L GA+DGI +Y+ PD  KL+   VW +A+ Q+F+     +G L AL SYN+FHNN  RD++I+TI NSATS F+GFV+FS+LG +A+  G  +S VA+ G GL F++YP A++ +P   +W+ L F+ML+ LG+DS+F  +E  +TG  D++P  L  + R+  F  L  ++ F L + + T+ G Y  QL D+Y   G ++L +  +E I++ WVYG          RF +D+  +LG RP +  WW  CW  ++P +  GI +F    Y R  Y G   YP WA+ LGW++ + S+  IP   +Y
Sbjct:    1 GAFLVPYGLTVVCVGIPLFFLEVALGQLTQQGTIGVWKIVPLFTGVGVASMVVVFLSDLYYIVVLAWSLYYLLHSLTTAQLPWTHCQGWWATAACSDTLGTSRAASNASEGASACQDTTS---------------------PAVEFWERNVLRVSSGMHDLGSVNWEMLLCLLAVWLLVYFSVWKGIKFSGKVVYVTGSVPYVLLLVLLVQGVMLPGALDGITYYLQPDWAKLATPQVWVEASTQVFYCYGVGFGVLPALGSYNKFHNNCYRDSIILTIINSATSFFSGFVVFSFLGFMAQEQGVDISHVAETGPGLVFVVYPRAISLLPVPALWATLLFIMLLLLGVDSEFAGMEGFVTGLTDLFPSQLSGKRRREAFTGLCCLVSFLLSVTMVTQGGIYVFQLFDSYAASGISMLWLMGWECIAVAWVYGAN--------RFMQDLTAMLGFRPHAWVWW--CWSVVSPAVCLGIFVFHLVHYERLVYNGRYEYPGWAEALGWLLALSSMLCIPAVALY 490          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.299 bits (656), Expect = 2.078e-79
Identity = 131/281 (46.62%), Postives = 179/281 (63.70%), Query Frame = 1
Query:  436 EENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDY-CRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYI--IPDLKKLSDASV 1269
            +EN ERGNW  K +++LS +G AVGLGN+WRFPY+ Y+NGGGAF+IPY+I L  +G+P+F ++  +GQF S GP T W+  P+  G+G+ MVI S+L+A+YYN II+Y ++Y+FAS ++ LPW SC   W  D  C DR S+ N SL    + G C  ++                  +++ P+E+Y+N   L  S+ +   G V W LAL L  SWI+    L+KGIKS+GK+VYFTAIFPY VL+IL  RG  L GAI GI +YI    +  KL  A V
Sbjct:    1 DENAERGNWASKSEYMLSMIGNAVGLGNLWRFPYLAYKNGGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGLGWMMVITSSLIALYYNSIIAYGLFYLFASFTSELPWSSCKKWWGADENCFDR-SVCNSSL----AEGNCSSVNS-----------------SKQTPSEQYWNKYALRRSESMDETGDVVWHLALTLLLSWIVTCAALVKGIKSSGKVVYFTAIFPYVVLIILLIRGATLPGAILGIEYYIGRQSNFTKLQSAEV 259          
BLAST of Transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.202 bits (622), Expect = 7.038e-73
Identity = 142/334 (42.51%), Postives = 193/334 (57.78%), Query Frame = 1
Query: 1129 KIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP--RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTY-CGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDK-IYPIWADFLGWMMTVLSLAFIPGTVVYLVFKER 2118
            ++VYFTA FPY VL+ILF  G+ L G+ DGI +Y+ PD  KL    VW DA  QIFFS +   G L AL SYNRF+NN  RDT I+ + NS TS FAGFV+FS LG +A   G  +S VA+ G GLAFI YP+AV+ MP + +W+ LFF MLI LGLDSQF  +E  +TG  D++P  L    R+  F+ +     F + + + T+ G Y  QL D Y   G  +L    +E I + WVY           RF  +I  ++G     W R CW ++TP + +GI LF+  +Y    Y    +YP W + LGW M + S+  IP   +Y + + +
Sbjct:    1 QVVYFTATFPYLVLIILFINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQVAESGPGLAFIAYPKAVSLMPMAPLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTGGYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGD-------RFMDNIALMIGYRPFPWMRWCWAFVTPCVCTGIFLFNLLNYKPLTYNKGYVYPWWGEALGWCMALSSMLCIPVVAIYRLARTK 327          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO31545 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0])

HSP 1 Score: 485.723 bits (1249), Expect = 1.652e-161
Identity = 260/588 (44.22%), Postives = 371/588 (63.10%), Query Frame = 1
Query:  442 NNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCW-EYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYC-RDRL-SIVNCSLMKAFSNGTCYD-ISDKLVGLWNETLFNIITQ----KTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFK------ERRYNPYHSIKRILQDL 2163
             NER  W  K DF+LS +G+AVGLGN+WRFPY+CY NGGGAF++PYLI L L GMP+F +++  GQ+ S GP   W    P+F GIG+A ++IS LV VYYNVII++ +Y++  S  + + W  C+N WNTD C   R+   ++CSL    +N      +++  V   N T  N  T+    + +  P+ E++ N +L LS  +   G ++W++ +CL  +W+ V+ C+ KG+KS+GK+VYFTA FPY VL ILF RGV L GA  GIAFY+ P+  +L D  VW  AA QIF+SL   +G L+A+ SYN+FHNNI +D + +++ N  TS+FAGFVIFS LG ++  L   +  VA+ G GLAF++YPEA+A MP S +W+ILFF M++TLGLDSQF  +E VITG +D YP+  R RK  FI +   + F LG+   T+ G Y L L D   GG ++L +G FE + + W+YG          RF +DIE ++G   + WWR  W++  PT+M+GI  +S   +    YG   YP WA+F GW++ + S+ FIPG  +Y+++K      ER        + ILQ++
Sbjct:    3 TNERETWGKKADFLLSCIGFAVGLGNVWRFPYLCYANGGGAFLLPYLIMLVLCGMPMFFMELSAGQYFSLGPIGVWGAICPLFRGIGFASIVISFLVCVYYNVIIAWCLYFLAVSFRSEVLWKHCDNWWNTDNCYAGRIPESMSCSLGSGSNNSLVNSTLANATVLAANAT--NATTECLFPENQVSPSLEFWENYILRLSDGIGEAGEIRWQILVCLILAWVGVYFCMWKGVKSSGKVVYFTATFPYLVLFILFVRGVTLPGADKGIAFYLKPEWHRLKDPKVWVAAATQIFYSLGIGFGSLVAMGSYNKFHNNIFKDAISISLINCGTSVFAGFVIFSTLGFMSHVLNKPIEEVANSGPGLAFVVYPEAIAQMPISPLWAILFFFMILTLGLDSQFGMMEAVITGIIDEYPV-CRKRKELFIAVACFLCFLLGITNVTQGGAYVLNLFDYQSGGVSLLFLGFFETVCLAWIYGAD--------RFSKDIEDMVGSRPAAWWRFTWKFCAPTVMAGIFFYSIIFWQGVSYGSYKYPQWAEFFGWVIALSSMLFIPGNAIYMIWKTPGTLRERVTFLLKPDRNILQEI 579          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO49218 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4])

HSP 1 Score: 484.567 bits (1246), Expect = 5.790e-161
Identity = 264/613 (43.07%), Postives = 372/613 (60.69%), Query Frame = 1
Query:  403 NVNAVNEYLKSEEN---------NERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEY-APIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERR--YNPYHSIKRILQDLTVPTIKWGPSLPKH 2205
            N +A  E L S+EN          ER  W  K +F L+ +GYAVGLGN+WRFPY+C++NGGGAF+IPYL  L + GMP+F +++ LGQF S GP T W    PI  G+G+AM+++S L  VYYNVII++ +YY+F S +  +PW +C+N WNT          NC+           +++D  +             K    P++E++ N VL ++ D+   G ++W+L +CL  +W++V+ CL KGIKS+GK+VYFTA FPY VL+IL  RG+ L GA+ G++FY+ P+  KL DA VW DAA QIF+SL   +G LIA+ SYN+FHNN  RD + V++ N +TS+FAG VIFS LG +A+ LG  VS VA  G GLAF++YPE +A MP S  WSI FF ML+TLGLD+QF   E V TG  D Y   LR RK  F        F LGLP+ ++SG + + L     GG +++ +  FEVI + W YG          RF  DIET+ G  +  WW + W+YITP +++GI +FS   +    Y D  YP WA+F+GW+M + S+ +IPG  +Y + + +      + S+ R  Q+  +  I+    +PK 
Sbjct:   13 NGDADGEGLTSDENCKIDVEIIGEEREKWGRKVEFFLACVGYAVGLGNVWRFPYLCFKNGGGAFLIPYLCMLLICGMPLFFMELSLGQFVSLGPVTSWAAICPISKGVGFAMLVVSFLCCVYYNVIIAWCLYYLFESFAKDVPWKTCDNWWNTA--------TNCT----------SNLTDTAL-------------KEYSSPSKEFYENYVLRITPDIDTFGVMRWQLVVCLILAWVLVYFCLWKGIKSSGKVVYFTATFPYLVLVILLIRGLTLPGAMKGLSFYLKPNFSKLGDAIVWVDAATQIFYSLGIGFGSLIAMGSYNKFHNNCFRDAMTVSVINCSTSVFAGLVIFSVLGFMAEVLGKEVSEVATSGPGLAFVVYPEGIAQMPISPFWSICFFFMLLTLGLDTQFAMFEAVTTGLGDEYVRLLRNRKELFTAFLCFCCFLLGLPIVSQSGAFIMNLYVWQAGGVSLVFLAFFEVIVVAWGYGAD--------RFALDIETMTGNKVWPWWPIAWKYITPAVITGIFIFSLVQWQGVSYDDYQYPPWAEFVGWVMALSSMLWIPGVAIYKMSRAKGTFMERWRSLTRPDQE-QMSIIELREGIPKR 585          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO39707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977])

HSP 1 Score: 462.611 bits (1189), Expect = 2.349e-152
Identity = 245/581 (42.17%), Postives = 360/581 (61.96%), Query Frame = 1
Query:  394 NDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWE-YAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLS---IVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP---RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKE 2115
              T+ +  +  +  EE   R  W  K +F+LSSLGY VG GN+WRFPY+CY+NGG  F+IPY I L + G+P+F +++ +GQ+ S+G    W+   P+  GIGYA+ +IS L  +YY VI+++  YY+F S    +PW +C+N WNT +CR + S   ++NC+ +    N T    S                      P+ E+++N VL +++D++  G ++W L      SWI+V+ CL KGIKS+GK+VYFTA FP+ VL IL  RG  L+G++DG+ +Y+ PD ++L+D  VW  AA QI++SL   +G LI   SYN+F+NN+ +D L+++I N +TS FAGFV+FS LG +A  L T+V+ VA  G GLAF+ YPEA++ MP S +W++LFF MLITLGLDSQF TIE VIT  VD YP ++R    RK  F+L+  I L  LGLP   + G +   LMD    G ++L++ + E+I+IGW+YG          RF  D+E + GR    W+R+CW+Y++P     IIL +   +   KY  K YP WA+ +GWM+ + S+  IP   ++ ++K 
Sbjct:   20 GSTSSSEDSPQIDVEEEQTRDKWSSKAEFMLSSLGYCVGFGNVWRFPYLCYKNGGATFLIPYFIMLIVNGIPLFFLELAIGQWFSSGVIGVWKSICPLLKGIGYAICMISYLCCIYYIVILAWTFYYLFMSFQAVVPWKTCDNPWNTKFCRAKRSGDLLLNCTELDLPQNCTAKPTS----------------------PSGEFWSNNVLEMTEDISDFGDMRWPLFGTFILSWIVVYFCLFKGIKSSGKVVYFTATFPFIVLFILMIRGATLEGSLDGVIYYLNPDWERLADPQVWIYAATQIYWSLGVGFGALITFGSYNKFNNNVHKDALVISIANCSTSFFAGFVVFSVLGFMALTLDTTVAKVATSGPGLAFVAYPEAISQMPVSTLWAVLFFFMLITLGLDSQFATIEAVITAIVDEYP-WVRGTKWRKPVFVLILCISLCILGLPCVFQGGMWIFNLMDYQVAGLSLLIVALLEIITIGWIYGVD--------RFSDDVEYMTGRRPMRWFRICWKYVSPLCTLAIILANLIQWKGVKYNGKPYPGWAELIGWMLMLSSVLMIPAFAIHEIYKR 569          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 449.129 bits (1154), Expect = 2.541e-147
Identity = 252/559 (45.08%), Postives = 339/559 (60.64%), Query Frame = 1
Query:  427 LKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGT--CYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP--RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTY-CGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYG-DKIYPIWADFLGWMMTVLSLAFIP 2085
            + + E  ER  WVGK DFIL+ +G++VGLGNIWRFPY+CY+NGGG F+IPYLI L L G+P+ +++V LGQF S G  T W+  P+F GIGYA V+I   + +YY VI+ +A YYMF S    LPW  C+N WNT+ C      V   ++  F++G+  C         LW +              A +Y    VLN+S  +  IG + W++ALCL  +WI+ +LC+ KG+KSTG++VYFTA FPY +L I+  R V L GA +GI FY+ PD  +L D SVW  AA Q+FFS S   G LIAL SYN+F NN  RD +I    NS TS + GFVIFS LG +A++ G  +  VA+ G GLAFI YP AVA MP S +WSILFF M+I LGLDS+F  +E  +T  VD++P YLR   RK  FI       FF+GL + T+ G Y  QL D Y   G  +L I +FE I IGWVYG          RF +++  ++G  I+ + ++CW + TP     + +FS  +Y    Y     YP+W D +GW++ + S+  IP
Sbjct:    1 MVAAEVVERETWVGKLDFILALIGFSVGLGNIWRFPYLCYKNGGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVIVQYLNIYYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCH-----VGRKMITTFNSGSKCCQLFIKSFKCLWKD--------------AADY----VLNISGGLDQIGTINWQMALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIFSVLGFMAEKQGVPIQEVAESGPGLAFIAYPAAVAEMPISPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFDNYSASGICLLWISLFESIGIGWVYGAE--------RFYQNMTDMIGFRINPYLKVCWIFCTPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGDAIGWLLALSSIVCIP 528          
BLAST of Transporter vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 433.721 bits (1114), Expect = 3.095e-142
Identity = 253/573 (44.15%), Postives = 345/573 (60.21%), Query Frame = 1
Query:  445 NERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEY-APIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQD 2160
             ER  W  K DF+LS +GYAVGLGN+WRFPY+CY+NGG +F+IPYL+ L   G+PIF ++V LGQ+T+ G    W   +PI TGIG+AM +I+ L +VYYNVI++++ YYMF +    +PW  CNN WNT +C    S  +   + +F   T   +                T   RK          VL LS DV   G V+++LA+CL  +WI+V+ C+ KGIKS GK+VYFTA FPY VL IL  RG  L GA +G  FY+ PD  KL D  VW DAA QIFFSLS  +GGLI   SYN+F+NN  RDTLIV++ N  TS+FAGFVIF+ +G +A  LG  V  V   G GLAFI YP+ +  +PGS  W+ LFF ML  LGLDSQF  +ETV T   D Y    R  K    LLF ++ + LG+   T+ G Y   + D   GG +++LI + EVI+IGW YG          RF R+IE+++G   + ++ LCW+YI+P ++  I +++  D++   YGD ++P WA+F GW++   S+  +P   +Y   K +       +KR  +D
Sbjct:    2 EEREQWSNKIDFLLSCIGYAVGLGNVWRFPYLCYKNGGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIMTGIGFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFC----SCTHAMNIPSFHENTIISV----------------TLSRRK----------VLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIFTMMGFMAHELGVEVEDVVKSGPGLAFIAYPQGIKKIPGSPFWAFLFFFMLFNLGLDSQFVGVETVTTVLSDSYK-GARRYKAHLTLLFCVVSYILGISNVTQGGVYIFTMFDYQGGGISLILIALLEVIAIGWFYGVE--------RFARNIESMIGHRPNIYFLLCWKYISPLIIGVIFIWNCVDWSGISYGDYVFPAWAEFCGWLLCFSSIVCVPICAIYRCVKGK--GTLAEVKRATRD 533          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a5 (solute carrier family 6 member 5 [Source:NCBI gene;Acc:101158004])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 300/629 (47.69%), Postives = 412/629 (65.50%), Query Frame = 1
Query:  442 NNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDR--LSIVNCSLMK----AFSNGTCYDISDKLVGLWNETL-FNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQ 2307
            N  RGNW  K DFILS +GYAVGLGN+WRFPY+ ++NGGGAF+IPYL  L + G+PIFL++V LGQF S GP + W+  P   G G AM+IIS L+A+YYN+I+ + +YY+FAS+   LPW +C N WNT  C+D+  L + +C L      +  N T + +S   VG   + L  +I   KT   P+EEYF   VL++SK +   G ++W LA CLF +W+IV+  L KGIKS+GK+VYFTA FPY VL+IL  RGV L GA DGI ++I P  +KLSDA VWKDAA QIFFSLSA+WGGLI LSSYN+FHNN  RDT+IVT  NSATSIFAGFVIFS +G +A  L   +  VAD+G G+AF++YPEA+  +P S  W+I+FF+ML+TLGLD+ F TIET++T   D +P YLR  K  F L+     F LG P+ T++G Y LQL+DT+   +++++I IFE++ I ++YG          RF  DIE ++G   + +WRLCW ++TPT+++GI+  S + +    Y D  YP W+  +GW+M + S+ +IP     ++F  + Y    +I   L+ +  P   WGP L KHR    +++ D       +  +L   DF HL++ Q
Sbjct:  166 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQNGGGAFLIPYLTMLGIAGIPIFLLEVSLGQFASQGPVSVWKCIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKGSLPWANCRNEWNTVECKDKDMLLLDSCILRDRNAISVKNST-FCLSANAVGNLTKLLNVSIDANKTYVSPSEEYFKYNVLHISKGIEYPGDIRWPLAGCLFLAWVIVYASLAKGIKSSGKVVYFTATFPYVVLIILLIRGVTLPGAGDGILYFITPKWEKLSDAKVWKDAATQIFFSLSAAWGGLITLSSYNKFHNNCYRDTVIVTCTNSATSIFAGFVIFSVIGFMAHELKVPIEKVADEGPGIAFVVYPEALTRLPLSPFWAIIFFLMLLTLGLDTMFATIETIVTSVSDEFPKYLRKHKPVFTLICCASFFILGFPMITENGMYMLQLVDTFAASYSLVIIAIFELLGISYLYGL--------QRFCADIEMMIGFQPNRFWRLCWAFVTPTILTGILGLSLYQWKVMTYEDYTYPTWSMIMGWLMVICSVIWIP-----IMFLIKMYLAPGTIGERLKLVCSPQPDWGPFLMKHRGDRYKNMTDPLGTS-SLGLKLPPKDF-HLTSYQ 778          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 498.049 bits (1281), Expect = 7.218e-165
Identity = 271/608 (44.57%), Postives = 390/608 (64.14%), Query Frame = 1
Query:  397 DTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLF---NIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            D N     E +K +EN  RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM+PY I L   G+P+F +++  GQF S G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C   +             G+ Y I++ L       +     ++ +  R  P+EEY+ + VLN+S D+   G V+  +  CL  SW +VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  L   VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   ++ F LG+PLTT++G YWL LMD Y   +++++I     I I ++YG           + RD+E +LG P   ++++CW++I+P ++S I++F+   Y    Y D +YP W+  +G+ M + S+  IP   VY ++K  R +P  + +  L+       KWGP+L +HR
Sbjct:   13 DQNGAVPGEPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVV-------------GSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGH--------RNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP---VYALYKISR-SPGATFRERLKAACRAHPKWGPALLEHR 595          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 495.738 bits (1275), Expect = 4.823e-164
Identity = 269/600 (44.83%), Postives = 388/600 (64.67%), Query Frame = 1
Query:  421 EYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLF---NIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            E +K +EN  RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM+PY I L   G+P+F +++  GQF S G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C   +             G+ Y I++ L       +     ++ +  R  P+EEY+ + VLN+S D+   G V+  +  CL  SW +VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  L   VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   ++ F LG+PLTT++G YWL LMD Y   +++++I     I I ++YG           + RD+E +LG P   ++++CW++I+P ++S I++F+   Y    Y D +YP W+  +G+ M + S+  IP   VY ++K  R +P  + +  L+       KWGP+L +HR
Sbjct:   17 EPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVV-------------GSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGH--------RNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP---VYALYKISR-SPGATFRERLKAACRAHPKWGPALLEHR 591          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a9 (solute carrier family 6 member 9 [Source:NCBI gene;Acc:101166418])

HSP 1 Score: 495.738 bits (1275), Expect = 4.823e-164
Identity = 269/600 (44.83%), Postives = 388/600 (64.67%), Query Frame = 1
Query:  421 EYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLF---NIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVD-VYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHR 2208
            E +K +EN  RGNW  + +F+L+S+GYAVGLGN+WRFPY+CYRNGGGAFM+PY I L   G+P+F +++  GQF S G    W+ +P+F G+GY M+++ST + +YYNV+I  A YY F S++N LPW  CNN WNT  C   +             G+ Y I++ L       +     ++ +  R  P+EEY+ + VLN+S D+   G V+  +  CL  SW +VFLCLI+G+KS+GK+VYFTA FPY VL ILF RG+ LDGAI+GI +Y+ P  +K+ DA VW DAA+QIF+SL  +WGGLI ++SYN+FHNN  RD++I++I N ATS++AGFVIFS LG +A  L   VS VAD G GLAF+ YPEA+  +P S +WS+LFF MLI LGL +QF  +ET++T  VD +   ++   KT   L   ++ F LG+PLTT++G YWL LMD Y   +++++I     I I ++YG           + RD+E +LG P   ++++CW++I+P ++S I++F+   Y    Y D +YP W+  +G+ M + S+  IP   VY ++K  R +P  + +  L+       KWGP+L +HR
Sbjct:   17 EPVKKDENLRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYRNGGGAFMLPYFIMLVFCGIPLFFLELSFGQFASQGCLGVWKISPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSMTNLLPWTYCNNPWNTPDCSGVV-------------GSGYQINNSLANATTSLVAGVSEVVNRTKRTSPSEEYWKHYVLNISDDIGNFGEVRLPILGCLAVSWCVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFIRGITLDGAINGIKYYLTPQWQKVLDAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCFRDSIIISITNCATSVYAGFVIFSILGFMAHNLNVPVSEVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETLVTAIVDEIGTDWIIRNKTVVTLSVAVVGFLLGVPLTTQAGIYWLLLMDNYAASFSLVVISCIMCICIMYIYGH--------RNYFRDVEMMLGFPPPLFFKVCWRFISPLIISFILIFTVIQYKPITYNDYVYPGWSLAIGFAMALSSVVCIP---VYALYKISR-SPGATFRERLKAACRAHPKWGPALLEHR 591          
BLAST of Transporter vs. Ensembl Medaka
Match: slc6a14 (solute carrier family 6 member 14 [Source:NCBI gene;Acc:101166790])

HSP 1 Score: 468.389 bits (1204), Expect = 3.602e-154
Identity = 268/605 (44.30%), Postives = 371/605 (61.32%), Query Frame = 1
Query:  436 EENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYI--IPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISN---WWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLED 2235
            +EN ERGNW  K D+ILS +GYAVGLGNIWRFPY+ Y+NGGGAF+IPY   L ++G+P+F ++  LGQF S GP   W+  PI  G+G A V+++ +V++YYNVII Y++YYMFAS+ +PLPW  C  SW    C +        +    S+ T     +KL+   N T  +       + P+E+Y++   L  S  +   G V W LALCL  S ++V   LI+GIKS+GK+VYFTA FPY V+LIL  RG+ L+GA DGI FYI    +L KL++A VWKDAA Q F+SLS  WGGL+ LSSYN F NN+ +DT  VT+ N+ TS+ AGF IFS LGH+A      V  V  +G GLAFI YP+A++ +P S +WSILFFVML+T+GLDSQF  IE + T  VD +P Y + ++    +    IL+ LGLP  T++G YW+ L+D +   W +L + + E+I + ++YG          RF +DIE +LG+       WWR CW  I+P ++  I+ +S   ++   YG+  YP W   LGW M    + +IP   VY + K R  +P+  +K     L  P+ +W P L  HR    R+ E+
Sbjct:   13 DENPERGNWANKSDYILSMIGYAVGLGNIWRFPYLAYKNGGGAFLIPYFTMLVVVGIPLFFLESALGQFCSQGPINAWKAVPILQGVGIAAVVVTLVVSIYYNVIICYSLYYMFASMQSPLPWSDC-FSWADSSCSN--------ISAGDSSHTNILFLEKLMHSGNNTCASSNMSVLVQSPSEQYWDRVALQRSSSLDETGPVVWHLALCLLLSSLLVAAALIRGIKSSGKVVYFTATFPYVVILILLVRGLTLEGARDGIEFYIGSQSNLTKLTEAEVWKDAATQTFYSLSIGWGGLVTLSSYNNFQNNVFKDTFAVTLTNAGTSVLAGFAIFSILGHMAHVYNIPVENVVKQGFGLAFIAYPDALSKLPISPLWSILFFVMLLTVGLDSQFAGIEVLTTCLVDAFPRYFKSKRAIVTVATCSILYLLGLPCVTRAGIYWVTLIDQFVATWVLLFLVLLEIIGVAFIYGG--------NRFIKDIEMMLGKKSFAFWLWWRACWFCISPCIILVILGWSIATFSPPTYGEVQYPGWGLALGWAMVAFVVIWIPFVAVYNLTKARG-SPWERLK----SLCSPSEEWHPYLDIHR--GERYSEE 593          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000019713.1 (SMESG000019713.1)

HSP 1 Score: 1383.62 bits (3580), Expect = 0.000e+0
Identity = 694/694 (100.00%), Postives = 694/694 (100.00%), Query Frame = 1
Query:  253 MKSEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR 2334
            MKSEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWFILLFVIILFFLGLPLTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR
Sbjct:    1 MKSEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWFILLFVIILFFLGLPLTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPKHRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR 694          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 461.455 bits (1186), Expect = 1.211e-151
Identity = 246/608 (40.46%), Postives = 374/608 (61.51%), Query Frame = 1
Query:  388 NANDTNVNAVNEY-LKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYC----RDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXT--TKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGP 2190
            +++ TN   ++E   ++ +   RGNW G+ DF LS +GYAVGLGN+WRFP++CY +GGGAF++PY I L + G+PIF  ++ LGQF+S+GP + W+  P+F GIGY+M+I++T+V+VYYNVII++++YY+FAS ++ LPW  CNN+WN + C    R++ +I NCS +    N   Y+++ +    W + +  +        P E +              +G VQW L LCL  +WII   CLIKG+KS+GK+VYFTAIFPY V++I+   G  L G+  GI +Y+IP  KKL    VW+DAA QIF+SL  ++GGL+ +SSYN+F+NN  RD L+V++ N  TS  AGF IFS LG++A + G ++      G GLAF+ Y ++++TM  + +WSILFF+ML+TLG+DSQF  +E + TG  D +PI  +           + +    L +T  +K G Y   +MD Y G + + +I IFE+I+I ++YG           F +DI+ +LG     +W  CW  +TP  +  I++ S+  +T  K+G+ I P+WA+ LG++MT   LA +   VVY ++    Y  +  + +  +D       WGP
Sbjct:    6 DSSKTNEQVISEVDSQTPKTTGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNK-TISNCSTLNT-QNCIEYEVAAE--QYWKKVVLGVEDYAGNLRPMEPF--------------LGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVK--------NFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMT---LAGVINIVVYFIY----YAIFKGVTKTPKD------SWGP 574          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000042091.1 (SMESG000042091.1)

HSP 1 Score: 460.299 bits (1183), Expect = 3.845e-151
Identity = 245/607 (40.36%), Postives = 371/607 (61.12%), Query Frame = 1
Query:  388 NANDTNVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYC----RDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRPRKTWXXXXXXXXXXXXXXXXT--TKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGP 2190
            +++ TN        ++ +   RGNW G+ DF LS +GYAVGLGN+WRFP++CY +GGGAF++PY I L + G+PIF  ++ LGQF+S+GP + W+  P+F GIGY+M+I++T+V+VYYNVII++++YY+FAS ++ LPW  CNN+WN + C    R++ +I NCS +    N   Y+++ +    W + +  +        P E +              +G VQW L LCL  +WII   CLIKG+KS+GK+VYFTAIFPY V++I+   G  L G+  GI +Y+IP  KKL    VW+DAA QIF+SL  ++GGL+ +SSYN+F+NN  RD L+V++ N  TS  AGF IFS LG++A + G ++      G GLAF+ Y ++++TM  + +WSILFF+ML+TLG+DSQF  +E + TG  D +PI  +           + +    L +T  +K G Y   +MD Y G + + +I IFE+I+I ++YG           F +DI+ +LG     +W  CW  +TP  +  I++ S+  +T  K+G+ I P+WA+ LG++MT   LA +   VVY ++    Y  +  + +  +D       WGP
Sbjct:    6 DSSKTNEQISEVDSQTPKTTGRGNWSGRFDFFLSCVGYAVGLGNLWRFPHLCYIHGGGAFLVPYFIMLLIAGIPIFYFELALGQFSSSGPISIWKVQPMFKGIGYSMLIVATIVSVYYNVIIAWSLYYLFASFTSKLPWSDCNNAWNDERCLTDFRNK-TISNCSTLNT-QNCIEYEVAAE--QYWKKVVLGVEDYAGNLRPMEPF--------------LGPVQWHLCLCLLLAWIICGACLIKGVKSSGKVVYFTAIFPYVVIIIMVVNGCLLSGSKIGIQYYLIPKWKKLLSIQVWRDAATQIFYSLGVAFGGLMTMSSYNKFNNNCYRDALLVSVINCLTSFLAGFAIFSVLGYMAHQTGRAIEQTTTSGSGLAFVAYAQSLSTMKVAPLWSILFFLMLLTLGIDSQFGGMEAIFTGLQDEFPILKKTHFIDIAFKISVQIILFFLGITCVSKGGIYMFSIMDEYSGTFTLQIIAIFELITIMYLYGVK--------NFMKDIKMMLGFKPGYYWVACWMVVTPLTIIFILILSFMYHTPTKFGNYILPVWANVLGYLMT---LAGVINIVVYFIY----YAIFKGVTKTPKD------SWGP 573          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000042051.1 (SMESG000042051.1)

HSP 1 Score: 458.373 bits (1178), Expect = 1.648e-150
Identity = 252/595 (42.35%), Postives = 364/595 (61.18%), Query Frame = 1
Query:  427 LKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP--RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTV-PTIKWGPSLPK 2202
             + +EN  RGNW  K DF LS +GYAVGLGN+WRFP++CY+NGGGAF+IPY   L + G+P+F  ++ LGQF+S+G  T W+  P+F GIG+AM++IS + ++YYNVII++++YY+FAS ++ LPW  CNN WN + C +    V   +  +F    C          W   +  ++     + P E Y              +G VQW L+LCL  +WII    LIKG+KS+GK+VYFTAIFPYFV++I+   G  L+G+++GI +Y+IP   KL +A VW DAA QIF+SL  ++GGL+ ++SYN+F+NN  RD L+V+I N ATS  AGF IF+ LG+++ + G SV+     G GLAF+ Y + VATMP S IWSILFF ML+TLG+DSQF  +E + TGF D +PI  +       F ++F IILFFLGLP  +K G Y   LMD YCG +++++I   E+  I ++YG           F +DIE +L      +W +CW ++TP ++  I++ S   +  + Y   + P WA+ LG ++   S++ +P            Y  YH+   I +  T  P  +WGP + K
Sbjct:   17 FEGDENTYRGNWSSKMDFFLSCVGYAVGLGNLWRFPHLCYKNGGGAFLIPYFTMLIIAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLVISIICSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLNDFKNVTNVVCSSFRTTNCTKYEVAAEQYWQRVVLGVVNYAGDQRPMEPY--------------LGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEARVWGDAATQIFYSLGVAFGGLMTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFAVLGYMSVKTGRSVAETTTSGTGLAFVAYAQGVATMPYSPIWSILFFGMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMFTLMDEYCGSFSLIIIAFLELTIISFIYGVK--------NFSQDIEMMLKFKPGYYWIICWTFLTPIIIIFILIVSIIQHAPSSYNGVLLPKWANQLGGVIAASSISAVP-----------IYFFYHA---IFKGFTFKPNEEWGPGVEK 575          
BLAST of Transporter vs. Planmine SMEST
Match: SMESG000042086.1 (SMESG000042086.1)

HSP 1 Score: 449.514 bits (1155), Expect = 5.447e-147
Identity = 254/600 (42.33%), Postives = 365/600 (60.83%), Query Frame = 1
Query:  409 NAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRNGGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGYAMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRLSIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNNEVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAIFPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFSLSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHLAKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLDSQFTTIETVITGFVDVYPIYLRP--RKTWXXXXXXXXXXXXXXXXTTKSGPYWLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETILGRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGWMMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPK 2202
            N +    + +EN  RGNW  K DF+LS +G AVGLGN+WRFPY+CY+NGGGAF+IPY   L + G+P+F  ++ LGQF+S+G  T W+  P+F GIG+AM+IIS + ++YYNVII++++YY+FAS ++ LPW  CNN WN + C      V  ++  +     C          W   +  ++     + P E Y              +G VQW L+LCL  +WII    LIKG+KS+GK+VYFTAIFPYFV++I+   G  L+G+++GI +Y+IP   KL +A VW DAA QIF+SLS  +GGL+ ++SYN+F+NN  RD L+V+I N ATS  AGF IFS LG+++ + G SV+     G GLAF++Y + VATMP S IWSILFF ML+TLG+DSQF  +E + TGF D +PI  +       F ++F IILFFLGLP  +K G Y + LMD YCG +++++I   E+  I ++YG           + +DIE +L      +W +CW  +TP ++  I++ S   +  + Y   + P WA+ LG ++   S++ +P            Y  YH+I +       P  KWGP + K
Sbjct:   12 NKIEVRFEGDENTYRGNWSNKMDFVLSCIGLAVGLGNLWRFPYLCYKNGGGAFLIPYFTMLIVAGIPLFYFELSLGQFSSSGFLTVWKIQPMFKGIGFAMLIISIISSIYYNVIIAWSLYYLFASFTSKLPWSDCNNEWNDELCLINFKNVTTAVCSSELTINCTKYEVPAEQYWQRVVLGVVNYAGDQRPMEPY--------------LGTVQWHLSLCLLLAWIICGASLIKGVKSSGKVVYFTAIFPYFVIVIMVINGCLLEGSLEGIKYYLIPKWSKLLEAGVWGDAATQIFYSLSVGFGGLLTMASYNKFNNNCYRDALMVSIINCATSFVAGFAIFSVLGYMSVKTGRSVAETTTSGTGLAFVVYAQGVATMPYSPIWSILFFAMLLTLGIDSQFGGMEAIFTGFQDQFPILKKTHFHDFSFKIIFQIILFFLGLPCVSKGGIYMVTLMDEYCGSFSLIIIAFLELTIISFIYGIK--------NYVQDIEMMLKFKPGYYWIICWTALTPIVIIFILIVSIIQHAPSSYNGVLLPKWANQLGGVIAASSISAVP-----------IYFFYHAIFKGFS--FKPDEKWGPGVEK 576          
The following BLAST results are available for this feature:
BLAST of Transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A50.000e+048.51solute carrier family 6 member 5 [Source:HGNC Symb... [more]
SLC6A99.634e-16144.50solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A92.964e-16045.08solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A92.964e-16045.08solute carrier family 6 member 9 [Source:HGNC Symb... [more]
SLC6A96.178e-16044.74solute carrier family 6 member 9 [Source:HGNC Symb... [more]
back to top
BLAST of Transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snf-117.294e-12636.12Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
dat-15.508e-12336.82Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-31.294e-11936.14Sodium- and chloride-dependent betaine transporter... [more]
mod-52.636e-11436.29Transporter [Source:UniProtKB/TrEMBL;Acc:Q9N3C7][more]
snf-62.464e-9930.91Sodium-dependent acetylcholine transporter [Sourc... [more]
back to top
BLAST of Transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GlyT6.472e-17546.74gene:FBgn0034911 transcript:FBtr0301162[more]
DAT1.262e-14942.48gene:FBgn0034136 transcript:FBtr0330002[more]
DAT1.393e-14942.48gene:FBgn0034136 transcript:FBtr0087125[more]
Gat1.242e-14641.94gene:FBgn0039915 transcript:FBtr0089972[more]
SerT1.803e-13738.90gene:FBgn0010414 transcript:FBtr0072362[more]
back to top
BLAST of Transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a50.000e+049.16solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a50.000e+049.16solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a50.000e+049.16solute carrier family 6 member 5 [Source:ZFIN;Acc:... [more]
slc6a142.085e-16645.63solute carrier family 6 member 14 [Source:ZFIN;Acc... [more]
slc6a98.709e-16345.29solute carrier family 6 member 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxd45.204e-17445.57MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd42.061e-17345.25MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd42.473e-17345.74MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd42.870e-17345.74MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
mxd43.304e-17345.74MAX dimerization protein 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a50.000e+048.00solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a50.000e+048.00solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a50.000e+048.00solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a93.788e-16045.41solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a93.788e-16045.41solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of Transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y345|SC6A5_HUMAN0.000e+048.51Sodium- and chloride-dependent glycine transporter... [more]
sp|Q761V0|SC6A5_MOUSE0.000e+048.00Sodium- and chloride-dependent glycine transporter... [more]
sp|P58295|SC6A5_RAT0.000e+047.84Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2X0|SC6A5_XENLA2.138e-18044.89Sodium- and chloride-dependent glycine transporter... [more]
sp|A7Y2W8|SC6A9_XENLA1.218e-16744.59Sodium- and chloride-dependent glycine transporter... [more]
back to top
BLAST of Transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H0B70.000e+051.67Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267F5970.000e+051.67Transporter OS=Macrostomum lignano OX=282301 GN=BO... [more]
T1FPK80.000e+050.76Transporter OS=Helobdella robusta OX=6412 GN=20210... [more]
A0A210Q7790.000e+048.63Transporter OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
A0A210Q7980.000e+050.55Transporter OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
back to top
BLAST of Transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a142.001e-16444.67solute carrier family 6 member 14 [Source:NCBI gen... [more]
slc6a96.359e-16344.86solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a91.553e-16145.15solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a11b2.986e-14440.78solute carrier family 6 member 11 [Source:NCBI gen... [more]
slc6a1l8.064e-14443.39solute carrier family 6 member 1, like [Source:ZFI... [more]
back to top
BLAST of Transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a1a3.150e-14742.65solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b8.939e-10940.23solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000008631.15.521e-9037.04pep scaffold:Pmarinus_7.0:GL483327:11244:21649:-1 ... [more]
ENSPMAT00000001684.12.078e-7946.62pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
ENSPMAT00000004857.17.038e-7342.51pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
back to top
BLAST of Transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315451.652e-16144.22Transporter [Source:UniProtKB/TrEMBL;Acc:A7SXK0][more]
EDO492185.790e-16143.07Transporter [Source:UniProtKB/TrEMBL;Acc:A7RHF4][more]
EDO397072.349e-15242.17Transporter [Source:UniProtKB/TrEMBL;Acc:A7S977][more]
EDO323562.541e-14745.08Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO397083.095e-14244.15Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
back to top
BLAST of Transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a50.000e+047.69solute carrier family 6 member 5 [Source:NCBI gene... [more]
slc6a97.218e-16544.57solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a94.823e-16444.83solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a94.823e-16444.83solute carrier family 6 member 9 [Source:NCBI gene... [more]
slc6a143.602e-15444.30solute carrier family 6 member 14 [Source:NCBI gen... [more]
back to top
BLAST of Transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019713.10.000e+0100.00SMESG000019713.1[more]
SMESG000042091.11.211e-15140.46SMESG000042091.1[more]
SMESG000042091.13.845e-15140.36SMESG000042091.1[more]
SMESG000042051.11.648e-15042.35SMESG000042051.1[more]
SMESG000042086.15.447e-14742.33SMESG000042086.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034835 ID=SMED30034835|Name=Transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=2828bp
GCCGGTTAATTGGAAACAAAATGCTTTATTTCATATTTCTTTTTAATAGG
TATGGAAAAAAATCAATATTCAATGCCACCTCAATAGAAATAACACAAAA
CAATTTATGGAAATTCAACCAATCAAATCACGAGATTTGCCATTTTTCTT
TTATAGTATGCATGATGCTATTTTTAGTTGGAATTTTATTTTTTCAAATT
TGCTTTTTATATCAAACTTCATAAAATTTTTGACATTAATTTATCAAAAG
CCATGAAATCCGAAGACAAAAAATCCATCATTGATCACGATCAGATGATA
AATGATGATAATGTGGAAAACTTACCGAAAAAAACGAAAAATATTCCAGT
TGTCTTGGATTCCATTCAGGTGTCAATGAATGGCTGTAATGCCAATGACA
CGAACGTAAATGCTGTAAACGAGTATCTGAAATCCGAAGAAAATAATGAA
CGAGGAAATTGGGTTGGTAAATGTGATTTTATACTCAGCAGTCTTGGTTA
TGCAGTTGGGCTGGGAAATATTTGGAGATTCCCATATATGTGTTATAGAA
ATGGAGGAGGGGCATTTATGATACCTTATTTGATTTTCCTTTTCCTCATC
GGGATGCCAATATTTTTAGTTGATGTTGGTCTTGGCCAGTTTACAAGTAA
TGGACCTTTTACGTGTTGGGAATATGCTCCAATATTTACTGGTATCGGAT
ACGCCATGGTTATCATATCAACATTGGTTGCAGTTTATTACAATGTTATC
ATATCGTATGCGGTATACTATATGTTTGCCTCAATATCTAATCCTTTGCC
ATGGATCTCCTGTAACAATTCATGGAATACTGACTACTGCCGAGACCGCT
TATCAATAGTGAATTGTAGTCTGATGAAGGCATTTAGCAATGGTACATGT
TACGATATATCAGACAAGTTGGTCGGACTTTGGAATGAAACCCTTTTCAA
TATTATCACTCAGAAAACCAGAAAATTACCAGCAGAAGAATACTTTAATA
ATGAAGTTCTTAATCTATCTAAAGATGTCACAATAATTGGTGCTGTTCAA
TGGAAACTTGCTTTATGTTTATTCGGTTCATGGATCATTGTATTCTTATG
TTTAATTAAAGGAATTAAATCAACTGGGAAAATTGTCTACTTCACTGCAA
TTTTCCCATACTTCGTCCTGTTAATCTTATTCTTCAGAGGAGTATGTCTC
GACGGAGCCATAGATGGGATAGCATTTTACATTATTCCGGATCTTAAAAA
GCTATCAGATGCCTCTGTATGGAAAGATGCAGCTAATCAAATTTTCTTTT
CTCTCTCTGCCAGTTGGGGAGGTTTAATAGCTTTATCCAGTTACAACAGA
TTTCATAATAATATTATCAGAGATACCCTAATAGTGACTATTGGAAACAG
TGCAACCAGCATTTTTGCTGGATTTGTTATTTTCTCCTACCTCGGACATT
TGGCCAAAAGATTAGGAACGAGTGTATCTCTGGTAGCGGATAAAGGAATG
GGATTGGCATTTATAATTTACCCAGAAGCCGTAGCAACAATGCCTGGATC
CTACATTTGGTCGATTTTATTTTTTGTAATGCTCATAACACTGGGTCTAG
ATAGTCAATTTACAACTATAGAAACAGTGATAACAGGGTTTGTGGATGTT
TATCCAATTTATTTAAGGCCAAGAAAAACATGGTTTATTCTCCTATTCGT
TATTATATTATTCTTTCTTGGATTGCCATTAACCACAAAGAGTGGCCCAT
ATTGGTTACAATTGATGGACACGTACTGTGGAGGGTGGGCAATTTTATTA
ATTGGAATCTTTGAGGTGATTTCTATCGGATGGGTTTATGGTAGGCCCGG
GTTTAACTGGAAAAAGCCAATGAGATTTCAAAGAGATATCGAAACAATTC
TGGGCAGGCCGATAAGTAATTGGTGGAGATTATGCTGGCAGTATATAACA
CCAACTTTGATGAGTGGAATTATATTGTTCTCATGGTTTGATTACACGAG
AGCTAAATACGGAGATAAAATATATCCAATTTGGGCTGACTTTCTAGGCT
GGATGATGACTGTGCTCAGTCTCGCCTTCATCCCAGGAACGGTTGTTTAC
TTAGTTTTCAAAGAAAGGAGATACAATCCATATCATAGCATAAAACGAAT
TCTACAAGATCTCACAGTTCCTACTATTAAATGGGGTCCGTCACTTCCAA
AGCATCGACTGTTAGCTGCCAGGCATTTAGAAGATTCAGAAAGCTATTAT
ATAGACGTTGCTAGACGATTGAAATACGGAGATTTCGTCCATCTGTCCAA
TGAACAGAATAATCACAACGAACCACACAATAGATAGAAGAAATAATATT
AGTAATTGGATGATAAGTTTTAATCAAGGAGAGATTAATGTAAATATATA
AAAAATTATTTATTGAATTCATTTTATTTTTCGCTAAAAAGAAAACATTA
TATTTTGGTTATTTTGTTTACAAACATTATCTTTCTAAAGGTTGCTATTA
TTTTGCCTTGGAAAACATTGTTTTATAATAAATCTGTTGAATTTGTCGAT
TGTTTTGGAAATCGATTACTAATCAAGTTAGCATTTTAGACATGTCTATG
ATTCCAAATGAGCACCAATCGCTACTGCCAAGTATTGATGATGCCAATAA
TAAAAATAATCACAATTCCGATTTTCGGAAAAACATTATCAGTAATATCA
AAAGTTTTCTGTTGGATTTCTTTGTAAAACTTTTGATAATAATACCGATT
TTATGCATTTGCTCGTCGGCGGTTTTTTTATTCATGTCTCAGAGATCCGA
GGTTCCGAAAATTAAGAAAAGAAAATAT
back to top

protein sequence of SMED30034835-orf-1

>SMED30034835-orf-1 ID=SMED30034835-orf-1|Name=SMED30034835-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=695bp
MKSEDKKSIIDHDQMINDDNVENLPKKTKNIPVVLDSIQVSMNGCNANDT
NVNAVNEYLKSEENNERGNWVGKCDFILSSLGYAVGLGNIWRFPYMCYRN
GGGAFMIPYLIFLFLIGMPIFLVDVGLGQFTSNGPFTCWEYAPIFTGIGY
AMVIISTLVAVYYNVIISYAVYYMFASISNPLPWISCNNSWNTDYCRDRL
SIVNCSLMKAFSNGTCYDISDKLVGLWNETLFNIITQKTRKLPAEEYFNN
EVLNLSKDVTIIGAVQWKLALCLFGSWIIVFLCLIKGIKSTGKIVYFTAI
FPYFVLLILFFRGVCLDGAIDGIAFYIIPDLKKLSDASVWKDAANQIFFS
LSASWGGLIALSSYNRFHNNIIRDTLIVTIGNSATSIFAGFVIFSYLGHL
AKRLGTSVSLVADKGMGLAFIIYPEAVATMPGSYIWSILFFVMLITLGLD
SQFTTIETVITGFVDVYPIYLRPRKTWFILLFVIILFFLGLPLTTKSGPY
WLQLMDTYCGGWAILLIGIFEVISIGWVYGRPGFNWKKPMRFQRDIETIL
GRPISNWWRLCWQYITPTLMSGIILFSWFDYTRAKYGDKIYPIWADFLGW
MMTVLSLAFIPGTVVYLVFKERRYNPYHSIKRILQDLTVPTIKWGPSLPK
HRLLAARHLEDSESYYIDVARRLKYGDFVHLSNEQNNHNEPHNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037272SNS_sf
IPR000175Na/ntran_symport
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005328neurotransmitter:sodium symporter activity
GO:0015293symporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000175Sodium:neurotransmitter symporterPRINTSPR00176NANEUSMPORTcoord: 147..173
score: 45.42
coord: 294..311
score: 56.01
coord: 75..96
score: 66.32
coord: 104..123
score: 49.02
coord: 511..531
score: 37.31
coord: 559..579
score: 31.54
coord: 430..449
score: 59.18
coord: 376..396
score: 50.66
IPR000175Sodium:neurotransmitter symporterPFAMPF00209SNFcoord: 67..619
e-value: 1.3E-191
score: 637.9
IPR000175Sodium:neurotransmitter symporterPANTHERPTHR11616SODIUM/CHLORIDE DEPENDENT TRANSPORTERcoord: 50..654
IPR000175Sodium:neurotransmitter symporterPROSITEPS00754NA_NEUROTRAN_SYMP_2coord: 173..193
IPR000175Sodium:neurotransmitter symporterPROSITEPS00610NA_NEUROTRAN_SYMP_1coord: 91..105
IPR000175Sodium:neurotransmitter symporterPROSITEPS50267NA_NEUROTRAN_SYMP_3coord: 66..623
score: 98.111
NoneNo IPR availablePANTHERPTHR11616:SF231SODIUM-DEPENDENT PROLINE TRANSPORTERcoord: 50..654
NoneNo IPR availableTMHMMTMhelixcoord: 427..449
NoneNo IPR availableTMHMMTMhelixcoord: 269..288
NoneNo IPR availableTMHMMTMhelixcoord: 560..582
NoneNo IPR availableTMHMMTMhelixcoord: 508..530
NoneNo IPR availableTMHMMTMhelixcoord: 476..493
NoneNo IPR availableTMHMMTMhelixcoord: 597..619
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 376..398
NoneNo IPR availableTMHMMTMhelixcoord: 101..123
IPR037272Sodium:neurotransmitter symporter superfamilySUPERFAMILYSSF161070SNF-likecoord: 67..618