fancd2-like protein

Overview
Namefancd2-like protein (ACT98276.1)
Smed IDSMED30034829
Length (bp)4225
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fancd2-like protein (SMED30034829) t-SNE clustered cells

Violin plots show distribution of expression levels for fancd2-like protein (SMED30034829) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fancd2-like protein (SMED30034829) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fancd2-like protein (SMED30034829) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034829

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034829SMESG000066544.1 SmedASXL_000716SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034829SMESG000066544.1 SmedASXL_009401SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30034829SMESG000066544.1 dd_Smed_v4_12881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30034829SMESG000066544.1 dd_Smed_v4_12881_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034829SMESG000066544.1 SMED_29736_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034829SMESG000066544.1 SMED_29736_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fancd2-like protein vs. Ensembl Human
Match: FANCD2 (FA complementation group D2 [Source:HGNC Symbol;Acc:HGNC:3585])

HSP 1 Score: 108.997 bits (271), Expect = 4.941e-23
Identity = 108/480 (22.50%), Postives = 221/480 (46.04%), Query Frame = 1
Query:  301 STPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFEN--LNSMFNSA--------VSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNL 1707
            S  KSL ++ L I  L   +I+ L  K+ E    N + D   +  L ++Q KW     +  ++  K++ +  IA   +Q+ +I+  P+I  D  +  + ++L D +  N  L    LD +S L L  +FL ++  LVM+ L S  +  LP +I F++ +    + +E+I ++R  ++ ++  L S   ++         +S+      +  SC + L + +K  +++   + +AW+K+I   +       FD ++L II++        I  ++++KI      +Q +++ F  H+ +LK +    L++  S++ S    ++ F    Y  AF   +  +   ++   L+  I +  ++ ++  L+VL  L     + + +    + G+L      +  QI  ++ +   +AF   +E          I++ + L+++KQL +  F  K  G IGAVT+   +      + S      NL
Sbjct:  130 SYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQLKWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTISEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQSTFSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDT-YCQQEVVGALVTHICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLAFSKQNEASS------HIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANL 602          

HSP 2 Score: 72.4034 bits (176), Expect = 6.644e-12
Identity = 126/514 (24.51%), Postives = 207/514 (40.27%), Query Frame = 1
Query: 2698 RCKLLEENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPP---------NANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEF--------CLSDEILENVDDPCFLVFEFVL-----KILSKIFHYL----------KNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQ----ILSIREKIPSINIAAAYCEFVSELL---TITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  LL  N    FRELD+ VF++L    +TK   D  +    +E+  LG  EL + L DL  K+E          +   PP         N     + F ++ Q     I+  +      F+L+               CL+ E    VD P   V E+ +     + L +IFH L            NL  S   ++   L         + LL Q    + +  + IPS   A      +  +L   T ++ N+ +++   L  +FL   W S +      S  +L  +  + L       K  E I    +PE+      N   + S   +  L + T +  F+++   + K  K +     + SQ+   E L  W    + V+ F+I+I   K  +S+ +L   +K+ R F++  +K  MP+LD   R     V+ LL   Q  TR +  LC H K   +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I
Sbjct:  913 KTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLE----------SMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCV------FQLLTPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMVILEKSTASAQNKEKIA--SLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAIEEIAGVGVPEL-----INSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQIHEEKLLYWN---MAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCR-EAFWLGNLKNRDLQGEEI 1399          
BLAST of fancd2-like protein vs. Ensembl Human
Match: FANCD2 (FA complementation group D2 [Source:HGNC Symbol;Acc:HGNC:3585])

HSP 1 Score: 108.997 bits (271), Expect = 4.941e-23
Identity = 108/480 (22.50%), Postives = 221/480 (46.04%), Query Frame = 1
Query:  301 STPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFEN--LNSMFNSA--------VSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNL 1707
            S  KSL ++ L I  L   +I+ L  K+ E    N + D   +  L ++Q KW     +  ++  K++ +  IA   +Q+ +I+  P+I  D  +  + ++L D +  N  L    LD +S L L  +FL ++  LVM+ L S  +  LP +I F++ +    + +E+I ++R  ++ ++  L S   ++         +S+      +  SC + L + +K  +++   + +AW+K+I   +       FD ++L II++        I  ++++KI      +Q +++ F  H+ +LK +    L++  S++ S    ++ F    Y  AF   +  +   ++   L+  I +  ++ ++  L+VL  L     + + +    + G+L      +  QI  ++ +   +AF   +E          I++ + L+++KQL +  F  K  G IGAVT+   +      + S      NL
Sbjct:  130 SYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQLKWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTISEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQSTFSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDT-YCQQEVVGALVTHICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLAFSKQNEASS------HIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANL 602          

HSP 2 Score: 72.4034 bits (176), Expect = 6.644e-12
Identity = 126/514 (24.51%), Postives = 207/514 (40.27%), Query Frame = 1
Query: 2698 RCKLLEENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPP---------NANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEF--------CLSDEILENVDDPCFLVFEFVL-----KILSKIFHYL----------KNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQ----ILSIREKIPSINIAAAYCEFVSELL---TITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  LL  N    FRELD+ VF++L    +TK   D  +    +E+  LG  EL + L DL  K+E          +   PP         N     + F ++ Q     I+  +      F+L+               CL+ E    VD P   V E+ +     + L +IFH L            NL  S   ++   L         + LL Q    + +  + IPS   A      +  +L   T ++ N+ +++   L  +FL   W S +      S  +L  +  + L       K  E I    +PE+      N   + S   +  L + T +  F+++   + K  K +     + SQ+   E L  W    + V+ F+I+I   K  +S+ +L   +K+ R F++  +K  MP+LD   R     V+ LL   Q  TR +  LC H K   +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I
Sbjct:  913 KTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLE----------SMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCV------FQLLTPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMVILEKSTASAQNKEKIA--SLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAIEEIAGVGVPEL-----INSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQIHEEKLLYWN---MAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCR-EAFWLGNLKNRDLQGEEI 1399          
BLAST of fancd2-like protein vs. Ensembl Human
Match: FANCD2 (FA complementation group D2 [Source:HGNC Symbol;Acc:HGNC:3585])

HSP 1 Score: 108.612 bits (270), Expect = 5.553e-23
Identity = 108/480 (22.50%), Postives = 221/480 (46.04%), Query Frame = 1
Query:  301 STPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFEN--LNSMFNSA--------VSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNL 1707
            S  KSL ++ L I  L   +I+ L  K+ E    N + D   +  L ++Q KW     +  ++  K++ +  IA   +Q+ +I+  P+I  D  +  + ++L D +  N  L    LD +S L L  +FL ++  LVM+ L S  +  LP +I F++ +    + +E+I ++R  ++ ++  L S   ++         +S+      +  SC + L + +K  +++   + +AW+K+I   +       FD ++L II++        I  ++++KI      +Q +++ F  H+ +LK +    L++  S++ S    ++ F    Y  AF   +  +   ++   L+  I +  ++ ++  L+VL  L     + + +    + G+L      +  QI  ++ +   +AF   +E          I++ + L+++KQL +  F  K  G IGAVT+   +      + S      NL
Sbjct:  130 SYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQLKWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTISEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQSTFSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDT-YCQQEVVGALVTHICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLAFSKQNEASS------HIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANL 602          

HSP 2 Score: 72.7886 bits (177), Expect = 4.837e-12
Identity = 126/514 (24.51%), Postives = 207/514 (40.27%), Query Frame = 1
Query: 2698 RCKLLEENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPP---------NANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEF--------CLSDEILENVDDPCFLVFEFVL-----KILSKIFHYL----------KNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQ----ILSIREKIPSINIAAAYCEFVSELL---TITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  LL  N    FRELD+ VF++L    +TK   D  +    +E+  LG  EL + L DL  K+E          +   PP         N     + F ++ Q     I+  +      F+L+               CL+ E    VD P   V E+ +     + L +IFH L            NL  S   ++   L         + LL Q    + +  + IPS   A      +  +L   T ++ N+ +++   L  +FL   W S +      S  +L  +  + L       K  E I    +PE+      N   + S   +  L + T +  F+++   + K  K +     + SQ+   E L  W    + V+ F+I+I   K  +S+ +L   +K+ R F++  +K  MP+LD   R     V+ LL   Q  TR +  LC H K   +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I
Sbjct:  913 KTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLE----------SMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCV------FQLLTPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMVILEKSTASAQNKEKIA--SLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAIEEIAGVGVPEL-----INSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQIHEEKLLYWN---MAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCR-EAFWLGNLKNRDLQGEEI 1399          
BLAST of fancd2-like protein vs. Ensembl Fly
Match: Fancd2 (gene:FBgn0038827 transcript:FBtr0083995)

HSP 1 Score: 68.9366 bits (167), Expect = 4.099e-11
Identity = 49/150 (32.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query: 3628 SKVSYSQRNTLEMLESWEKIVVIV-KLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
             +VS   R   + L+ WE  V ++  L +IV    +  N  L F+K S  F+K ++++ M  L++++R +  ++ + L E+Q VTRF+ +LC H K   N +  S +P +R  +ET +FRVK +L  N C   + ++  + N+D+HG  I
Sbjct: 1273 GQVSVDSRG--DKLKLWESAVDLLNGLLSIVQQVEQPRNFGL-FLKHSLLFLKLLLQHGMSALESIVREDPERLTRFLHELQKVTRFLHQLCCHSKSIKNTAIISYIPSLRETIETLVFRVKALLAANNCHS-AFHMGNMINRDLHGDSI 1418          

HSP 2 Score: 56.6102 bits (135), Expect = 2.001e-7
Identity = 84/349 (24.07%), Postives = 156/349 (44.70%), Query Frame = 1
Query:  703 LVMNMLDSATMG-----MLPSLITFLIK----NTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAF--MNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTL---MKYLCNVDVNTDSTVNAITNL 1707
            L + +LD AT G     +LP LI  L+     +TD +++ +LI  +R    + + N     + S        +     ++L   L++ L  +    +A  +S S    +    SFD I+LL++ +  +     I NI++ +I  E  T   +E + +++  IL+      + I++  M     ++ DFAK +Y   F   N  +  I+ ++ E L  D S+   + +   LE+L+ L       +Q   T +  +L    + +  Q      +   +AF D + +  +     Q++  V ++VKKQL N    IK+ G IG V L   M  + N  V+ D  + ++ N+
Sbjct:  308 LRVRILDFATSGQCSDAILPHLIRLLLNVLKIDTD-DSVRDLIGSLRGIFNWRHTNETEKISASE-------DSKKSQLELFGFLELGLIRSKKFYQACQRS-SASVPAAEFTSFDMILLLLLIHVNEDNSLYIENILRRRIKLEHITVSILEEIRQHYRHILEQHITTLMNILHDFMREKNRIVSDFAKSSYSILFKIFNSIQKNILKKLLE-LTCDKSSPHLTTM--ALELLRELQRKSAKDVQNCATLLIPMLDRISDLSLTQTRVAMDLLCHVAFPDPNLSPCL-----QLQEQVDMVVKKQLINSIDNIKKQGIIGCVQLIDAMARIANNGVDRDEFIASVENV 639          
BLAST of fancd2-like protein vs. Ensembl Zebrafish
Match: fancd2 (FA complementation group D2 [Source:ZFIN;Acc:ZDB-GENE-040116-5])

HSP 1 Score: 99.3673 bits (246), Expect = 2.692e-20
Identity = 161/708 (22.74%), Postives = 287/708 (40.54%), Query Frame = 1
Query:  211 QEMIRGIET---NRINFTQFLQPV----KSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENL----------NSMFNSAVSSTPLMHVRNESSCGVKLI-NSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNE-YKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSD---------------------SFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIG-----KTAKIHLPAHFRLLALL-ELRNKKSLCEINALFGCPV 2193
            QE I  +ET   +   F   L P      S  D    S  +SL ++ L I  L   +I  L  K+ E       ED   +  L +NQ KW     +  ++  KL+ +  +A   +Q  +I+  P+I +D  +  +A++L+  +  N  L    LD +S LNL ++ L E+   VM  L +  +  LP ++ F++ +   ++  E++  +R  +E E            + M N  VS +  +   +     V LI + +K  ++F   + +AWLK+I    +S      D ++L I+ +            ++K K+ K    +  ++  FK H  +++  +   L +   ++ S    ++ F    Y  AF   +  +   ++   L+    +     ++  LE+L  L      ++  F   + G+L       S QI  ++ +   +AF       +  G   Q   H++  ++KQL +     KR G IGAV ++  +       D           S GG L      Q          V  +L+L+ S SE+ PE   + +DEL  L+ T ++  +    I + ++ D                     S LYN   E  E             G+ V L    +A+       +S   G     + + + L   FRLL L  E++++  L EI+AL GCP+
Sbjct:   92 QEFISALETYIEDPERFRNCLLPCVPAPTSQQDTNSSSYQESLVRLLLGIEMLQTLVINTLFEKLPEFMFEGASEDGLNVPRLIVNQLKWLDRIVDGKDLSSKLMQMVSVAPVEIQRDIITSLPEILEDSQHGDMAKELNGLLQQNTQLAVPILDALSSLNLSSTLLSEVREAVMGTLSAVQLEDLPVVVKFVLHSISASDANEVVCDLRKKLELEQCVLPAVLQASQSRMKNKTVSRSSSVPSCSSGQDSVALILDVIKSAIRFQKTISEAWLKAIENIDESEDHKVVDLLVLFILHSTNANHSRRGAERVLKVKVRKGLIQESLLQKTFKGHAQVMRGYFPSILALAQGLLRSPDCCVVPFGGHMYKQAFTAFD-SYCQQEVVGSLVTHACSGVSGEVDVALELLCELVSQKPAEMSQFTVFVKGILDYMDNLTSQQIRRLFHLLSRLAF-----GQEQHGGHIQDDMHIV--IRKQLSSTVPKYKRIGIIGAVMMVGSMGACRNKHD----------GSQGGTLPKETNRQ----------VMALLELVRSCSESSPEAAALCYDELANLLQTCKLDPLVQAWIGKSVLEDFQDDFVVDLGPDISGAFMFPTSVLYNLDEEESEG------------GIAVNL-LPLMALDQQHKTDTSQPAGVKRERRVSPLCLSPFFRLLRLCEEVQHEGDLEEIDALLGCPL 758          

HSP 2 Score: 78.5666 bits (192), Expect = 5.172e-14
Identity = 76/301 (25.25%), Postives = 135/301 (44.85%), Query Frame = 1
Query: 3214 SKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEV--SMLDLTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            S+   + + + R  +PS+N A    + +  L      N       +  LT  FL  +W++ +        Y  ++  L  I+L    D  K  E I    +PE+      N   + +   +  L++ T L  +K +   + K  + +  SK   +Q    E L +W    + V+ F I+I   K  +S  +L+  +K+ R F++  +K  MP+LD   +     V  LL   Q  TR +  +C H K + +    + VP +++ LE F++RVK ML +N C  ++  +  L N+D+ G  I
Sbjct: 1110 SRHAFEYLQNFRSTVPSLNTALCLTQLLIVLSQYGGSNHRTYREQITSLTKHFLCQEWVTASGEKERGNKYNETLQTLLSIYLEHTDDVLKAVEEIAGEGVPEL-----LNAAKDANSRSWPTLNRQTFLVYYKCMMSELEKAVRKIPPSKQMDNQEMQSEKLLTWN---LAVRDFHILINLVKMFDSRPVLTVCLKYGRLFLESFLKLGMPLLDYSFKKHKEDVQGLLKTFQLSTRQLHHMCGHSKIRQDTGLTNHVPALKKSLEQFVYRVKAMLTLNHCQ-EAFWLGNLKNRDLKGEEI 1401          
BLAST of fancd2-like protein vs. Ensembl Zebrafish
Match: fancd2 (FA complementation group D2 [Source:ZFIN;Acc:ZDB-GENE-040116-5])

HSP 1 Score: 99.3673 bits (246), Expect = 2.692e-20
Identity = 161/708 (22.74%), Postives = 287/708 (40.54%), Query Frame = 1
Query:  211 QEMIRGIET---NRINFTQFLQPV----KSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENL----------NSMFNSAVSSTPLMHVRNESSCGVKLI-NSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNE-YKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSD---------------------SFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIG-----KTAKIHLPAHFRLLALL-ELRNKKSLCEINALFGCPV 2193
            QE I  +ET   +   F   L P      S  D    S  +SL ++ L I  L   +I  L  K+ E       ED   +  L +NQ KW     +  ++  KL+ +  +A   +Q  +I+  P+I +D  +  +A++L+  +  N  L    LD +S LNL ++ L E+   VM  L +  +  LP ++ F++ +   ++  E++  +R  +E E            + M N  VS +  +   +     V LI + +K  ++F   + +AWLK+I    +S      D ++L I+ +            ++K K+ K    +  ++  FK H  +++  +   L +   ++ S    ++ F    Y  AF   +  +   ++   L+    +     ++  LE+L  L      ++  F   + G+L       S QI  ++ +   +AF       +  G   Q   H++  ++KQL +     KR G IGAV ++  +       D           S GG L      Q          V  +L+L+ S SE+ PE   + +DEL  L+ T ++  +    I + ++ D                     S LYN   E  E             G+ V L    +A+       +S   G     + + + L   FRLL L  E++++  L EI+AL GCP+
Sbjct:   92 QEFISALETYIEDPERFRNCLLPCVPAPTSQQDTNSSSYQESLVRLLLGIEMLQTLVINTLFEKLPEFMFEGASEDGLNVPRLIVNQLKWLDRIVDGKDLSSKLMQMVSVAPVEIQRDIITSLPEILEDSQHGDMAKELNGLLQQNTQLAVPILDALSSLNLSSTLLSEVREAVMGTLSAVQLEDLPVVVKFVLHSISASDANEVVCDLRKKLELEQCVLPAVLQASQSRMKNKTVSRSSSVPSCSSGQDSVALILDVIKSAIRFQKTISEAWLKAIENIDESEDHKVVDLLVLFILHSTNANHSRRGAERVLKVKVRKGLIQESLLQKTFKGHAQVMRGYFPSILALAQGLLRSPDCCVVPFGGHMYKQAFTAFD-SYCQQEVVGSLVTHACSGVSGEVDVALELLCELVSQKPAEMSQFTVFVKGILDYMDNLTSQQIRRLFHLLSRLAF-----GQEQHGGHIQDDMHIV--IRKQLSSTVPKYKRIGIIGAVMMVGSMGACRNKHD----------GSQGGTLPKETNRQ----------VMALLELVRSCSESSPEAAALCYDELANLLQTCKLDPLVQAWIGKSVLEDFQDDFVVDLGPDISGAFMFPTSVLYNLDEEESEG------------GIAVNL-LPLMALDQQHKTDTSQPAGVKRERRVSPLCLSPFFRLLRLCEEVQHEGDLEEIDALLGCPL 758          

HSP 2 Score: 78.5666 bits (192), Expect = 5.172e-14
Identity = 76/301 (25.25%), Postives = 135/301 (44.85%), Query Frame = 1
Query: 3214 SKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEV--SMLDLTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            S+   + + + R  +PS+N A    + +  L      N       +  LT  FL  +W++ +        Y  ++  L  I+L    D  K  E I    +PE+      N   + +   +  L++ T L  +K +   + K  + +  SK   +Q    E L +W    + V+ F I+I   K  +S  +L+  +K+ R F++  +K  MP+LD   +     V  LL   Q  TR +  +C H K + +    + VP +++ LE F++RVK ML +N C  ++  +  L N+D+ G  I
Sbjct: 1110 SRHAFEYLQNFRSTVPSLNTALCLTQLLIVLSQYGGSNHRTYREQITSLTKHFLCQEWVTASGEKERGNKYNETLQTLLSIYLEHTDDVLKAVEEIAGEGVPEL-----LNAAKDANSRSWPTLNRQTFLVYYKCMMSELEKAVRKIPPSKQMDNQEMQSEKLLTWN---LAVRDFHILINLVKMFDSRPVLTVCLKYGRLFLESFLKLGMPLLDYSFKKHKEDVQGLLKTFQLSTRQLHHMCGHSKIRQDTGLTNHVPALKKSLEQFVYRVKAMLTLNHCQ-EAFWLGNLKNRDLKGEEI 1401          
BLAST of fancd2-like protein vs. Ensembl Xenopus
Match: rfk (riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010122])

HSP 1 Score: 132.494 bits (332), Expect = 2.562e-30
Identity = 141/662 (21.30%), Postives = 286/662 (43.20%), Query Frame = 1
Query:  406 DDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMF----------NSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIF-NEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST-GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLL------FGVGVGL------DYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLAL-LELRNKKSLCEINALFGCPVRFVGGFDSVEAVE-------------LQTVINWLIEVVNAF 2277
            D +   +  L +NQFKW     +  ++  K++ +  +A   +Q+ +I+  P+I +D  +  +A +L+  +  N  L    LD +S LN+ T  L E+   VM+ L +  +  LP +I F++     ++ VE+I ++R  ++ E+ +S+           N   + + +   ++ S C   +++ +K  ++F  ++ +AW+K+I            D I+LLI++  +          ++++KI     + Q ++  F+ H  +L+  +   L++  S++ S +  ++ F    Y +AF +    +   ++   L+  + +   + ++  L+VL  L  +    + L+   + G+L      N+ QI  ++ I  ++AF    E   I  D       + ++++KQL +     KR G IGAV ++  +  ++    + V A+  L+ +                                  E VPE   + +DEL  L+          V K +     D F+ + T  ++       K  + L       G+ + +      D C      + +   S ++   + I L   FRLL L +E +++ +L EI+AL GCP+ ++   +  E +E             L   +NW  E+VNAF
Sbjct:  102 DSDGISIPRLIINQFKWLDRILDCKDLTLKIMQLISVAPVDIQHDIITSLPEILEDSQHNDVARELNSLLQQNTQLTVPILDALSSLNINTDLLSEVRQSVMSTLSAVELEDLPVIIKFILHAVTPSDAVEVISELRKKLDLESCSSLAQIHATQNKERNKPQAGSSVNKTKS-SDCVSLMMDVIKSAVRFQKHMSEAWIKAIENVDTVGDHKVSDLIVLLILYTTQTNSSKKQAERVLRNKIRSGFISDQLLQNAFRNHSQVLRDYFPSILSLAQSMLRSAEQSVVSFGSLMYKSAF-SVFDSYCQQEVVGALVTHVCSGYPAEVDVSLDVLTDLVSSHAAAVALYAVFVKGILDYLDNLNAQQIRKLFHILSVLAFSRGQEGSHIQDD-------MFIVIRKQLSSTALKYKRIGIIGAVRMVGSMAQLNNTQMNNVTALLELVQTCS--------------------------------EQVPEASALYYDELSSLVQKRNLDPLSWVGKTVLTDFQDDFVDDLTPTVEGNYIFPVKAMYNLDEDDSQGGIAINILPVLSKDMCSRGAEQAANKEESRVV---SPICLSPFFRLLRLCIEDQHEGNLEEIDALLGCPL-YLTDLEITEKMESLSKQEREFLCSLLFFALNWFREIVNAF 718          

HSP 2 Score: 75.0998 bits (183), Expect = 9.948e-13
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query: 3457 KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            K  E I    +PE+      N   +     Y  L + T +  F+++ D + K  K +   S  +  TL+  E   +  + V+ F I++   K  +S  +LS  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C H K   + +  + VP +++ LE F++RVK ML +N C  D+  +  L N+D+ G  I
Sbjct: 1085 KAVEEIAGVGVPEL-----VNAAKDAGSSSYPTLTRQTFIVFFRVMMDKLEKCVKCIP--SGKKAETLQQTEQLLRWNLAVRDFHILVNLVKMFDSRPVLSICLKYGRMFVETFLKLGMPLLDCCFKKHREDVQSLLKTLQLSTRQLHHMCGHSKIHQDTALTNHVPLLKKTLELFVYRVKAMLVLNNCQ-DAFWLGNLKNRDLQGEEI 1285          
BLAST of fancd2-like protein vs. Ensembl Xenopus
Match: rfk (riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010122])

HSP 1 Score: 126.331 bits (316), Expect = 2.105e-28
Identity = 153/696 (21.98%), Postives = 311/696 (44.68%), Query Frame = 1
Query:  211 QEMIRGIET---NRINFTQFLQPV----KSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMF----------NSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIF-NEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXS---DSFLYNFTSXXXXXXXXXKKDRHLL------FGVGVGL------DYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLAL-LELRNKKSLCEINALFGCPV 2193
            QE I G+E+   +R  F   L P     ++     + S   SL ++ L +  L + +I  L  K+ E    +   D   +  L +NQFKW     +  ++  K++ +  +A   +Q+ +I+  P+I +D  +  +A +L+  +  N  L    LD +S LN+ T  L E+   VM+ L +  +  LP +I F++     ++ VE+I ++R  ++ E+ +S+           N   + + +   ++ S C   +++ +K  ++F  ++ +AW+K+I            D I+LLI++  +          ++++KI     + Q ++  F+ H  +L+  +   L++  S++ S +  ++ F    Y +AF +    +   ++   L+  + +   + ++  L+VL  L  +    + L+   + G+L      N+ QI  ++ I  ++AF    E   I  D       + ++++KQL +     KR G IGAV ++  +            A+     S     N    E   Q+T        +L+L+ + SE VPE   + +DEL  L+    +  + +  + + +++   D F+ + T  ++       K  + L       G+ + +      D C      + +   S ++   + I L   FRLL L +E +++ +L EI+AL GCP+
Sbjct:   95 QEFISGLESHIEDRDTFRNCLLPCGNRQETEASTMVGSFHDSLMKLLLGLEILQESVINTLFEKLPEFLYDSVGSDGISIPRLIINQFKWLDRILDCKDLTLKIMQLISVAPVDIQHDIITSLPEILEDSQHNDVARELNSLLQQNTQLTVPILDALSSLNINTDLLSEVRQSVMSTLSAVELEDLPVIIKFILHAVTPSDAVEVISELRKKLDLESCSSLAQIHATQNKERNKPQAGSSVNKTKS-SDCVSLMMDVIKSAVRFQKHMSEAWIKAIENVDTVGDHKVSDLIVLLILYTTQTNSSKKQAERVLRNKIRSGFISDQLLQNAFRNHSQVLRDYFPSILSLAQSMLRSAEQSVVSFGSLMYKSAF-SVFDSYCQQEVVGALVTHVCSGYPAEVDVSLDVLTDLVSSHAAAVALYAVFVKGILDYLDNLNAQQIRKLFHILSVLAFSRGQEGSHIQDD-------MFIVIRKQLSSTALKYKRIGIIGAVRMVGSM------------AVNKKHGSKNPENNPLSAESFRQVT-------ALLELVQTCSEQVPEASALYYDELSSLVQKRNLDPLVMSWVGKTVLTDFQDDFVDDLTPTVEGNYIFPVKAMYNLDEDDSQGGIAINILPVLSKDMCSRGAEQAANKEESRVV---SPICLSPFFRLLRLCIEDQHEGNLEEIDALLGCPL 759          

HSP 2 Score: 78.9518 bits (193), Expect = 5.421e-14
Identity = 70/253 (27.67%), Postives = 117/253 (46.25%), Query Frame = 1
Query: 3352 LTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILK--KCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  +FL   WI  +      T Y  ++  L  I+L    D  K  E I    +PE+      N   +     Y  L + T +  F+++ D + K  KC    K + + +   E L  W    + V+ F I++   K  +S  +LS  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C H K   + +  + VP +++ LE F++RVK ML +N C  D+  +  L N+D+ G  I
Sbjct: 1149 MAKQFLCQPWIQPSGEREKGTRYHENLQSLLCIYLENTDDVLKAVEEIAGVGVPEL-----VNAAKDAGSSSYPTLTRQTFIVFFRVMMDKLEKCVKCIPSGKKAETLQEQTEQLLRWN---LAVRDFHILVNLVKMFDSRPVLSICLKYGRMFVETFLKLGMPLLDCCFKKHREDVQSLLKTLQLSTRQLHHMCGHSKIHQDTALTNHVPLLKKTLELFVYRVKAMLVLNNCQ-DAFWLGNLKNRDLQGEEI 1392          
BLAST of fancd2-like protein vs. Ensembl Xenopus
Match: rfk (riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010122])

HSP 1 Score: 124.405 bits (311), Expect = 8.235e-28
Identity = 131/618 (21.20%), Postives = 271/618 (43.85%), Query Frame = 1
Query:  433 LCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMF-------------NSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIF-NEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDS-TVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXS---DSFLYNFTSXXXXXXXXXKKDRHLL------FGVGVGL------DYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLAL-LELRNKKSLCEINALFGCPV 2193
            L +NQFKW     +  ++  K++ +  +A   +Q+ +I+  P+I +D  +  +A +L+  +  N  L    LD +S LN+ T  L E+   VM+ L +  +  LP +I F++     ++ VE+I ++R  ++ E+ +S+               + ++  P   +   S C   +++ +K  ++F  ++ +AW+K+I            D I+LLI++  +          ++++KI     + Q ++  F+ H  +L+  +   L++  S++ S +  ++ F    Y +AF +    +   ++   L+  + +   + ++  L+VL  L  +    + L+   + G+L      N+ QI  ++ I  ++AF    E   I  D       + ++++KQL +     KR G IGAV ++  + N     DS  V A+  L+ +                                  E VPE   + +DEL  L+    +  + +  + + +++   D F+ + T  ++       K  + L       G+ + +      D C      + +   S ++   + I L   FRLL L +E +++ +L EI+AL GCP+
Sbjct:  101 LIINQFKWLDRILDCKDLTLKIMQLISVAPVDIQHDIITSLPEILEDSQHNDVARELNSLLQQNTQLTVPILDALSSLNINTDLLSEVRQSVMSTLSAVELEDLPVIIKFILHAVTPSDAVEVISELRKKLDLESCSSLAQIHATQNKERNKPQAGMNGNPFC-IGLSSDCVSLMMDVIKSAVRFQKHMSEAWIKAIENVDTVGDHKVSDLIVLLILYTTQTNSSKKQAERVLRNKIRSGFISDQLLQNAFRNHSQVLRDYFPSILSLAQSMLRSAEQSVVSFGSLMYKSAF-SVFDSYCQQEVVGALVTHVCSGYPAEVDVSLDVLTDLVSSHAAAVALYAVFVKGILDYLDNLNAQQIRKLFHILSVLAFSRGQEGSHIQDD-------MFIVIRKQLSSTALKYKRIGIIGAVRMVGSMAN---KPDSKKVTALLELVQTCS--------------------------------EQVPEASALYYDELSSLVQKRNLDPLVMSWVGKTVLTDFQDDFVDDLTPTVEGNYIFPVKAMYNLDEDDSQGGIAINILPVLSKDMCSRGAEQAANKEESRVV---SPICLSPFFRLLRLCIEDQHEGNLEEIDALLGCPL 671          

HSP 2 Score: 78.9518 bits (193), Expect = 6.026e-14
Identity = 70/253 (27.67%), Postives = 117/253 (46.25%), Query Frame = 1
Query: 3352 LTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILK--KCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  +FL   WI  +      T Y  ++  L  I+L    D  K  E I    +PE+      N   +     Y  L + T +  F+++ D + K  KC    K + + +   E L  W    + V+ F I++   K  +S  +LS  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C H K   + +  + VP +++ LE F++RVK ML +N C  D+  +  L N+D+ G  I
Sbjct: 1057 MAKQFLCQPWIQPSGEREKGTRYHENLQSLLCIYLENTDDVLKAVEEIAGVGVPEL-----VNAAKDAGSSSYPTLTRQTFIVFFRVMMDKLEKCVKCIPSGKKAETLQEQTEQLLRWN---LAVRDFHILVNLVKMFDSRPVLSICLKYGRMFVETFLKLGMPLLDCCFKKHREDVQSLLKTLQLSTRQLHHMCGHSKIHQDTALTNHVPLLKKTLELFVYRVKAMLVLNNCQ-DAFWLGNLKNRDLQGEEI 1300          
BLAST of fancd2-like protein vs. Ensembl Xenopus
Match: rfk (riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010122])

HSP 1 Score: 124.02 bits (310), Expect = 9.123e-28
Identity = 153/690 (22.17%), Postives = 306/690 (44.35%), Query Frame = 1
Query:  211 QEMIRGIET---NRINFTQFLQPVKSNYDLYL-FSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMF----------NSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIF-NEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST-GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLL------FGVGVGL------DYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLAL-LELRNKKSLCEINALFGCPV 2193
            QE I G+E+   +R  F   L P  +  +         SL + C       + +I  L  K+ E     D +   +  L +NQFKW     +  ++  K++ +  +A   +Q+ +I+  P+I +D  +  +A +L+  +  N  L    LD +S LN+ T  L E+   VM+ L +  +  LP +I F++     ++ VE+I ++R  ++ E+ +S+           N   + + +   ++ S C   +++ +K  ++F  ++ +AW+K+I            D I+LLI++  +          ++++KI     + Q ++  F+ H  +L+  +   L++  S++ S +  ++ F    Y +AF +    +   ++   L+  + +   + ++  L+VL  L  +    + L+   + G+L      N+ QI  ++ I  ++AF    E          I++ + ++++KQL +     KR G IGAV ++  +    VN  S   +++             E+ Q  Q       V+ +L+L+ + SE VPE   + +DEL  L+          V K +     D F+ + T  ++       K  + L       G+ + +      D C      + +   S ++   + I L   FRLL L +E +++ +L EI+AL GCP+
Sbjct:   86 QEFISGLESHIEDRDTFRNCLLPCGNRQETEARIELSFSLSKNCYFFLLCWESVINTLFEKLPE--FLYDSDGISIPRLIINQFKWLDRILDCKDLTLKIMQLISVAPVDIQHDIITSLPEILEDSQHNDVARELNSLLQQNTQLTVPILDALSSLNINTDLLSEVRQSVMSTLSAVELEDLPVIIKFILHAVTPSDAVEVISELRKKLDLESCSSLAQIHATQNKERNKPQAGSSVNKTKS-SDCVSLMMDVIKSAVRFQKHMSEAWIKAIENVDTVGDHKVSDLIVLLILYTTQTNSSKKQAERVLRNKIRSGFISDQLLQNAFRNHSQVLRDYFPSILSLAQSMLRSAEQSVVSFGSLMYKSAF-SVFDSYCQQEVVGALVTHVCSGYPAEVDVSLDVLTDLVSSHAAAVALYAVFVKGILDYLDNLNAQQIRKLFHILSVLAFSRGQEGS-------HIQDDMFIVIRKQLSSTALKYKRIGIIGAVRMVGSMA---VNKASQSGSVSQKPRW-------VEDHQFPQCC-----VTALLELVQTCSEQVPEASALYYDELSSLVQKRNLDPLSWVGKTVLTDFQDDFVDDLTPTVEGNYIFPVKAMYNLDEDDSQGGIAINILPVLSKDMCSRGAEQAANKEESRVV---SPICLSPFFRLLRLCIEDQHEGNLEEIDALLGCPL 746          

HSP 2 Score: 74.7146 bits (182), Expect = 1.108e-12
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query: 3457 KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            K  E I    +PE+      N   +     Y  L + T +  F+++ D + K  K +   S  +  TL+  E   +  + V+ F I++   K  +S  +LS  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C H K   + +  + VP +++ LE F++RVK ML +N C  D+  +  L N+D+ G  I
Sbjct: 1153 KAVEEIAGVGVPEL-----VNAAKDAGSSSYPTLTRQTFIVFFRVMMDKLEKCVKCIP--SGKKAETLQQTEQLLRWNLAVRDFHILVNLVKMFDSRPVLSICLKYGRMFVETFLKLGMPLLDCCFKKHREDVQSLLKTLQLSTRQLHHMCGHSKIHQDTALTNHVPLLKKTLELFVYRVKAMLVLNNCQ-DAFWLGNLKNRDLQGEEI 1353          
BLAST of fancd2-like protein vs. Ensembl Xenopus
Match: rfk (riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010122])

HSP 1 Score: 121.324 bits (303), Expect = 7.095e-27
Identity = 92/416 (22.12%), Postives = 198/416 (47.60%), Query Frame = 1
Query:  433 LCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMF----------NSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIF-NEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLM 1647
            L +NQFKW     +  ++  K++ +  +A   +Q+ +I+  P+I +D  +  +A +L+  +  N  L    LD +S LN+ T  L E+   VM+ L +  +  LP +I F++     ++ VE+I ++R  ++ E+ +S+           N   + + +   ++ S C   +++ +K  ++F  ++ +AW+K+I            D I+LLI++  +          ++++KI     + Q ++  F+ H  +L+  +   L++  S++ S +  ++ F    Y +AF +    +   ++   L+  + +   + ++  L+VL  L  +    + L+   + G+L      N+ QI  ++ I  ++AF    E   I  D       + ++++KQL +     KR G IGAV ++
Sbjct:   78 LIINQFKWLDRILDCKDLTLKIMQLISVAPVDIQHDIITSLPEILEDSQHNDVARELNSLLQQNTQLTVPILDALSSLNINTDLLSEVRQSVMSTLSAVELEDLPVIIKFILHAVTPSDAVEVISELRKKLDLESCSSLAQIHATQNKERNKPQAGSSVNKTKS-SDCVSLMMDVIKSAVRFQKHMSEAWIKAIENVDTVGDHKVSDLIVLLILYTTQTNSSKKQAERVLRNKIRSGFISDQLLQNAFRNHSQVLRDYFPSILSLAQSMLRSAEQSVVSFGSLMYKSAF-SVFDSYCQQEVVGALVTHVCSGYPAEVDVSLDVLTDLVSSHAAAVALYAVFVKGILDYLDNLNAQQIRKLFHILSVLAFSRGQEGSHIQDD-------MFIVIRKQLSSTALKYKRIGIIGAVRMV 484          

HSP 2 Score: 77.411 bits (189), Expect = 1.634e-13
Identity = 69/251 (27.49%), Postives = 117/251 (46.61%), Query Frame = 1
Query: 3352 LTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  +FL   WI  +      T Y  ++  L  I+L    D  K  E I    +PE+      N   +     Y  L + T +  F+++ D  L+KC  +  +   ++   E L  W    + V+ F I++   K  +S  +LS  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C H K   + +  + VP +++ LE F++RVK ML +N C  D+  +  L N+D+ G  I
Sbjct: 1026 MAKQFLCQPWIQPSGEREKGTRYHENLQSLLCIYLENTDDVLKAVEEIAGVGVPEL-----VNAAKDAGSSSYPTLTRQTFIVFFRVMMD-KLEKC--VKCIPSGKKEQTEQLLRWN---LAVRDFHILVNLVKMFDSRPVLSICLKYGRMFVETFLKLGMPLLDCCFKKHREDVQSLLKTLQLSTRQLHHMCGHSKIHQDTALTNHVPLLKKTLELFVYRVKAMLVLNNCQ-DAFWLGNLKNRDLQGEEI 1264          
BLAST of fancd2-like protein vs. Ensembl Mouse
Match: Fancd2 (Fanconi anemia, complementation group D2 [Source:MGI Symbol;Acc:MGI:2448480])

HSP 1 Score: 132.494 bits (332), Expect = 1.937e-30
Identity = 164/722 (22.71%), Postives = 317/722 (43.91%), Query Frame = 1
Query:  310 KSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENL----------NSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST---GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGV-------GVGLD-----YCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKS-LCEINALFGCPVRFVGGFDSVEAVELQTV-------------INWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVE 2355
            KSL ++ L I  L   +I+ML  K+ +    +++ D   +A L +NQ KW     +  ++  +++ +  +A   +Q+  I+  P+I  D  +  + ++L + +  N  L    LD  S L L  +FL +I  LVM  L S  +   P ++ FL+ +      +E+I ++R N+  +            + + +  ++S+      ++  C V + + +K  +++   + +AW K+I     +    + D ++LLII++        +  ++++KI  +   +Q +++ F  H+ +LK I    L +  ++  S    ++ F    Y  AF   +  +   ++   L+  + +  ++ ++  L+VL  L     + ++L    + G+L      +  QI  I+ I   +AF          G    I++ + L+++KQL +  F  K  G IGAVT+   +       D +V +     NS+    N    EQ++Q+T+       +L+L+ S +E  P    + +DE   LI        T   V + I     D+F+ +F +  +       K    L+G+       G+ ++     Y E A   S++ S  +     + + L +HFRLL L   R     L EI+ L  CP+ F+   +  E +E  +               NW  EVVNAF    +        + K++ R+K +VE
Sbjct:  131 KSLIKLLLGIDILQPAIIKMLFEKVPQFLFESENRDGINMARLIINQLKWLDRIVDGKDLTAQMMQLISVAPVNLQHDFITSLPEILGDSQHANVGKELGELLVQNTSLTVPILDVFSSLRLDPNFLSKIRQLVMGKLSSVRLEDFPVIVKFLLHSVTDTTSLEVIAELRENLNVQQFILPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLVFDVIKSAIRYEKTISEAWFKAIERIESAAEHKALDVVMLLIIYSTSTQTKKGVEKLLRNKIQSDCIQEQLLDSAFSTHYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFFDT-YCQQEVVGALVTHVCSGTEAEVDTALDVLLELIVLNASAMRLNAAFVKGILDYLENMSPQQIRKIFCILSTLAFSQQP------GTSNHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAE-----DRSVPS-----NSSQRSAN-VSSEQRTQVTS-------LLQLVHSCTEHSPWASSLYYDEFANLIQERKLAPKTLEWVGQTIFNDFQDAFVVDFCAAPEGDFPFPVK---ALYGLEEYSTQDGIVINLLPLFYQECAKDASRATSQESSQRSMSSLCLASHFRLLRLCVARQHDGNLDEIDGLLDCPL-FLPDLEPGEKLESMSAKDRSLMCSLTFLTFNWFREVVNAFCQQTS-----PEMKGKVLSRLKDLVE 818          

HSP 2 Score: 78.9518 bits (193), Expect = 3.984e-14
Identity = 126/533 (23.64%), Postives = 229/533 (42.96%), Query Frame = 1
Query: 2716 ENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEH-----------CFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIIS-MQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIF------HYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILS----IREKIPSINIAAAYCEFVSELLTITSV-NESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIXXXXXXXXXXXXXXXXXXXCTDVSEELNACSDDVENESLNE 4197
            +N R  FRELD+ VF++L S  +TK   D  +    +E+  LG  EL + L DL  K+E+           CF+++     GF+  +      +   + Q+  LT + N +  + + F+ + ++ +                   ++ +L++L  +F      H  K+ L  S  E++   L  +      + L+ Q  S        +PS          +  LL  ++V N+ +  +  L  + L   W         +    L ++  + L       K  E I    +PE+ +        + +   +  L + T +  F+++   + K  K L     + SQ+   E L  W    + V+ F+I++   K  +S  +L   +K+ R F++  +K  MP+LD   R     V+ LL  +Q  TR +  LC H K + +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I     S +E   ED+E+ V + VS   N  ++D E+E+ +E
Sbjct:  917 QNYRAFFRELDIEVFSILHSGLVTKFILDTEMHTEATEVVQLGPAELLFLLEDLSQKLENMLTAPFAKRICCFKNKGRQNIGFSHLHQRSVQDIVHCVVQL--LTPMCNHLENIHNFFQCLGAEHLSADDKARATAQEQHTMACCYQKLLQVLHALFAWKGFTHQSKHRLLHSALEVLSNRLKQMEQDQPLEELVSQSFSYLQNFHHSVPSFQCGLYLLRLLMALLEKSAVPNQKKEKLASLAKQLLCRAWPHGEKEKNPTFNDHLHDVLYIYLEHTDNVLKAIEEITGVGVPELVSA-----PKDAASSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTAADSQQVHEEKLLYWN---MAVRDFSILLNLMKVFDSYPVLHVCLKYGRRFVEAFLKQCMPLLDFSFRKHREDVLSLLQTLQLNTRLLHHLCGHSKIRQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCR-EAFWLGTLKNRDLQGEEIISQDPSSSESNAEDSEDGVTSHVSR--NRATEDGEDEASDE 1436          
BLAST of fancd2-like protein vs. Ensembl Mouse
Match: Fancd2 (Fanconi anemia, complementation group D2 [Source:MGI Symbol;Acc:MGI:2448480])

HSP 1 Score: 132.109 bits (331), Expect = 2.400e-30
Identity = 164/722 (22.71%), Postives = 317/722 (43.91%), Query Frame = 1
Query:  310 KSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENL----------NSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST---GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGV-------GVGLD-----YCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKS-LCEINALFGCPVRFVGGFDSVEAVELQTV-------------INWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVE 2355
            KSL ++ L I  L   +I+ML  K+ +    +++ D   +A L +NQ KW     +  ++  +++ +  +A   +Q+  I+  P+I  D  +  + ++L + +  N  L    LD  S L L  +FL +I  LVM  L S  +   P ++ FL+ +      +E+I ++R N+  +            + + +  ++S+      ++  C V + + +K  +++   + +AW K+I     +    + D ++LLII++        +  ++++KI  +   +Q +++ F  H+ +LK I    L +  ++  S    ++ F    Y  AF   +  +   ++   L+  + +  ++ ++  L+VL  L     + ++L    + G+L      +  QI  I+ I   +AF          G    I++ + L+++KQL +  F  K  G IGAVT+   +       D +V +     NS+    N    EQ++Q+T+       +L+L+ S +E  P    + +DE   LI        T   V + I     D+F+ +F +  +       K    L+G+       G+ ++     Y E A   S++ S  +     + + L +HFRLL L   R     L EI+ L  CP+ F+   +  E +E  +               NW  EVVNAF    +        + K++ R+K +VE
Sbjct:  131 KSLIKLLLGIDILQPAIIKMLFEKVPQFLFESENRDGINMARLIINQLKWLDRIVDGKDLTAQMMQLISVAPVNLQHDFITSLPEILGDSQHANVGKELGELLVQNTSLTVPILDVFSSLRLDPNFLSKIRQLVMGKLSSVRLEDFPVIVKFLLHSVTDTTSLEVIAELRENLNVQQFILPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLVFDVIKSAIRYEKTISEAWFKAIERIESAAEHKALDVVMLLIIYSTSTQTKKGVEKLLRNKIQSDCIQEQLLDSAFSTHYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFFDT-YCQQEVVGALVTHVCSGTEAEVDTALDVLLELIVLNASAMRLNAAFVKGILDYLENMSPQQIRKIFCILSTLAFSQQP------GTSNHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAE-----DRSVPS-----NSSQRSAN-VSSEQRTQVTS-------LLQLVHSCTEHSPWASSLYYDEFANLIQERKLAPKTLEWVGQTIFNDFQDAFVVDFCAAPEGDFPFPVK---ALYGLEEYSTQDGIVINLLPLFYQECAKDASRATSQESSQRSMSSLCLASHFRLLRLCVARQHDGNLDEIDGLLDCPL-FLPDLEPGEKLESMSAKDRSLMCSLTFLTFNWFREVVNAFCQQTS-----PEMKGKVLSRLKDLVE 818          

HSP 2 Score: 80.4925 bits (197), Expect = 1.516e-14
Identity = 124/530 (23.40%), Postives = 225/530 (42.45%), Query Frame = 1
Query: 2716 ENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEH-----------CFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIIS-MQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIF------HYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILS----IREKIPSINIAAAYCEFVSELLTITSV-NESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIXXXXXXXXXXXXXXXXXXXCTDVSEELNACSDDVENESLNE 4197
            +N R  FRELD+ VF++L S  +TK   D  +    +E+  LG  EL + L DL  K+E+           CF+++     GF+  +      +   + Q+  LT + N +  + + F+ + ++ +                   ++ +L++L  +F      H  K+ L  S  E++   L  +      + L+ Q  S        +PS          +  LL  ++V N+ +  +  L  + L   W         +    L ++  + L       K  E I    +PE+ +        + +   +  L + T +  F+++   + K  K L     + SQ+   E L  W    + V+ F+I          +L+ +K+ R F++  +K  MP+LD   R     V+ LL  +Q  TR +  LC H K + +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I     S +E   ED+E+ V + VS   N  ++D E+E+ +E
Sbjct:  917 QNYRAFFRELDIEVFSILHSGLVTKFILDTEMHTEATEVVQLGPAELLFLLEDLSQKLENMLTAPFAKRICCFKNKGRQNIGFSHLHQRSVQDIVHCVVQL--LTPMCNHLENIHNFFQCLGAEHLSADDKARATAQEQHTMACCYQKLLQVLHALFAWKGFTHQSKHRLLHSALEVLSNRLKQMEQDQPLEELVSQSFSYLQNFHHSVPSFQCGLYLLRLLMALLEKSAVPNQKKEKLASLAKQLLCRAWPHGEKEKNPTFNDHLHDVLYIYLEHTDNVLKAIEEITGVGVPELVSA-----PKDAASSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTAADSQQVHEEKLLYWN---MAVRDFSI----------LLNLMKYGRRFVEAFLKQCMPLLDFSFRKHREDVLSLLQTLQLNTRLLHHLCGHSKIRQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCR-EAFWLGTLKNRDLQGEEIISQDPSSSESNAEDSEDGVTSHVSR--NRATEDGEDEASDE 1423          
BLAST of fancd2-like protein vs. UniProt/SwissProt
Match: sp|Q80V62|FACD2_MOUSE (Fanconi anemia group D2 protein homolog OS=Mus musculus OX=10090 GN=Fancd2 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.355e-29
Identity = 164/722 (22.71%), Postives = 317/722 (43.91%), Query Frame = 1
Query:  310 KSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENL----------NSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST---GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGV-------GVGLD-----YCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKS-LCEINALFGCPVRFVGGFDSVEAVELQTV-------------INWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVE 2355
            KSL ++ L I  L   +I+ML  K+ +    +++ D   +A L +NQ KW     +  ++  +++ +  +A   +Q+  I+  P+I  D  +  + ++L + +  N  L    LD  S L L  +FL +I  LVM  L S  +   P ++ FL+ +      +E+I ++R N+  +            + + +  ++S+      ++  C V + + +K  +++   + +AW K+I     +    + D ++LLII++        +  ++++KI  +   +Q +++ F  H+ +LK I    L +  ++  S    ++ F    Y  AF   +  +   ++   L+  + +  ++ ++  L+VL  L     + ++L    + G+L      +  QI  I+ I   +AF          G    I++ + L+++KQL +  F  K  G IGAVT+   +       D +V +     NS+    N    EQ++Q+T+       +L+L+ S +E  P    + +DE   LI        T   V + I     D+F+ +F +  +       K    L+G+       G+ ++     Y E A   S++ S  +     + + L +HFRLL L   R     L EI+ L  CP+ F+   +  E +E  +               NW  EVVNAF    +        + K++ R+K +VE
Sbjct:  131 KSLIKLLLGIDILQPAIIKMLFEKVPQFLFESENRDGINMARLIINQLKWLDRIVDGKDLTAQMMQLISVAPVNLQHDFITSLPEILGDSQHANVGKELGELLVQNTSLTVPILDVFSSLRLDPNFLSKIRQLVMGKLSSVRLEDFPVIVKFLLHSVTDTTSLEVIAELRENLNVQQFILPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLVFDVIKSAIRYEKTISEAWFKAIERIESAAEHKALDVVMLLIIYSTSTQTKKGVEKLLRNKIQSDCIQEQLLDSAFSTHYLVLKDICPSILLLAQTLFHSQDQRIILFGSLLYKYAFKFFDT-YCQQEVVGALVTHVCSGTEAEVDTALDVLLELIVLNASAMRLNAAFVKGILDYLENMSPQQIRKIFCILSTLAFSQQP------GTSNHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAE-----DRSVPS-----NSSQRSAN-VSSEQRTQVTS-------LLQLVHSCTEHSPWASSLYYDEFANLIQERKLAPKTLEWVGQTIFNDFQDAFVVDFCAAPEGDFPFPVK---ALYGLEEYSTQDGIVINLLPLFYQECAKDASRATSQESSQRSMSSLCLASHFRLLRLCVARQHDGNLDEIDGLLDCPL-FLPDLEPGEKLESMSAKDRSLMCSLTFLTFNWFREVVNAFCQQTS-----PEMKGKVLSRLKDLVE 818          

HSP 2 Score: 78.9518 bits (193), Expect = 2.787e-13
Identity = 126/533 (23.64%), Postives = 229/533 (42.96%), Query Frame = 1
Query: 2716 ENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEH-----------CFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIIS-MQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIF------HYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILS----IREKIPSINIAAAYCEFVSELLTITSV-NESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIXXXXXXXXXXXXXXXXXXXCTDVSEELNACSDDVENESLNE 4197
            +N R  FRELD+ VF++L S  +TK   D  +    +E+  LG  EL + L DL  K+E+           CF+++     GF+  +      +   + Q+  LT + N +  + + F+ + ++ +                   ++ +L++L  +F      H  K+ L  S  E++   L  +      + L+ Q  S        +PS          +  LL  ++V N+ +  +  L  + L   W         +    L ++  + L       K  E I    +PE+ +        + +   +  L + T +  F+++   + K  K L     + SQ+   E L  W    + V+ F+I++   K  +S  +L   +K+ R F++  +K  MP+LD   R     V+ LL  +Q  TR +  LC H K + +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I     S +E   ED+E+ V + VS   N  ++D E+E+ +E
Sbjct:  917 QNYRAFFRELDIEVFSILHSGLVTKFILDTEMHTEATEVVQLGPAELLFLLEDLSQKLENMLTAPFAKRICCFKNKGRQNIGFSHLHQRSVQDIVHCVVQL--LTPMCNHLENIHNFFQCLGAEHLSADDKARATAQEQHTMACCYQKLLQVLHALFAWKGFTHQSKHRLLHSALEVLSNRLKQMEQDQPLEELVSQSFSYLQNFHHSVPSFQCGLYLLRLLMALLEKSAVPNQKKEKLASLAKQLLCRAWPHGEKEKNPTFNDHLHDVLYIYLEHTDNVLKAIEEITGVGVPELVSA-----PKDAASSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTAADSQQVHEEKLLYWN---MAVRDFSILLNLMKVFDSYPVLHVCLKYGRRFVEAFLKQCMPLLDFSFRKHREDVLSLLQTLQLNTRLLHHLCGHSKIRQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCR-EAFWLGTLKNRDLQGEEIISQDPSSSESNAEDSEDGVTSHVSR--NRATEDGEDEASDE 1436          
BLAST of fancd2-like protein vs. UniProt/SwissProt
Match: sp|Q6IV68|FACD2_RAT (Fanconi anemia group D2 protein homolog OS=Rattus norvegicus OX=10116 GN=Fancd2 PE=2 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 4.269e-26
Identity = 156/672 (23.21%), Postives = 292/672 (43.45%), Query Frame = 1
Query:  310 KSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIR--INVEFENLNSMFNSA--------VSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLIST---GXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYC----------------EIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKS-LCEINALFGCPVRFVGGFDSVEAVE 2232
            KSL ++ L I  L   +I+ML  K+ +    ++  D   +  L ++Q KW     +  ++  +++ +  +A   +Q+  I+  P+I  D  +  + ++L + +  N  L    LD  S L L  +FL EI  LVM  L S  +  LP ++ F++ +   +  +E+I ++R  +NV+   L S   ++        ++S+      ++  C V L + +K  +++   + +AW+K+I     +    + D  +LLII+         +  ++++KI  +   +Q +++ F  H  +LK I    L +  ++  S    ++ F       AF   +  +   ++   L+  + +  ++ ++A L+VL  L     + ++L    I G+L      +  QI  I+ I   +AF          G    I++ + L+++KQL +  F  K  G IGAVT+   +       D T+   +N    +  V      EQ +Q+T+       +L+L+ S +E  P    + +DE   LI        T   V + I     D+F+ +F +       + + D         GL+ C                E A  VSQ  S  +     + + L +HFRLL L   R     L EI+AL  CP+ F+   +  E +E
Sbjct:  133 KSLIKLLLGIDILQPAIIKMLFEKVPQFLFESESRDGISMPRLIISQLKWLDRIVDSKDLTTQMMQLISVAPVNLQHDFITSLPEILGDSQHANVGKELSELLVQNTSLTVPILDVFSSLRLDPNFLSEIRQLVMGKLSSVRLEDLPVIVKFILHSVTDSTSLEVIAELREKLNVQHFTLPSRIQASQSKLKSKGLASSSGNQENSDKDCIVLLFDVIKSAIRYEKTISEAWIKAIERIQSAAEHKALDVAMLLIIYGTSTQTKKGVERLLRNKIQSDCIQEQLLDSTFSTHCLVLKDICPSILLLAQTLFHSQDQRIILFGSLLCKYAFKFFDT-YCQQEVVGALVTHVCSGNEAEVDAALDVLLELIVLNASAMRLNAAFIKGILDYLENMSPQQIRKIFCILSTLAFSQQP------GTSNHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAE-----DRTMP--SNSTQRSASV----SSEQHTQVTS-------LLQLVHSCTEHSPWASSLYYDEFANLIQERKLAPKTLEWVAQTIFNDFQDAFVVDFCA-------VPEGDFPFPVKALYGLEECNTQDGIVINLLPLFFQEFAKDVSQVTSQESSQKSMSPLCLASHFRLLRLCVARQHNGNLDEIDALLDCPL-FLPDLEPGEKLE 771          

HSP 2 Score: 71.633 bits (174), Expect = 5.164e-11
Identity = 60/211 (28.44%), Postives = 98/211 (46.45%), Query Frame = 1
Query: 3457 KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            K  E I    +PE+      N   + S   +  L + T +  F+++   + K  K L     + SQ+   E L  W    + V+ F+I+I   K  +S  +L   +K+ R F++  +K  MP+LD   R     V+ LL  +Q  TR +  LC H K   +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I
Sbjct: 1198 KAIEEITGVGVPEL-----VNAPKDASSSTFPTLTRHTFVIFFRVMMAELEKTVKGLQAGTATDSQQVHEEKLLYWN---MAVRDFSILINLMKVFDSYPVLHVCLKYGRRFVEAFLKQCMPLLDFSFRKHRDDVLSLLQTLQLNTRLLHHLCGHSKIHQDTRLTKHVPLLKKSLELLVCRVKAMLVLNNCR-EAFWLGTLKNRDLQGEEI 1399          
BLAST of fancd2-like protein vs. UniProt/SwissProt
Match: sp|Q9BXW9|FACD2_HUMAN (Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 2.373e-22
Identity = 108/480 (22.50%), Postives = 221/480 (46.04%), Query Frame = 1
Query:  301 STPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFEN--LNSMFNSA--------VSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNL 1707
            S  KSL ++ L I  L   +I+ L  K+ E    N + D   +  L ++Q KW     +  ++  K++ +  IA   +Q+ +I+  P+I  D  +  + ++L D +  N  L    LD +S L L  +FL ++  LVM+ L S  +  LP +I F++ +    + +E+I ++R  ++ ++  L S   ++         +S+      +  SC + L + +K  +++   + +AW+K+I   +       FD ++L II++        I  ++++KI      +Q +++ F  H+ +LK +    L++  S++ S    ++ F    Y  AF   +  +   ++   L+  I +  ++ ++  L+VL  L     + + +    + G+L      +  QI  ++ +   +AF   +E          I++ + L+++KQL +  F  K  G IGAVT+   +      + S      NL
Sbjct:  130 SYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQLKWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTSLTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTISEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQSTFSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDT-YCQQEVVGALVTHICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLAFSKQNEASS------HIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERANL 602          

HSP 2 Score: 72.4034 bits (176), Expect = 3.191e-11
Identity = 126/514 (24.51%), Postives = 207/514 (40.27%), Query Frame = 1
Query: 2698 RCKLLEENLRFCFRELDLSVFTMLSS--LTKS--DLVLFDHNSEL--LGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPP---------NANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEF--------CLSDEILENVDDPCFLVFEFVL-----KILSKIFHYL----------KNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQ----ILSIREKIPSINIAAAYCEFVSELL---TITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSD-----KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +  LL  N    FRELD+ VF++L    +TK   D  +    +E+  LG  EL + L DL  K+E          +   PP         N     + F ++ Q     I+  +      F+L+               CL+ E    VD P   V E+ +     + L +IFH L            NL  S   ++   L         + LL Q    + +  + IPS   A      +  +L   T ++ N+ +++   L  +FL   W S +      S  +L  +  + L       K  E I    +PE+      N   + S   +  L + T +  F+++   + K  K +     + SQ+   E L  W    + V+ F+I+I   K  +S+ +L   +K+ R F++  +K  MP+LD   R     V+ LL   Q  TR +  LC H K   +      VP +++ LE  + RVK ML +N C  ++  +  L N+D+ G  I
Sbjct:  913 KTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQLGPPELLFLLEDLSQKLE----------SMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCV------FQLLTPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQPENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMVILEKSTASAQNKEKIA--SLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAIEEIAGVGVPEL-----INSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQIHEEKLLYWN---MAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKHREDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNCR-EAFWLGNLKNRDLQGEEI 1399          
BLAST of fancd2-like protein vs. TrEMBL
Match: D2DJT9 (Fancd2-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1584.7 bits (4102), Expect = 0.000e+0
Identity = 877/899 (97.55%), Postives = 884/899 (98.33%), Query Frame = 1
Query:  217 MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNXXXXXXXXXXXXXXXSHLLINVTEIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQESDESEELFETDKIENATTSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELPNGF 2913
            MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVR+ESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNSQKIVSKILKLLLSYSETVPELIIVVFDELYRLISTGEITEINVEKIIEKIISDSFLYNFTSEIDEIDEIDKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNVGYGVVGVGGGGGGGSHLLINVTEIII K    ++   KKKK  K  + + +NNNNKTTTVGNSIQESDESEELFETDKIENA TSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLW+KVEHCFRDRNELPNGF
Sbjct:    1 MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRSESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNSQKIVSKILKLLLSYSETVPELIIVVFDELYRLISTGEITEINVEKIIEKIISDSFLYNFTSEIDEIDEIDKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNVGYGVVGVGGGGGGGSHLLINVTEIII-KKVSVKRKTVKKKKKSKKSKQNHDNNNNKTTTVGNSIQESDESEELFETDKIENA-TSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLWMKVEHCFRDRNELPNGF 897          
BLAST of fancd2-like protein vs. TrEMBL
Match: A0A210PF67 (Fanconi anemia group D2 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10936 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.097e-33
Identity = 129/505 (25.54%), Postives = 248/505 (49.11%), Query Frame = 1
Query:  208 FQEMIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMI------PKLNDFLIEMLVNKI-CECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRN--------ESSCGVKL--INSLKINLQFNPYLRKAWLKSISTKSDSVRSPS----FDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLC 1659
            FQE I   + +R +++  L P  +  D     +    C I LM+      PKL + L+E L   +  E S+ +  E   +  L ++QF+W     N  E+ +K+L++  I +  +Q  +I+  P++ +D  +  +A+ L + +  NN L    LD +S L L    L E+   V+  L S  M  LP +I FL+++ +  +  E++++IR N++F   NS F   +SSTP              ES+ G +L  ++++K  ++F   + +AW+K I    D V+ P      D  ILLI+ +  + +   + ++ ++KI    FT+  ++  F  H  +++  +   L++  +++ S +  ++ FA   Y  AF   +  F   +I   L+  I    +  I++ L++L  L +   +K+  F   + G+L      + +QI  +YS+  ++AF++  E          I++ + +L++KQL + +   KR G IGA+ ++K + 
Sbjct:   97 FQEFIE--DQSRFHYS--LLPTNTTSDCDSARSGGQDCAIRLMLGVDLLQPKLMNTLLEKLAEFMEDEDSIFDHGEKVNIPRLLMSQFRWLDSIINGKEVTNKMLEMIGIVSLDIQREIITCLPEVVEDSEHGEVAKALREILVQNNQLTVPILDALSNLTLSPELLSEVRGSVLQTLASVKMEDLPVVIKFLLQSVNNQDAPEVVEEIRSNLDF---NSSFAPTISSTPFSTQAGKRGSKSEIESARGSELLTLDAIKSGIRFQKCVAEAWIKVI----DGVKQPGDHKVIDIFILLILHSTNRKK--PVESLFRNKIRAGGFTEVLVQAAFGAHSQVMRDYFPSILSLAEALLRSPEPAVVYFACAMYRGAFTAFDS-FCQQEIVGNLVTHIGIGFEGEIDSSLDILAELVDTHLSKMAPFAIFVKGVLDYLDNLSVMQIRKLYSMLSMLAFRNPQEGG-------LIQDDLHILIRKQLSSNSPKYKRMGVIGAIMIIKSIA 580          

HSP 2 Score: 90.5077 bits (223), Expect = 3.050e-14
Identity = 74/289 (25.61%), Postives = 137/289 (47.40%), Query Frame = 1
Query: 3256 IPSINIAAAYCEFVSELLTITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSS--------VLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVIRNI------DDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKV--SYSQRNTLEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +P++  A    + +  L    + ++ +V ++ ++ +FL  +W+ T+    K +        VLR +   L    D          L  ++TI  + I      D+N S  +Y  L K +    ++++   ++   K +S V  S S+   L+ L  W + V I+ +   +I       ++ + +K  R+F+   ++  MP+LDNM R     V  LL  +Q  TR +  +C H K   NL+  + VP +++ LE F++RVK ML +NKC  ++  +  L N+D+ G  I
Sbjct: 1120 VPNLTTAVTVLKVLITLGDKVNTDDLQVKIVAMSEEFLKREWLGTDGEKEKGAKHNENLQFVLRTY---LGCSEDS---------LSSVETIATKGITELLETDNNGSSDLYPTLTKHSFPVFYRIMFYELIGCLKTISPVKQSDSREVKLDCLLRWNQAVRILHIMVNLIKAFDGRVLLGTALKCGRQFLDIFLRQGMPLLDNMFRSHRDDVQSLLKNLQLSTRALHHMCGHSKIMKNLALTNQVPFLKKSLEAFVYRVKVMLTVNKCL-EAFWLGNLKNRDLKGEEI 1395          
BLAST of fancd2-like protein vs. TrEMBL
Match: A0A2B4RGL0 (Fanconi anemia group D2 protein OS=Stylophora pistillata OX=50429 GN=FANCD2 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.283e-29
Identity = 176/777 (22.65%), Postives = 346/777 (44.53%), Query Frame = 1
Query:  196 NYAKFQEMIR-GIETNRI------NFTQFLQPVKSNYDLYLFST-PKSLCQICLMIPKLNDFLIEMLVN-KICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVK-----LINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXX-XXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYCE---IAV------IVSQSNSSS--NLIGKTAK-IHLPAHFRLLALL-ELRNKKSLCEINALFGCPV-----RFVGGFDSVEAVELQTV-------INWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKP 2406
            + A FQ+ +R G++T+        NF + LQ    + D +L S  P SL +         + LI ML+   I +  + +      + +  L +F  +  N    E+ +K+L++  I +  +Q  +I+  P++  D  +  +A +L + +  N  L    LD +S LNL +  L E+   V+ +L SA +  LP ++ F++++   N+  E+I ++R N++F   ++    +  STP    R              + ++   ++F   + + W+K+I + +  V+    D  +LLI+ +        + ++I++KI    FT++ +   F  H  IL+  +   L++   ++ S    +  +A   Y  +F++ +  +   ++   L+  I +   +  +A L+VL  L E+  + +  F   I GLL         QI  ++S+   +AF +  E          I++ + ++++KQL + +   KR G IGA+ ++  +            A    +N       D++ + ++ ++N        +L+++ + +   PE   + +DEL R+I  G        KI +  IS++ + +F  +     E   +   +   +   LD  E   IAV      + S+  ++S   L    A  I L  HFRLL +  E ++K  L  I+AL GCP+       +    S++  + + +       +NW  EVVNAF+S  +        R K + R++ I    + L+  L  +   KP
Sbjct:    6 DRALFQKKVRNGLKTHESYPEVVDNFLEGLQTRLDDADRFLLSLLPVSLAEDVDGHVGGQEGLIRMLLGIDILQPKIAS------MLLEKLPEFTEDDCNPR-RELAEKMLEIVGITSVEIQREIITCIPEVLDDAEHTEVARELSELLCQNTGLTVPILDALSNLNLHSDLLAEVRASVIQILPSAEISDLPVVVKFILQSVSDNDAFEVISELRANLDF--TSTTLQPSACSTPAEQQRPSRGGSTSDGELFTLEAICSGIRFQKSVAEGWIKAIESVNSPVKHKVVDLFVLLILHSTAN-RKKAMESLIRNKIKNGHFTEEMLSAAFSSHSQILREYFPDLLSLAEILLRSPDPSVCSYACSTYKLSFVSFDL-YCQQEVVGTLVTHIGSGFAAEADASLDVLSDLVESHADIMAPFAIFIKGLLDYLDNLTITQIRKLFSMLSTLAFANQQEGG-------LIQDDMHIVIRKQLSSNSAKYKRIGIIGAIMVVHSM------------AKKRSVNEGSEETMDSQSQPRTTLSNDVYKQICSMLEMIRNSTNQTPEAAALFYDELARIIQLG----GIDPKIEQAWISETVVADFQDDFLVDREQPTESVGVPMELSYALDEAEEGSIAVNILPLLLASRKGATSKEKLDSVPASLICLAPHFRLLRVCEESQHKGDLEGIDALLGCPLVSFKEEMIKEISSLDQADREVICGTLFHTVNWFREVVNAFASQES-----PELRGKSIARLQGITTLCAVLEKCLAATPTFKP 743          

HSP 2 Score: 111.309 bits (277), Expect = 1.322e-20
Identity = 77/259 (29.73%), Postives = 131/259 (50.58%), Query Frame = 1
Query: 3325 NESEVSMLDLTAKFLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTLEML-ESWEKIVVIVKLFTIVITNNK---ESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            N   +S+ +LT  FL  +W+  +        Y  ++  L   HL    D    V +  +     T +I + D N +   Y  L ++++   ++ + + ++   K    V   + ++ E   E   K+ + V+LF I+I   K   + +MI + +KF R F+   +K  MP+LD+MLR     +  +L  +Q  TR +Q +C H K   +LS  + VP V++ LETF+FRVK ML +NKC  ++  +  L N+DIHG+ I
Sbjct: 1061 NGMSISLAELTGNFLKREWLRPDGERESGAKYNEALQFLLRFHLSCAEDTL--VTIEEVAGGAVTELIESEDKNAASTTYQTLTRSSLPCYYRAMMEELIGHLKQTHSVPLKKTDSPESHNERLVKLNISVRLFHILINLVKAFDQRSMIGASLKFGRLFVDTFLKLGMPVLDSMLRTHKDDINGMLKNLQQSTRSLQHICGHSKVTKDLSLTNHVPAVKKCLETFVFRVKAMLTLNKCH-EAFWVGTLKNRDIHGQEI 1316          
BLAST of fancd2-like protein vs. TrEMBL
Match: A0A1S3I8N1 (Fanconi anemia group D2 protein OS=Lingula unguis OX=7574 GN=LOC106162055 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.809e-29
Identity = 107/449 (23.83%), Postives = 224/449 (49.89%), Query Frame = 1
Query:  358 LIEMLVNKICEC-----SLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEF-----ENLNSMFNSAVSSTPLMHVRNESSCGVKL--INSLKINLQFNPYLRKAWLKSISTKSDSVRSPS----FDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYL 1656
            +++ML+ K+ E      S+    E  ++  L +NQF+W     N  E+ DK++++  I++  VQ  +I+  P++  D  +  +A +L D ++ NN LI   LD +S L+L      E++  V+  L S  +  LP ++ FL++     + ++++ ++R N++F        +S  +   ++T    V   +  GV+   ++++K  ++F   + +AW+K++    +SV++P      D ++LL++ +        + +++++KI    FT+  +   F  H  +L+  +   L++   ++ S +  +  F    Y +AF+  +  +   +I   L+  I +     I+  L+VL  L EN   K+  F   + G+L         QI  +Y++  ++AF++       F D   I++ + +L++KQL N +   K+ G IGA+ ++K L
Sbjct:  139 VMKMLLEKLPEFTEDQESIFEQGEKVDMPKLIMNQFRWLDRIVNSKELTDKMMEIVSISSMDVQREVITCIPEVVDDTEHGEVALQLKDLLTDNNQLIVPILDALSNLSLKPELASEVKESVLQSLPSIELDDLPVVVKFLLQTVTSQDALDVVSELRNNLDFNSSFPPTSSSTPHGKRAATGRASVAPRAPRGVEALTLDAIKSAVRFQKNVAEAWIKAV----ESVKTPGEHKVIDILVLLVLHSASANRKKPVESLLRNKIRAGHFTELLLRATFGSHGQVLRDYFSSILSLAEVLLRSPEPAVASFGCAIYRHAFVTFDT-YCQQEIVGNLVTHIGSGFPGEIDCSLDVLAELVENNLEKMVPFAIFVKGVLDYLDNLTMTQIRKLYAMLSVLAFRN-------FRDGGLIQDDMHILIRKQLSNNSTKYKKMGVIGAMMVVKCL 575          

HSP 2 Score: 92.4337 bits (228), Expect = 6.609e-15
Identity = 110/485 (22.68%), Postives = 202/485 (41.65%), Query Frame = 1
Query: 2719 NLRFCFRELDLSVFTMLSS--LTKS----DLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEF--CLSDEILENVDDPCFL---------VFEFVLKILSKIFHY------LKNNLTDSGDEMIKRLLDGLSPVNYS-KSLLKQILSIREK----IPSINIAAAYCEFVSELLTITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVIRNI---DDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
              R  FRELDL VF++LS+  +TKS     L   D  +  L   +L + L DL  K+ H           F     +KN   F ++D     ++ + ++ +       +  +  F   L+      +D P  +          F+ +L++L   F +          L   G  ++   + G +  N + + LLKQ     E     +P++  A    + +  +       +   ++  +  +FL  +W+  +    K +        L+ +     E ++SAI   + T  I  +   D N     Y  L + +    ++++   ++   + +   K S S +  ++ L  W   V    +   +I        + S  K+ R F++  ++  MP+LD+M RH    V  LL  +Q  TR I  +C H K   ++S  + VP ++R LE F++RVK ML +NKC  ++  +  L N+D+ G  I
Sbjct:  954 QFRHFFRELDLEVFSILSTGMITKSALDSQLNTSDETTLQLQPPQLAFLLEDLTRKLSHSLIASASKRRMFLKVKGSKNAG-FSHLDHHSASSVAKKVVLLLPALCDHLGAASGFFEALTSANDGVIDGPGSMSEEAILMGTCFQHLLQVLLTFFSWNGFVMAEHKPLLKEGLVVLASRMKGAAAKNMTFQELLKQNFQYLENFSGFVPNLMTAVTLVKLLVVMAEKGDSGQYGAAIAGMAQEFLKREWLGEDGQKPKGAKHNEMLQGLIQMYLSNSEDVLSAI-EHLSTTAIPELVQSDKNAQSDTYPTLTRNSFGVYYRVILSELVVVVRGIPAGKPSDSTQVKVDKLIRWNLAVRTFHILVNLIKVFDARGNLTSIFKYGRLFVEVFLRQGMPLLDHMFRHHKDDVQSLLKNLQLSTRAIHHMCGHSKIVKDISLTNQVPPMKRCLELFVYRVKAMLTVNKCL-EAFWMGNLKNRDLQGEEI 1435          
BLAST of fancd2-like protein vs. TrEMBL
Match: W4XD22 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 3.625e-29
Identity = 121/529 (22.87%), Postives = 244/529 (46.12%), Query Frame = 1
Query:  211 QEMIRGIETNRINFTQFLQPVKSNYDLYLFSTPK-----------SLCQICLMIPKLNDFLIEMLVNKICEC-----SLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVK-----------LINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLI---IFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNL 1707
            +E I G++ N I       PV+  Y L L ++             SL ++ L I +L   L+  L+ K+ E      S+ +  E  +L  L LNQF W     N  E+ DK+L++  I++  VQ  +I+  P++  D+ +  +A +L + +  N+ L    +D +  LNL    L+E+    +  L SA +  LP +I F++++   ++ +E+I ++R N++F   ++    + +STP  + R  ++  V            ++ ++K  ++FN  L   W K+I + SD+      D  +LLI   + N  K     +  + + K+ K  FT++ ++  F  H  +++      L I   ++ S +  +  F  + Y  AF   +  +   ++   L+  I +   + +++ L++L  LA +    +  F   I G+L         Q+  ++S+   +A++  S      G   Q   H++  V+K L + +   KR G + A+ +++ +    +++ S   A+ +L
Sbjct:  120 EEFISGLQ-NHIE-----DPVRFKYSLLLTTSSAECESARGGNQDSLIRLILGIDELQPALVNTLLEKLPEFMGEEDSMFDYSEAVDLPKLILNQFHWMDNVINSKEMTDKMLEMVEISSPSVQREIIACIPEVVSDQEHSEVANRLKNMLECNSQLTVPIIDALDNLNLTPELLREVRGSALESLVSADLDDLPVVIKFILQSVSSSDALEVISELRRNLDF---HTSLPPSSASTP--YARASTTGNVSTHKKTTDSEMLILETIKSTMRFNKVLADGWQKAIESVSDAAGHKVLDIFVLLISHAVANRKK----PVEAVFRHKVRKGHFTEELLQATFTSHAKVIRDYLGSLLCIAEKLLRSPEPQVSQFGSKVYQTAFAAFDV-YSKQEVVGALVTHIGSGLSAEMDSALDILSSLALSHTKDLAPFAVFIKGVLDYLDNLTMTQVKKLFSVLATLAYRGGSS-----GSTLQDELHIV--VRKNLTSNSPKYKRMGVVAALMVIQNMARKRMDSGSGKQALASL 625          
BLAST of fancd2-like protein vs. Ensembl Cavefish
Match: fancd2 (FA complementation group D2 [Source:ZFIN;Acc:ZDB-GENE-040116-5])

HSP 1 Score: 94.3597 bits (233), Expect = 6.391e-19
Identity = 150/703 (21.34%), Postives = 292/703 (41.54%), Query Frame = 1
Query:  439 LNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFEN--LNSMFNSAVSSTPLMHVRNESSCGVK-----LINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNE-YKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSD-------------SFLYNFTSXXXXXXXXXKKDRHLLFGVGVGL---------DYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALL-ELRNKKSLCEINALFGCPVRF--VGGFDSVEAVE----------LQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLP 2418
            +NQ KW     +  ++  KL+ +  +A   +Q+ +I+  P+I +D  +  +A  L+  +  +  L    LD +S LNL ++ L E+   V++ + +  +  LP ++ F++ +   ++  E++  +R  +E E   L+SM  ++  S     V    SC  K     ++  +K  ++F   + +AWLK+I   S+       D ++LLI+ +            ++K K+      +  +   FK    +++  +   L +   ++ S    ++ F    Y  AF   +  +   ++   L+  + +     ++  LE+L  L      ++  +   + G+L      +  QI  ++ +   +AF       D  G   Q   H++  ++KQL +     KR G IGAV ++            ++    N  +S GG L      Q + + +          L+ S SE   E   + +DEL  L+ T ++  +    I + ++ D             +  Y F + +    + D+       G+ + L            E  +  SQ NS        + + L + FRLL L  E +++  L EI+AL GCP+    +G  + VE++           L   INW  EVVNAF    +        ++K+V R+    + ++ LQ++L   +   P   P
Sbjct:  117 INQLKWLDRVVDCKDLASKLMQLVSVAPVEIQHDIITSLPEILEDSQHGDMARDLNALLKESTQLTVPILDALSSLNLSSTLLAEVRGAVISTVSAVQLEDLPVVVKFILHSISASDANEVVCDLRKKLELEQCVLSSMLQASQRSEKSASV---PSCSSKDSVALVLEVIKSAVRFQKIISEAWLKAIENVSEPEDHKVIDVLVLLILHSTNANQSRRGAERVLKVKVRAGLIQETLLNKTFKGFAQVMRGYFPSILALAQGLVRSSDCCVVPFGGHMYKQAFTAFD-SYCQQEVVGSLVTHVCSGVSGEVDVALELLCELVSLKPTEMAQYAVFVKGILDYMDNLSPQQIRRLFHLLSSLAF-----GHDQHGSHIQDDMHIV--IRKQLSSTVPKYKRIGIIGAVMMV-----------GSMGVRRNKADSQGGTLPKETHRQVTALLD----------LVRSCSEGSAEAAALYYDELANLLQTCKLDPLVQAWIGKSVLEDFQEDFVVDLGPEIAGSYPFPASVMYNLDEDESQG----GIAINLLPLMAQDVPHSAEGRIAPSQKNSR-----HVSPLCLSSFFRLLRLCEEEQHQGDLEEIDALLGCPLILTDMGAVEKVESLSKAEREFLCSLLFYTINWFREVVNAFCKQKD-----PEMKMKVVTRL----QNITYLQTLLETCLADCPGYTP 769          

HSP 2 Score: 73.1738 bits (178), Expect = 2.042e-12
Identity = 79/305 (25.90%), Postives = 143/305 (46.89%), Query Frame = 1
Query: 3217 KSLLKQ----ILSIREKIPSINIAAAYCEFVSELLTITS-VNESEVSML-----DLTAKFLGTKWISTNMTIYKS----SVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTL--EMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            + L+KQ    +L+ R  +PS+N   A C  +++LLT+ S    S  +        LT  FL  +W+  +    +       LR   I  L  +D   +  V  I  E  T ++    D  S   +  L++ T L  +K++ + + K  + L     +    +  E L +W    + V+ F ++I   K  +S  +L+  +K+ R F++  +K  MP+LD   +     V  LL  +Q  TR +  +C+H K + +    + VP +++ LE F++RVK ML  N+C  ++  +  L N+++ G  I
Sbjct: 1026 EQLIKQSFEYLLNFRSTVPSLN--TALC--LTQLLTVISQFGGSHHTFFREHTASLTRHFLCQEWVDPSGVKERGKKHNDALRSLLIIYLAHTDDVLKA-VEEITGEGITELLNAAKDASSRS-WPTLNRQTFLVYYKVMMEELEKNVRKLPPGRQTDSREIQNEKLLTWN---LAVRDFHVLINLVKVFDSRPVLNVCLKYGRLFLESFLKLGMPLLDYSFKKHKEDVQNLLKTLQLSTRQLHHICSHSKNRQDTGLTNHVPALKKSLEQFVYRVKAMLTFNQCQ-EAFWLGNLKNRNLKGEEI 1320          
BLAST of fancd2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007168.1 (pep scaffold:Pmarinus_7.0:GL476993:42332:95020:1 gene:ENSPMAG00000006452.1 transcript:ENSPMAT00000007168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 9.743e-30
Identity = 120/521 (23.03%), Postives = 241/521 (46.26%), Query Frame = 1
Query:  202 AKFQEMIRGIETNRINFTQFLQPVKS--NYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKW--NVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFE--------NLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPS----FDFIILLII-FNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFS-------ILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTV 1689
            +  QE + G E     F   L P +S  + D    ++ +SL ++ L +  L   L+  L+ K+ E     + ED   +  L ++ FKW   +Y+     + D++L++  +A   VQ  +I+  P+I +D  + R+A++L   M  N  L    LD +S +NL +  L E+   VM  L S  +  LP ++ F++ +    +  E+I ++R  ++F+        ++      A + TP     ++  C   +++++   ++F     +AW+K+I    +SVRS S     DF++LLI+  N +K     + +++++K+   +   + ++ VF  H         ++ P+ + ++ I N+++ S + L +     A+++    P     + ++   L+  +     + ++  L+VL  L +     +  +   I G+L      +  QI  ++ I   +AF   ++   I GD      H++  V+KQL +     KR G IGA+ L+  +   D   D  V
Sbjct:   59 SSLQEYVEGREA----FKTCLLPCRSCQDSDASTKASRESLIKLLLGVNILQTPLMNALLEKLPEFMEDGNSEDGVNIPRLTISHFKWLDRIYDST--SLTDRILELLTVAPLDVQRDIITCLPEIIEDDQHTRVAKELSALMQQNTQLTVVVLDVLSNINLSSDLLAEVRGSVMLALASVELDDLPVVVKFILHSITATDAYEVIAELRTKLDFQLCLPPASLSVTQGGRRAATGTPSQVAPDKRDCKALVLDAIASAVRFQKTTAEAWIKAI----ESVRSESEHKVIDFLVLLILHINHHK----AVESLVQAKVRAGRLGDKLLQAVFSGHTPPADTFDLVVYPLMQ-YINIGNTVVCSFR-LCMFLTTLAHFSLLCLP-----VQEVVGSLVTFVCNGYTAEVDTALQVLHELVQQRTASLASYAVFIKGILDYLENLSLTQIRKLFFILSTLAFSGGTQGSYIQGD-----MHIV--VRKQLSSTVLKYKRIGIIGAIALVGSMATRDDQIDGGV 551          

HSP 2 Score: 75.8702 bits (185), Expect = 5.943e-14
Identity = 38/107 (35.51%), Postives = 65/107 (60.75%), Query Frame = 1
Query: 3757 IKFSREFIKFIIKNLMPILDNMLRHENAQVIK-LLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +K+ R F++  +K  MP+LD   +    ++   LL  +Q  TR +  +C H K  +N++  + VPQ++R LE+F++RVK ML +NKC  ++  I  L N+++HG  I
Sbjct: 1253 LKYGRLFVEAFLKKGMPLLDCTFKKYKDEIYSHLLKNLQLSTRQLHHMCGHSKVNHNVNLMNCVPQLKRTLESFVYRVKAMLTVNKCH-EAFWIGNLKNRNLHGEEI 1358          
BLAST of fancd2-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007173.1 (pep scaffold:Pmarinus_7.0:GL476993:42347:94670:1 gene:ENSPMAG00000006452.1 transcript:ENSPMAT00000007173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 1.292e-29
Identity = 119/506 (23.52%), Postives = 233/506 (46.05%), Query Frame = 1
Query:  202 AKFQEMIRGIETNRINFTQFLQPVKS--NYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDN-ELAILCLNQFKW--NVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFE--------NLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPS----FDFIILLII-FNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPI------YRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLM 1647
            +  QE + G E     F   L P +S  + D    ++ +SL ++ L +  L   L+  L+ K+ E     + ED   +  L ++ FKW   +Y+     + D++L++  +A   VQ  +I+  P+I +D  + R+A++L   M  N  L    LD +S +NL +  L E+   VM  L S  +  LP ++ F++ +    +  E+I ++R  ++F+        ++      A + TP     ++  C   +++++   ++F     +AW+K+I    +SVRS S     DF++LLI+  N +K     + +++++K+   +   + ++ VF  H  I+  +          L+ +N    +  G LL  A  A+++    P     + ++   L+  +     + ++  L+VL  L +     +  +   I G+L      +  QI  ++ I   +AF   ++   I GD      H++  V+KQL +     KR G IGA+ L+
Sbjct:   54 SSLQEYVEGREA----FKTCLLPCRSCQDSDASTKASRESLIKLLLGVNILQTPLMNALLEKLPEFMEDGNSEDGVNIPRLTISHFKWLDRIYDST--SLTDRILELLTVAPLDVQRDIITCLPEIIEDDQHTRVAKELSALMQQNTQLTVVVLDVLSNINLSSDLLAEVRGSVMLALASVELDDLPVVVKFILHSITATDAYEVIAELRTKLDFQLCLPPASLSVTQGGRRAATGTPSQVAPDKRDCKALVLDAIASAVRFQKTTAEAWIKAI----ESVRSESEHKVIDFLVLLILHINHHK----AVESLVQAKVRAGRLGDKLLQAVFSGHTPIVLDVCVSTYLATCCLSHLNMASTTRFGPLLSRAPLAHFSLLCLP-----VQEVVGSLVTFVCNGYTAEVDTALQVLHELVQQRTASLASYAVFIKGILDYLENLSLTQIRKLFFILSTLAFSGGTQGSYIQGD-----MHIV--VRKQLSSTVLKYKRIGIIGAIALV 533          

HSP 2 Score: 81.2629 bits (199), Expect = 1.315e-15
Identity = 39/106 (36.79%), Postives = 65/106 (61.32%), Query Frame = 1
Query: 3757 IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            +K+ R F++  +K  MP+LD   +    +V  LL  +Q  TR +  +C H K  +N++  + VPQ++R LE+F++RVK ML +NKC  ++  I  L N+++HG  I
Sbjct: 1244 LKYGRLFVEAFLKKGMPLLDCTFKKYKEEVFGLLKNLQLSTRQLHHMCGHSKVNHNVNLMNCVPQLKRTLESFVYRVKAMLTVNKCH-EAFWIGNLKNRNLHGEEI 1348          
BLAST of fancd2-like protein vs. Ensembl Medaka
Match: fancd2 (Fanconi anemia group D2 protein [Source:NCBI gene;Acc:101172571])

HSP 1 Score: 88.5817 bits (218), Expect = 3.974e-17
Identity = 125/526 (23.76%), Postives = 234/526 (44.49%), Query Frame = 1
Query: 2635 ESDESE-ELFETDKIENATTSVRCKLLEENLRFCFRELDLSVFTMLSS------LTKSDLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIISM-----------QDLFKLIISKSIEFCLSDEILENVDDPCFLV--FEFVLKILSKIFHY-------LKNNLTDSGDEMIKRLLDG---LSPVNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSMLDLTAK----FLGTKWISTNMTI-----YKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            E+DE++ E  E +K ++    V   +     R  FRELDL V ++L S      L  S+L        LLG  EL + L DL  K+E            F    A+++ + F ++ Q     I    + +            + F+ ++SK+ + C+ D    ++ +   +   ++ +L++L+ +F +        +N L  +   + +RL +G   L+   + K   + +L+ R  +PS+N A    + +S   T+     +  +  D TA     FL   W++ +        +  ++  L  I+L  + D  K  E I    + E+      N+  +ES   +  L++ T L  +K++   + K  + +   K S       E L +W    + V+ F I++   K  +S  +L+  +K+ R F++  +K  MP+LD   +     V  LL   Q  TR +  +C H K + + S  + VP +++ LE F++RVK ML +N C  ++  +  L N+++ G  I
Sbjct:  926 EADETQQEHPEKEKDKDVWPGVSLSVF----RPFFRELDLEVLSVLQSGLLSRSLLDSELHTKVREEVLLGPAELVFLLEDLLHKLEFRLTAAPTKRAPFLKTRADRS-VGFSHLQQRSTKDIASYCVQLLPALCTHLENCHNHFQALLSKN-DGCV-DAAAADLQEHRLMSASYQLLLQVLNTVFSWSGFSQPGHRNLLKKALGVLAERLKEGDADLTLEQFVKHSFEYLLNFRSTMPSLNTALCLSQLLS---TVAERGGNAAAHRDQTASLARHFLSQVWVTASGERERGNKFNEALHALLTIYLEQVDDILKVVEEIAGEGISEL-----LNVSKDESSASWPTLNRQTFLVFYKVLLAELEKAVRKIPAGKSSDDSEAQSEKLLTWN---LAVRDFHILVNLVKVFDSRSVLNVCLKYGRLFLESFLKLGMPLLDYSFKRHKEDVQSLLKTFQLSTRQLHHMCGHSKIRQDTSLTNHVPALKKSLELFLYRVKAMLALNNCQ-EAFWMGNLKNRNLKGEEI 1432          

HSP 2 Score: 85.5001 bits (210), Expect = 3.344e-16
Identity = 111/526 (21.10%), Postives = 221/526 (42.02%), Query Frame = 1
Query:  202 AKFQEMIRGIETNRINFTQF----LQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSL-TNDDEDNELAILCLNQFKWNVYNKNMNEIVD------KLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVK-------------LINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNE-YKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITN 1704
            A  QE I G+E +  N        L  V    D ++ S  +SL ++ L +  L   +I +L+ K+ E  L +  D       + +NQ KW      ++ I+D      KL+++  +A   VQ  +I+  P+I  D  +  +  +L+  +     L    LD +S LNL +S L E+   VM  + +  +  LP ++ F++ +   ++  E++  +R N+E E          S T L   R   S                 +++ +K  ++F   + +AWLK+I +  +       D ++L I+ +            ++K K+      +  ++  F+ +  +L+  +   L +  S++ S    L+ F    Y  +F   +  +   ++   L+  + +     ++  LE+L  L     +++ L+   + G+L       S QI  ++ +   +AF    +      D+  I      +++KQL +     KR G IGAV ++  +      TDS   +++ 
Sbjct:   88 AIIQEFITGMEAHIENPDTLRVCLLPCVPQTSDGHISSFQESLLRMLLGVEMLQTLIINILLEKVPEFMLDSTGDGGLSFPRMIINQLKW------LDRILDAKGLSLKLMELVSVAPVEVQRDVITSLPEILDDSQHNDVGRELNCLLLERTQLTVPILDALSSLNLSSSLLTEVRTAVMATMAAVQLEDLPVVVKFILHSVSSSDAYEVVCSLRKNLELEQCVLPAALQASQTLLKTKRAAVSAPAAAAAASSSQDSISLVLDGIKSAVRFQKTIAEAWLKAIESVEEEEEHKVIDLLMLFILHSTNANQSRRGAERMLKLKVRTGLIQEPLLQRTFRDYVQVLRGYFSSILALAQSLLRSPDPGLVAFGGHMYRCSFTAFD-SYCQQEVVGSLVTHVCSGAGGEVDMALELLCGLVTEKPSEMALYAVFVKGILDYMDNLTSQQIRKLFQLLSRLAFGQQQQQGSHIQDDMHI------VIRKQLSSTVPKYKRIGIIGAVMIIGSMGARSEGTDSQNGSLSQ 600          
BLAST of fancd2-like protein vs. Ensembl Medaka
Match: fancd2 (Fanconi anemia group D2 protein [Source:NCBI gene;Acc:101172571])

HSP 1 Score: 87.8113 bits (216), Expect = 7.884e-17
Identity = 128/529 (24.20%), Postives = 237/529 (44.80%), Query Frame = 1
Query: 2635 ESDESE-ELFETDKIENATTSVRCKLLEENLRFCFRELDLSVFTMLSS------LTKSDLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELPNGFNP---PNANKNGMLFRNIDQVDNLTILENIISM-----------QDLFKLIISKSIEFCLSDEILENVDDPCFLV--FEFVLKILSKIFHY-------LKNNLTDSGDEMIKRLLDG---LSPVNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSMLDLTAK----FLGTKWISTNM-----TIYKSSVLRLFEIHLLLLSD--KWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNL--SKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNK--ESNMILSF-IKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRI 4074
            E+DE++ E  E +K ++    V   +     R  FRELDL V ++L S      L  S+L        LLG  EL + L DL  K+E  FR     P    P     A+++ + F ++ Q     I    + +            + F+ ++SK+ + C+ D    ++ +   +   ++ +L++L+ +F +        +N L  +   + +RL +G   L+   + K   + +L+ R  +PS+N A    + +S   T+     +  +  D TA     FL   W++ +        +  ++  L  I+L  + D  K  E I    + E+      N+  +ES   +  L++ T L  +K++   + K  + +   K S       E L +W    + V+ F I++   K  +S  +L+  +K+ R F++  +K  MP+LD   +     V  LL   Q  TR +  +C H K + + S  + VP +++ LE F++RVK ML +N C  ++  +  L N+++ G  I
Sbjct:  885 EADETQQEHPEKEKDKDVWPGVSLSVF----RPFFRELDLEVLSVLQSGLLSRSLLDSELHTKVREEVLLGPAELVFLLEDLLHKLE--FR-LTAAPTKRAPFLKTRADRS-VGFSHLQQRSTKDIASYCVQLLPALCTHLENCHNHFQALLSKN-DGCV-DAAAADLQEHRLMSASYQLLLQVLNTVFSWSGFSQPGHRNLLKKALGVLAERLKEGDADLTLEQFVKHSFEYLLNFRSTMPSLNTALCLSQLLS---TVAERGGNAAAHRDQTASLARHFLSQVWVTASGERERGNKFNEALHALLTIYLEQVDDILKVVEEIAGEGISEL-----LNVSKDESSASWPTLNRQTFLVFYKVLLAELEKAVRKIPAGKSSDDSEAQSEKLLTWN---LAVRDFHILVNLVKVFDSRSVLNVCLKYGRLFLESFLKLGMPLLDYSFKRHKEDVQSLLKTFQLSTRQLHHMCGHSKIRQDTSLTNHVPALKKSLELFLYRVKAMLALNNCQ-EAFWMGNLKNRNLKGEEI 1391          

HSP 2 Score: 85.1149 bits (209), Expect = 4.500e-16
Identity = 111/526 (21.10%), Postives = 221/526 (42.02%), Query Frame = 1
Query:  202 AKFQEMIRGIETNRINFTQF----LQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSL-TNDDEDNELAILCLNQFKWNVYNKNMNEIVD------KLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVK-------------LINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNE-YKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITN 1704
            A  QE I G+E +  N        L  V    D ++ S  +SL ++ L +  L   +I +L+ K+ E  L +  D       + +NQ KW      ++ I+D      KL+++  +A   VQ  +I+  P+I  D  +  +  +L+  +     L    LD +S LNL +S L E+   VM  + +  +  LP ++ F++ +   ++  E++  +R N+E E          S T L   R   S                 +++ +K  ++F   + +AWLK+I +  +       D ++L I+ +            ++K K+      +  ++  F+ +  +L+  +   L +  S++ S    L+ F    Y  +F   +  +   ++   L+  + +     ++  LE+L  L     +++ L+   + G+L       S QI  ++ +   +AF    +      D+  I      +++KQL +     KR G IGAV ++  +      TDS   +++ 
Sbjct:   88 AIIQEFITGMEAHIENPDTLRVCLLPCVPQTSDGHISSFQESLLRMLLGVEMLQTLIINILLEKVPEFMLDSTGDGGLSFPRMIINQLKW------LDRILDAKGLSLKLMELVSVAPVEVQRDVITSLPEILDDSQHNDVGRELNCLLLERTQLTVPILDALSSLNLSSSLLTEVRTAVMATMAAVQLEDLPVVVKFILHSVSSSDAYEVVCSLRKNLELEQCVLPAALQASQTLLKTKRAAVSAPAAAAAASSSQDSISLVLDGIKSAVRFQKTIAEAWLKAIESVEEEEEHKVIDLLMLFILHSTNANQSRRGAERMLKLKVRTGLIQEPLLQRTFRDYVQVLRGYFSSILALAQSLLRSPDPGLVAFGGHMYRCSFTAFD-SYCQQEVVGSLVTHVCSGAGGEVDMALELLCGLVTEKPSEMALYAVFVKGILDYMDNLTSQQIRKLFQLLSRLAFGQQQQQGSHIQDDMHI------VIRKQLSSTVPKYKRIGIIGAVMIIGSMGARSEGTDSQNGSLSQ 600          
BLAST of fancd2-like protein vs. Planmine SMEST
Match: SMESG000066544.1 (SMESG000066544.1)

HSP 1 Score: 2390.15 bits (6193), Expect = 0.000e+0
Identity = 1302/1327 (98.12%), Postives = 1309/1327 (98.64%), Query Frame = 1
Query:  217 MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNXXXXXXXXXXXXXXXXETVPELIIVVFDELYRLISTGXXXXXXXXXXXXXXXSDSFLYNFTSXXXXXXXXXKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNXXXXXXXXXXXXXXXSHLLINVTEIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQESDESEELFETDKIENATTSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIFHYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSMLDLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTLEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIXXXXXXXXXXXXXXXXXXXCTDVSEELNACSDDVENESLNE 4197
            MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVR+ESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNSQKIVSKILKLLLSYSETVPELIIVVFDELYRLISTGEITEINVEKIIEKIISDSFLYNFTSEIDEIDEIDKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNVGYGVVGVGGGGGGGSHLLINVTEIII K    ++   KKKK  K  + + +NNNNKTTTVGNSIQESDESEELFETDKIENA TSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLW+KVEHCFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIFHYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSML LTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIV RNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNT EMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIEESVQSENEEEDEDNEEEVCTDVSEELNACSDDVENESLNE
Sbjct:    1 MIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLNDFLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLDVGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDTISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELIDKIRINVEFENLNSMFNSAVSSTPLMHVRSESSCGVKLINSLKINLQFNPYLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKITKEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAYYNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKIQLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQIRNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITNLLNSAGGVLNDTEEEQQSQMTNSQKIVSKILKLLLSYSETVPELIIVVFDELYRLISTGEITEINVEKIIEKIISDSFLYNFTSEIDEIDEIDKKDRHLLFGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKKSLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGGIDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNVGYGVVGVGGGGGGGSHLLINVTEIII-KKVSVKRKTVKKKKKSKKSKQNHDNNNNKTTTVGNSIQESDESEELFETDKIENA-TSVRCKLLEENLRFCFRELDLSVFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLWMKVEHCFRDRNELPNGFNPPNANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEFCLSDEILENVDDPCFLVFEFVLKILSKIFHYLKNNLTDSGDEMIKRLLDGLSPVNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSMLGLTAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQTIVTRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRNTSEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLMPILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQVRRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIEESVQSENEEEDEDNEEEVCTDVSEELNACSDDVENESLNE 1325          
The following BLAST results are available for this feature:
BLAST of fancd2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FANCD24.941e-2322.50FA complementation group D2 [Source:HGNC Symbol;Ac... [more]
FANCD24.941e-2322.50FA complementation group D2 [Source:HGNC Symbol;Ac... [more]
FANCD25.553e-2322.50FA complementation group D2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fancd2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fancd24.099e-1132.67gene:FBgn0038827 transcript:FBtr0083995[more]
back to top
BLAST of fancd2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fancd22.692e-2022.74FA complementation group D2 [Source:ZFIN;Acc:ZDB-G... [more]
fancd22.692e-2022.74FA complementation group D2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfk2.562e-3021.30riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010... [more]
rfk2.105e-2821.98riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010... [more]
rfk8.235e-2821.20riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010... [more]
rfk9.123e-2822.17riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010... [more]
rfk7.095e-2722.12riboflavin kinase [Source:Xenbase;Acc:XB-GENE-1010... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fancd21.937e-3022.71Fanconi anemia, complementation group D2 [Source:M... [more]
Fancd22.400e-3022.71Fanconi anemia, complementation group D2 [Source:M... [more]
back to top
BLAST of fancd2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q80V62|FACD2_MOUSE1.355e-2922.71Fanconi anemia group D2 protein homolog OS=Mus mus... [more]
sp|Q6IV68|FACD2_RAT4.269e-2623.21Fanconi anemia group D2 protein homolog OS=Rattus ... [more]
sp|Q9BXW9|FACD2_HUMAN2.373e-2222.50Fanconi anemia group D2 protein OS=Homo sapiens OX... [more]
back to top
BLAST of fancd2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJT90.000e+097.55Fancd2-like protein (Fragment) OS=Schmidtea medite... [more]
A0A210PF676.097e-3325.54Fanconi anemia group D2 protein OS=Mizuhopecten ye... [more]
A0A2B4RGL01.283e-2922.65Fanconi anemia group D2 protein OS=Stylophora pist... [more]
A0A1S3I8N11.809e-2923.83Fanconi anemia group D2 protein OS=Lingula unguis ... [more]
W4XD223.625e-2922.87Uncharacterized protein OS=Strongylocentrotus purp... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fancd26.391e-1921.34FA complementation group D2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007168.19.743e-3023.03pep scaffold:Pmarinus_7.0:GL476993:42332:95020:1 g... [more]
ENSPMAT00000007173.11.292e-2923.52pep scaffold:Pmarinus_7.0:GL476993:42347:94670:1 g... [more]
back to top
BLAST of fancd2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fancd2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fancd2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fancd23.974e-1723.76Fanconi anemia group D2 protein [Source:NCBI gene;... [more]
fancd27.884e-1724.20Fanconi anemia group D2 protein [Source:NCBI gene;... [more]
back to top
BLAST of fancd2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066544.10.000e+098.12SMESG000066544.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034829
GenBankACT98276.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034829 ID=SMED30034829|Name=fancd2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4225bp
TTAATAATTGTTTTTAGTTCGTGTTTTAATGTATAGATAAAAAGTAACTT
TAAAATGAGAAATGATGATTTACAAAGTTTGAATCATATTCTTTCAATAT
GCGGTATTGAATTTGATTTGAATTTTGTCCAAAAACGTCCAACTAATGTG
GTTCTTGAAAATATAATTGATCTTTTAAATAAAGGAATTGTATCGAATTA
TGCGAAATTTCAAGAAATGATTAGAGGCATTGAAACAAATCGAATAAACT
TTACGCAATTTTTACAACCCGTAAAATCAAATTATGATCTATACTTATTT
TCAACACCAAAATCATTATGCCAGATTTGTCTAATGATTCCTAAGTTAAA
TGATTTTCTAATTGAAATGCTAGTTAATAAGATTTGTGAATGTTCTCTGA
CAAATGATGATGAAGATAATGAACTTGCAATTTTATGTCTTAATCAATTT
AAATGGAATGTTTACAATAAAAATATGAATGAAATTGTAGATAAGTTACT
AGATGTGGGATATATTGCTAACAATTTTGTTCAAAATCATTTAATATCAA
TATTTCCTGATATTTGTCAAGATAAATGTAACCCGAGGCTAGCTGAAAAA
CTTCATGATTGGATGTCCAGTAATAATTATCTTATAACTAGTTCTTTAGA
CACTATTAGCAAGCTTAATCTACCTACAAGCTTTTTGAAAGAAATCGAAT
TATTAGTAATGAATATGTTAGATTCAGCCACAATGGGAATGTTGCCAAGT
TTAATTACATTCCTAATAAAAAATACAGATAAAAATAATCTAGTAGAATT
AATAGATAAAATAAGAATAAATGTTGAATTTGAAAATTTAAATAGTATGT
TTAACAGTGCAGTAAGTTCAACGCCATTAATGCATGTTCGGAATGAATCT
AGTTGTGGAGTAAAATTAATAAATTCACTGAAAATTAATCTACAATTTAA
TCCCTATCTTCGAAAAGCATGGCTAAAATCGATTTCGACTAAATCTGATT
CGGTTCGATCACCGAGTTTTGATTTCATTATTTTATTGATCATTTTCAAT
GAATATAAAGTAGAAATGCATGTTATTACAAACATAATTAAATCGAAGAT
AACTAAAGAACAATTTACACAACAAACAATTGAGACTGTTTTCAAATATC
ATTTTAGCATTTTAAAACCAATCTATCGAGGATTTCTAACTATAATAAAT
TCAATAATGATTTCAGATAAAGGCCTTCTATTAGACTTTGCCAAAGAAGC
TTATTATAATGCTTTTATGAATCCAAATAAAGATTTTATTATCGATCAGA
TATTTGAATATTTAATAGCCGATATTTCTACAAAACCGAAATCAAATATT
AATGCAATTTTAGAAGTATTGAAACATCTAGCTGAAAATTGCCGGAATAA
AATCCAATTATTTTACACACAGATTTCTGGACTATTGTCGAATAATTTGG
AATTTAACTCCATTCAAATTTATAACATCTATTCGATTTTTGGAATTATT
GCCTTTAAAGACATTTCAGAAAATGATGATATTTTTGGCGACGAGAAACA
AATTCGAAATCATGTTATTTTATTGGTGAAAAAACAGCTTCAAAATCCGA
ATTTTCTCATCAAAAGAAACGGTGGAATCGGTGCTGTAACATTGATGAAA
TATTTGTGTAATGTCGATGTTAACACAGATTCTACAGTCAATGCAATTAC
GAATCTGTTGAATTCAGCTGGCGGCGTTCTCAACGACACCGAAGAAGAAC
AACAAAGTCAAATGACAAATTCTCAGAAAATTGTGTCGAAAATATTGAAA
TTACTGTTATCGTATTCGGAAACCGTACCGGAATTGATTATTGTCGTTTT
TGATGAATTGTATCGATTAATTTCCACAGGAGAAATAACTGAGATAAATG
TTGAGAAAATAATCGAGAAAATAATTTCCGATTCATTTCTATATAATTTC
ACAAGTGAAATCGATGAAATCGATGAAATCGATAAAAAAGATCGACATTT
GTTGTTTGGTGTTGGTGTCGGTTTGGATTACTGTGAAATTGCTGTCATTG
TTTCACAATCGAATTCATCTTCGAATTTAATAGGAAAAACGGCAAAAATT
CATTTGCCAGCACATTTTCGACTTTTAGCACTTTTGGAGTTGCGAAATAA
AAAAAGTCTGTGTGAAATCAACGCTTTATTCGGTTGTCCGGTTCGGTTTG
TTGGAGGTTTCGATTCCGTTGAAGCCGTTGAATTACAGACAGTTATCAAT
TGGTTAATCGAAGTGGTAAATGCTTTTTCAAGTGATATTAATAATGGCGG
TGGAATCGATAATTTTCGATTGAAAATGGTGCAAAGAATGAAATTGATTG
TCGAACAAGTTTCAAATCTTCAATCGATGTTGTTGTTGAGTGTTCAATCG
AAACCCACGAAATTGCCGATAATTCAAGCTTCAAATGTCGGTTATGGTGT
CGTTGGTGTTGGTGGAGGAGGAGGAGGAGGATCACATTTATTAATAAATG
TTACTGAAATAATAATCAAGAAAGTGTCAGTTAAAAGAAAAACTGTTAAA
AAAAAGAAGAAATCGAAGAAATCGAAACAAAACCATGACAACAACAACAA
CAACAAGACGACAACAGTGGGAAATTCAATCCAGGAATCTGACGAATCTG
AGGAATTGTTTGAAACTGATAAAATCGAAAATGCGACAACAAGTGTTCGA
TGCAAACTTTTGGAAGAAAATCTACGGTTTTGTTTCAGGGAACTCGATTT
ATCGGTTTTTACTATGCTGTCATCTCTGACAAAATCGGATTTGGTTTTAT
TCGATCATAATTCTGAATTGTTGGGATGGAAAGAATTGAAATATTATTTA
TCGGATTTATGGTTGAAGGTGGAACATTGTTTCAGGGATAGAAATGAACT
GCCAAATGGATTTAACCCACCAAATGCCAACAAAAATGGAATGCTATTCA
GAAATATTGATCAAGTAGACAATTTGACCATACTAGAGAATATAATATCC
ATGCAAGATTTATTCAAGTTAATAATTTCCAAAAGTATTGAGTTTTGCCT
TAGTGATGAAATACTTGAAAATGTCGACGATCCATGTTTTCTTGTGTTTG
AATTTGTTTTGAAAATTCTTTCTAAAATATTTCATTATTTAAAGAACAAT
TTGACTGATTCTGGCGATGAAATGATAAAGCGTTTACTTGATGGCTTATC
TCCTGTTAATTATTCTAAATCATTGTTAAAACAAATATTAAGTATTCGTG
AAAAAATTCCTTCTATTAATATAGCAGCAGCATACTGTGAATTTGTTTCC
GAATTACTTACAATTACCAGTGTCAATGAAAGTGAAGTATCTATGTTAGA
TTTGACTGCGAAATTTTTAGGCACTAAATGGATATCAACCAATATGACAA
TTTACAAAAGTTCTGTGCTGAGGCTTTTTGAAATTCACCTTTTACTACTA
TCAGATAAATGGTTTGAGGTGATAGTTAGTGCAATTCTTCCGGAAATGCA
GACTATTGTTATTAGAAATATCGATGATAATGAATCTGAACCGGTTTACG
CTTGTCTTGACAAAACAACTATTCTCGGTGTTTTCAAACTCGTTTCGGAT
TTCATTTTGAAAAAATGCAAAAACCTATCAAAAGTTTCTTATAGTCAAAG
AAATACTTTAGAAATGCTTGAATCCTGGGAAAAAATTGTAGTGATTGTGA
AATTGTTTACTATTGTTATTACTAACAATAAAGAATCTAATATGATATTA
AGCTTCATAAAATTTAGTAGAGAATTCATAAAATTTATCATCAAGAATCT
GATGCCAATATTAGACAACATGTTGAGACATGAAAATGCGCAAGTTATAA
AACTTTTAACAGAGATTCAATTTGTCACACGGTTCATTCAAAGATTATGC
ACACATTGTAAGCAAAAAAATAATTTGTCATCTGCTTCATTGGTTCCTCA
AGTTCGGAGGTATTTGGAAACATTTATGTTTCGCGTTAAAAAAATGTTGT
GCATAAATAAGTGTTCAGGAGATTCAATTAATATATTATTTCTTGCTAAC
AAAGATATACACGGTAGGCGAATAGAAGAATCAGTTCAATCGGAAAATGA
AGAAGAAGATGAAGATAATGAAGAAGAAGTTTGCACGGATGTAAGTGAAG
AATTGAATGCTTGCAGTGATGATGTAGAAAACGAATCTTTAAATGAATAA
ATGTTGTTTAATGAGATCGGAAGAG
back to top

protein sequence of SMED30034829-orf-1

>SMED30034829-orf-1 ID=SMED30034829-orf-1|Name=SMED30034829-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1382bp
MRNDDLQSLNHILSICGIEFDLNFVQKRPTNVVLENIIDLLNKGIVSNYA
KFQEMIRGIETNRINFTQFLQPVKSNYDLYLFSTPKSLCQICLMIPKLND
FLIEMLVNKICECSLTNDDEDNELAILCLNQFKWNVYNKNMNEIVDKLLD
VGYIANNFVQNHLISIFPDICQDKCNPRLAEKLHDWMSSNNYLITSSLDT
ISKLNLPTSFLKEIELLVMNMLDSATMGMLPSLITFLIKNTDKNNLVELI
DKIRINVEFENLNSMFNSAVSSTPLMHVRNESSCGVKLINSLKINLQFNP
YLRKAWLKSISTKSDSVRSPSFDFIILLIIFNEYKVEMHVITNIIKSKIT
KEQFTQQTIETVFKYHFSILKPIYRGFLTIINSIMISDKGLLLDFAKEAY
YNAFMNPNKDFIIDQIFEYLIADISTKPKSNINAILEVLKHLAENCRNKI
QLFYTQISGLLSNNLEFNSIQIYNIYSIFGIIAFKDISENDDIFGDEKQI
RNHVILLVKKQLQNPNFLIKRNGGIGAVTLMKYLCNVDVNTDSTVNAITN
LLNSAGGVLNDTEEEQQSQMTNSQKIVSKILKLLLSYSETVPELIIVVFD
ELYRLISTGEITEINVEKIIEKIISDSFLYNFTSEIDEIDEIDKKDRHLL
FGVGVGLDYCEIAVIVSQSNSSSNLIGKTAKIHLPAHFRLLALLELRNKK
SLCEINALFGCPVRFVGGFDSVEAVELQTVINWLIEVVNAFSSDINNGGG
IDNFRLKMVQRMKLIVEQVSNLQSMLLLSVQSKPTKLPIIQASNVGYGVV
GVGGGGGGGSHLLINVTEIIIKKVSVKRKTVKKKKKSKKSKQNHDNNNNN
KTTTVGNSIQESDESEELFETDKIENATTSVRCKLLEENLRFCFRELDLS
VFTMLSSLTKSDLVLFDHNSELLGWKELKYYLSDLWLKVEHCFRDRNELP
NGFNPPNANKNGMLFRNIDQVDNLTILENIISMQDLFKLIISKSIEFCLS
DEILENVDDPCFLVFEFVLKILSKIFHYLKNNLTDSGDEMIKRLLDGLSP
VNYSKSLLKQILSIREKIPSINIAAAYCEFVSELLTITSVNESEVSMLDL
TAKFLGTKWISTNMTIYKSSVLRLFEIHLLLLSDKWFEVIVSAILPEMQT
IVIRNIDDNESEPVYACLDKTTILGVFKLVSDFILKKCKNLSKVSYSQRN
TLEMLESWEKIVVIVKLFTIVITNNKESNMILSFIKFSREFIKFIIKNLM
PILDNMLRHENAQVIKLLTEIQFVTRFIQRLCTHCKQKNNLSSASLVPQV
RRYLETFMFRVKKMLCINKCSGDSINILFLANKDIHGRRIEESVQSENEE
EDEDNEEEVCTDVSEELNACSDDVENESLNE*
back to top
Aliases
The feature 'fancd2-like protein' has the following synonyms
Synonym
fancd2-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR029448FANCD2
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029448Fanconi anaemia protein FANCD2PFAMPF14631FancD2coord: 83..941
e-value: 2.5E-63
score: 214.1
coord: 1056..1354
e-value: 1.9E-23
score: 82.0
IPR029448Fanconi anaemia protein FANCD2PANTHERPTHR32086FAMILY NOT NAMEDcoord: 52..1357
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 830..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 846..861