Histone-lysine N-methyltransferase SETMAR

Overview
NameHistone-lysine N-methyltransferase SETMAR
Smed IDSMED30034827
Length (bp)5322
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase SETMAR (SMED30034827) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30034827) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase SETMAR (SMED30034827) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30034827) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034827

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30034827SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000081696.1 Contig17718newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000081696.1 Contig17718uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034827SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30034827SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30034827SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034827SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 60.4622 bits (145), Expect = 2.326e-8
Identity = 39/106 (36.79%), Postives = 56/106 (52.83%), Query Frame = 3
Query: 1587 TVQRYLDEIWKVCRQGIWVPHLLSEMNID*RRTICTPFFCRERSDPFLQNIDTSDEKWALYSQNKRNKQWIFQ----IN*PKPSLTLIKMLLCV---CCD**HYSF 1883
            TV R+L +I KV +   WVPH L+E   + R  + +    R  ++PFL  I T DEKW LY   +R+ QW+ Q     + PKP L   K+++ +        HYSF
Sbjct:  303 TVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSF 408          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 60.4622 bits (145), Expect = 2.956e-8
Identity = 39/106 (36.79%), Postives = 56/106 (52.83%), Query Frame = 3
Query: 1587 TVQRYLDEIWKVCRQGIWVPHLLSEMNID*RRTICTPFFCRERSDPFLQNIDTSDEKWALYSQNKRNKQWIFQ----IN*PKPSLTLIKMLLCV---CCD**HYSF 1883
            TV R+L +I KV +   WVPH L+E   + R  + +    R  ++PFL  I T DEKW LY   +R+ QW+ Q     + PKP L   K+++ +        HYSF
Sbjct:  442 TVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSF 547          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 1.419e-7
Identity = 39/106 (36.79%), Postives = 56/106 (52.83%), Query Frame = 3
Query: 1587 TVQRYLDEIWKVCRQGIWVPHLLSEMNID*RRTICTPFFCRERSDPFLQNIDTSDEKWALYSQNKRNKQWIFQ----IN*PKPSLTLIKMLLCV---CCD**HYSF 1883
            TV R+L +I KV +   WVPH L+E   + R  + +    R  ++PFL  I T DEKW LY   +R+ QW+ Q     + PKP L   K+++ +        HYSF
Sbjct:  442 TVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSF 547          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A087T0R5 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_17494 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.561e-22
Identity = 50/75 (66.67%), Postives = 61/75 (81.33%), Query Frame = 3
Query: 2373 KMSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTY-FSTYIEEAAGRDPQLP 2594
            K+S+VGL+  YE+D+NI+LKLKSLA L FVPI DVR +FD L+ +FP EE  NEVLTY F+TYIE AAGR+PQ P
Sbjct:   40 KISNVGLRIPYETDVNIKLKLKSLAALAFVPISDVRVIFDHLSTTFPDEESYNEVLTYFFTTYIEGAAGREPQFP 114          

HSP 2 Score: 35.4242 bits (80), Expect = 1.561e-22
Identity = 14/22 (63.64%), Postives = 19/22 (86.36%), Query Frame = 1
Query: 2593 LRVYNQYKAAAEQSPKTTNYCE 2658
            +R++N Y+AA E+SPKTTN CE
Sbjct:  115 MRLWNHYEAALERSPKTTNCCE 136          

HSP 3 Score: 104.375 bits (259), Expect = 6.052e-19
Identity = 63/118 (53.39%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 2373 KMSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTY-FSTYIEEAAGRDPQLPKSV*SI*SCRRTITENNELLRRSVPK----CIYFHFSLQSPKH 2711
            K+S+VGL+  YE+D+NI+LKLKSLA L FVPI DVR +FD L+ +FP EE  NEVLTY F+TYIE AAGR+PQ P          R        L RS PK    C  FH SL S  H
Sbjct:  410 KISNVGLRIPYETDVNIKLKLKSLAALAFVPISDVRVIFDQLSTTFPDEESYNEVLTYFFTTYIEGAAGREPQFP---------MRLWNHYEAALERS-PKTTNCCEGFHNSLNSLFH 517          

HSP 4 Score: 87.4261 bits (215), Expect = 1.478e-13
Identity = 41/73 (56.16%), Postives = 56/73 (76.71%), Query Frame = 1
Query: 2593 LRVYNQYKAAAEQSPKTTNYCEEAFQNAFISIFHCSHPSIWFLFDEIERNLAYHKLTLTKAQLKQ-EIKKESM 2808
            +R++N Y+AA E+SPKTTN CE  F N+  S+FHCSHPSIWFLFD ++R+LA  +L L+ AQ  + EIKK+ +
Sbjct:  485 MRLWNHYEAALERSPKTTNCCE-GFHNSLNSLFHCSHPSIWFLFDGLQRDLACQRLLLSNAQAGRLEIKKKKI 556          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A0B7BRZ1 (MULE domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204518 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.590e-21
Identity = 52/73 (71.23%), Postives = 60/73 (82.19%), Query Frame = 3
Query: 2376 MSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTY-FSTYIEEAAGRDPQL 2591
            ++SVG+K EYESDI++RLKLKSLA L FVP D+VR VF LLA SFP EE+ N +LTY FSTYIE AAGRDPQ 
Sbjct:   80 VNSVGMKVEYESDIDVRLKLKSLAALAFVPSDEVRPVFALLAESFPDEERYNAILTYFFSTYIEGAAGRDPQF 152          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A0B7BPQ3 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204515 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 3.074e-20
Identity = 45/71 (63.38%), Postives = 57/71 (80.28%), Query Frame = 1
Query: 2593 LRVYNQYKAAAEQSPKTTNYCEEAFQNAFISIFHCSHPSIWFLFDEIERNLAYHKLTLTKAQLKQ-EIKKE 2802
            LRV+N ++A+AE+SPKTTN CE  F N+  SIFHCSHPSIW L D +ER+LA HKLTL KA++ Q E+KK+
Sbjct:    8 LRVWNHHEASAERSPKTTNCCE-GFHNSLNSIFHCSHPSIWLLLDGLERDLACHKLTLEKARVGQPEVKKK 77          

HSP 2 Score: 37.3502 bits (85), Expect = 3.074e-20
Identity = 17/32 (53.12%), Postives = 23/32 (71.88%), Query Frame = 3
Query: 2805 YDLLREQVPTVVHMYEVDEDKLKYLRRMANLK 2900
            Y+ L +QV  VV  Y  ++DKL +LRRMANL+
Sbjct:   79 YEALHQQVAHVVQGYAEEQDKLSFLRRMANLQ 110          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A0B7BS23 (MULE domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204529 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.563e-16
Identity = 45/64 (70.31%), Postives = 53/64 (82.81%), Query Frame = 3
Query: 2376 MSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTY-FSTYIE 2564
            ++SVG+K EYESDI++RLKLKSLA L FVP D+VR VF LLA SFP EE+ N +LTY FSTYIE
Sbjct:   80 VNSVGMKVEYESDIDVRLKLKSLAALAFVPSDEVRPVFALLAESFPDEERYNAILTYFFSTYIE 143          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: D7ELB3 (Uncharacterized protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC001422 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.372e-15
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 3
Query: 2373 KMSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTYFSTYIEEA 2570
            K++SVGLK+EYESDI+++L+LKSL  L FVP+ DVR+ F LLAASFP E+K N +LTYF   I  A
Sbjct:   41 KINSVGLKTEYESDIDVKLRLKSLVALAFVPLQDVRKNFSLLAASFPNEDKFNAILTYFFQLILRA 106          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000061495.1 (SMESG000061495.1)

HSP 1 Score: 318.161 bits (814), Expect = 1.517e-96
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 1
Query: 4567 VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPGRAARIKKRYLMEAIYMEQNRKPTNL 5031
            VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPGRAARIKKRYLMEAIYMEQNRKPTNL
Sbjct:  242 VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPGRAARIKKRYLMEAIYMEQNRKPTNL 396          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000061495.1 (SMESG000061495.1)

HSP 1 Score: 265.388 bits (677), Expect = 7.201e-77
Identity = 129/130 (99.23%), Postives = 129/130 (99.23%), Query Frame = 1
Query: 4567 VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPG 4956
            VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRP 
Sbjct:  242 VENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPA 371          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000073500.1 (SMESG000073500.1)

HSP 1 Score: 85.1149 bits (209), Expect = 9.638e-33
Identity = 38/70 (54.29%), Postives = 53/70 (75.71%), Query Frame = 1
Query: 2593 LRVYNQYKAAAEQSPKTTNYCEEAFQNAFISIFHCSHPSIWFLFDEIERNLAYHKLTLTKAQLKQEIKKE 2802
            +R++NQ++AAAE SPKTTN CE  F NA  + FHCSHPSIW L+D ++R++A H+LTL   Q ++  KK+
Sbjct: 1694 VRIWNQWEAAAENSPKTTNCCE-GFHNALNATFHCSHPSIWLLYDGLQRDIACHRLTLANYQTERPEKKK 1762          

HSP 2 Score: 77.0258 bits (188), Expect = 9.638e-33
Identity = 37/75 (49.33%), Postives = 52/75 (69.33%), Query Frame = 3
Query: 2373 KMSSVGLKSEYESDINIRLKLKSLATLVFVPIDDVRQVFDLLAASFPGEEKCNEVLTY-FSTYIEEAAGRDPQLP 2594
            +++ VG K+ YES+++++L LKSL  L FVP ++V   FD+LA +FP E+  N VL+Y F TYIE A GRD   P
Sbjct: 1619 RVNCVGFKNLYESNVDVKLMLKSLCALAFVPANEVMSAFDILARTFPDEDPYNAVLSYFFQTYIEGAIGRDSMFP 1693          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000025087.1 (SMESG000025087.1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.474e-19
Identity = 52/107 (48.60%), Postives = 66/107 (61.68%), Query Frame = 3
Query: 2229 ARVTSWKCREHHKNHCKALLKTFANAIRSDIPTPSYDK*GRISLKPR*KMSSVGLKSEYESDINIRLKLKSLAT--LVFVPIDDVRQVFDLLAASFPGEEKCNEVLT 2543
            A VT+W+CREH KNHCKALLK FAN IRSDIPT  +   G  S K    ++   +K++  +       +  LA   L+  PI  V Q+FDLL ASFP +E+ NEVLT
Sbjct:   28 AGVTTWRCREHQKNHCKALLKIFANTIRSDIPTHFH---GSCSQKVSVNITKAKMKNDMRNVGATARNVIGLALTRLLTRPI-YVGQLFDLLEASFPADERYNEVLT 130          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000069251.1 (SMESG000069251.1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.701e-16
Identity = 53/153 (34.64%), Postives = 89/153 (58.17%), Query Frame = 1
Query: 4570 ENILEELQKDLKKAYADKEIRTKRTEKWIRKCRLMETSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALKVKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPGRAARIKKRYLMEAIYMEQNRKPTN 5028
            E + E  ++DLK+   +KEI T + ++ +R+ R +  SWF+P ++   + QI  LK +A+Q+  EI+ LK  ++ERE E+D  K +   VNPVI+    + +ELF  Q E+ +   ++    KRK+R G+  R+++R   E   +EQ  K  N
Sbjct:  504 EKLAECFRRDLKQLNDEKEIHTHQVDRLMRRYRSIVASWFKPDQVNEVQQQIHLLKSQATQNQDEIKELKTAIKEREREIDIFKSELGIVNPVIT----TEIELFPSQTELRSSNVTKQSCIKRKSRLGKKERMRQRQCKEKQQIEQLEKSIN 652          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SETMAR2.326e-836.79SET domain and mariner transposase fusion gene [So... [more]
SETMAR2.956e-836.79SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN1.419e-736.79Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087T0R51.561e-2266.67Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
A0A0B7BRZ12.590e-2171.23MULE domain-containing protein (Fragment) OS=Arion... [more]
A0A0B7BPQ33.074e-2063.38Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A0B7BS233.563e-1670.31MULE domain-containing protein (Fragment) OS=Arion... [more]
D7ELB31.372e-1562.12Uncharacterized protein OS=Tribolium castaneum OX=... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061495.11.517e-96100.00SMESG000061495.1[more]
SMESG000061495.17.201e-7799.23SMESG000061495.1[more]
SMESG000073500.19.638e-3354.29SMESG000073500.1[more]
SMESG000025087.12.474e-1948.60SMESG000025087.1[more]
SMESG000069251.13.701e-1634.64SMESG000069251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034827 ID=SMED30034827|Name=Histone-lysine N-methyltransferase SETMAR|organism=Schmidtea mediterranea sexual|type=transcript|length=5322bp
TAGGTAAGTCTATTCGTCCAATAGAATCGCAGAACTTCCATTGATAAAAA
ACTAACAAATATTGGATTAATGTTAAATAATGCTACGAATGAGTTTTGTT
TACAAGTATGCGTAGAATGGTGTATCAAAAATTCGATTGTGCAAATAAAA
TCTAAAGAGAATGCTCATATTAAAAAATTGATTAATTTGAGAAAAATATT
TGGGATTTCTAAATTTAGTGTGGAGAATACTGTGATAAATTTGAGTAAAA
TAGTGTTGAATGATGATGAAGAGCGTGTTTTAAAATTTGGTCCAAATCAC
TGTATTAAGAATCGCTTGGATGAAACAAAATTGTGTGCAAAAATTGAAAG
TTTATATTTTCATATAGCCCGATCGATGAAAGGCATTAATGGTAATTATG
TGAAGTACGATGGAGTATATCGATAAAAACAAAAAGCAGAATATTAGGGA
TTTTATGACTTTAAAAAACTTAGCTAAAAAAATATAAATATCTGTAAGTT
TGACAAAGGAAATGGGATAGTTATTCTTGAATTCAACTACTATTGAGTGA
CTTTCCAATGCATTCGAAATGTCATTGTTGAATAGAGCTGGCATGCTTCA
AAGCACTGATAAATCATATCGACAATATATACTTTTTTGAAACCCGTGAG
GACAAATTTGATCGTTATCTAATTTGTTTGCAGACCGGAAGGTTCATTAA
CCCACTGACTCACTATATTTGCAATTTGGGAATTAAAATACAATTAAAAA
TGTCTTTTTGAATTCTGAAATCTACGGTTGTTAAAAAGGTTAATCTTATA
ACTTAAAACGAAAACGCGATACTGTAAGTGATTACAATGCAAAATACTGG
AATTTTTGGCCCATGCTCTTATTGATTTACCTTTTGTTAAAATTTCAATT
TTACAACCGAATATTAAAATGGATATTCTCAAATTATTTTACTTTTTATA
CTGAAATGAATTCTGAAACATTTTCAATTTTTATTTGGCGATGATAACAG
TAATTTCATATCAGTAATTTTTATACACTCTAGTAAGCAATTTAACAAAG
GAAATTATAATTATGATGGCATCAAGACATTTGATTATCGTATTGTATCG
GATTATGTTTTCTATTGTTTTTCAAAGTTAATTTAATCAATAAAATAGGT
AGGAGAGTGGGTGAAAATATAAATATGAATGACTCACCCCGAGATACACT
TTTGATTCATTATAATTGTAATCAGAGCCATCTTATCCACCGCTAAATTA
ATGTAGTTGTAATTCATAGCTGTGATCTATATATATATAAACTTTAAAAT
CTTTTTTGTAGGTAGCGGAATCATTTATGTAAATAAAATTTAAATAAATA
ACAATGGTAGCCAATTTCCACAATGTTTTTTCATAAAATATGATATATTT
CGACCGATATTTTCTTTCACTCAAATTAACTTGAATTAAAATTATCCAAT
GGTGATTTTGACTTGTTTGATAGCGATTGAAGTGGGCGTCCGTTAGGGTT
TGATAATAAAGCTTTAAAAACTCTAGTGGAAACGAATCCCAAACTGAGTA
TCCAGGAAATAGAAAACACTACAGGCTACTTGACCAACAGTTCAAAGATA
TCTTGATGAAATCTGGAAGGTTTGCAGGCAAGGTATATGGGTTCCACATC
TATTGTCGGAGATGAATATAGATTAACGGCGTACAATTTGCACACCCTTT
TTTTGCAGAGAAAGAAGTGATCCATTTTTACAAAATATTGATACTAGTGA
CGAGAAATGGGCCTTGTACAGTCAGAACAAGCGCAATAAACAATGGATTT
TCCAAATCAACTAACCTAAACCATCCCTCACTTTAATAAAGATGCTATTG
TGCGTTTGTTGTGACTAGTAGCATTATTCATTTTGAACTATATATATACA
TGTATACATTGATTGATAGATTGATTAATTGGTTAAAGTATTGATTGATA
AATACATAAACTCCGTTTTGTCATAGAACACATGACAGAACGACACAGTT
AGAAAACAACACAGACAAAATGACACATATACACAACGACACCTTTTATA
AAAATAACACGCGGCACAGATTTTTTGAAAAAAGTGGAATTGTGTAAATT
ATTACGTTCATTACTGGTAATAATTTATCACAATTTATTTCTTAAATTAC
AAGAATTTTCTGAAACTCAGAAAAACAAAAATGTTTTGATTATAAATGGC
TTTGAGTATATCAAGTATCGGGAAAAATGCAAGAGTAACTTCATGGAAAT
GTAGAGAACATCATAAAAACCATTGCAAGGCGCTTTTAAAGACTTTTGCA
AATGCAATCAGAAGTGACATACCAACACCCTCCTATGATAAGTGAGGGCG
AATATCACTAAAGCCAAGATGAAAAATGAGCAGTGTTGGATTAAAAAGTG
AATATGAATCAGACATTAACATCAGACTGAAGTTAAAATCGCTTGCAACC
TTGGTATTTGTTCCGATCGATGATGTAAGGCAAGTTTTTGATCTACTTGC
CGCTTCATTTCCAGGCGAGGAAAAGTGCAATGAAGTTCTCACCTACTTCT
CCACATACATTGAAGAAGCAGCAGGAAGAGATCCACAGTTACCTAAGAGT
GTATAATCAATATAAAGCTGCCGCCGAACAATCACCGAAAACAACGAATT
ACTGCGAAGAAGCGTTCCAAAATGCATTTATTTCCATTTTTCACTGCAGT
CACCCAAGCATCTGGTTTCTATTTGATGAAATTGAGAGGAACTTGGCGTA
CCACAAGCTCACACTCACAAAAGCACAACTAAAACAAGAAATAAAAAAAG
AAAGTATGATCTTCTCCGTGAGCAAGTACCCACTGTAGTCCACATGTATG
AAGTTGATGAAGACAAGTTGAAATACTTAAGACGAATGGCAAATTTAAAG
TGAGAAAAGATTTATAAATAAAAATAATATTTATATGATGCCTCTTATTA
TTAAATAATAAGATAATTGAAATATGATTAATATATAAAATGTATCGTTT
TGTCTATATGTTGTTTTGTAATTATGTCGAAATGTCTGTGTTGTTTTGTC
ATATAACCAATTAATTACTATCTGTAGTCAGTAATATATATTTATTTATA
AAGTAGTTAAATTAGCAAAGTTTTGTGCAGTGACAAAAACAGACAAACGT
ACGTATTATTGTCTAGCATATTAATCATCAAGTGAAATATAATTTATGAA
TCTTATCCGGCCGTATTGGACGGTCTTATATCACTAGTGATTTTGAAGTG
TGCCGTGAGATGTAAGAGGTACTTTGAAAAAACATCAATATTACAGTTAT
TTTTTGATTTTTCATGTTCACCTTTAGATTATTTATTAATTCTTTTTAAA
TAAATTAAATCATTCCTCTTAACCTATTCTAGTTATTTTATCCTTCCAGA
GTACTGAGTCAACATTAAGTTGTGAATTTTTTGTTGGTTTTTAATACACA
GGTAACACAGCATGTAGCAAAAATCATTGAAAACACACAAAACCCTACGA
AAATAACGAAAATTAATAAGATAACAAAAATTCTCAAATATAGCACAAAA
ATATTTAATTAAATCGATTATATCATTTAATTTTTGGAAAAAAGGAAAAT
AAATTATCAAAAGCAAGAAATGAAGAAATAAAATAATTTAAAGAAATTCA
AATTTGTTTAAAAGTACAAGTAACAATCAGACACACGTGCAATAAATCTC
TATAAAAGCCGATGCTGAACTTATCTTATCTTTTACCTCAATTTTTGAAC
TCGAAATTCTTACAGAAATTCTTTCTACAATTCTTATTTCAGTACTTTTT
TCAGCTAAATATTTATTCAAGAAGGAAAATAAGAATGAACTACACCAAGA
AACACATTTATTACAACCTAAAGAAATGTAGATTGATAGAAATACGAGAA
AGAATTATTGGCAAAATGAAAAGTAATAAAGTTGAAGAAGATTATATTCA
ATTGGGATGTTTCAAAATTGATCGAAGAAACTTTAAAAATGATTTAGGGA
ATGTGTTGTATTATGGATCTGATAATATAATTCCGATGGTTACTTTGAAC
AAAATTATTTTAGACATCTCAATTTTCAGCTAAATATTTATGAATACATC
ACAAAATATGCATAAGGCAATAAAGGGTTGATATAATCTAAAATTCAGAT
CTTTTCCAGGGACTCCTCGCTATATACCCCAGGTTGTGCATAGTGAATAC
GGTACAGACTATGAAAAATAACAAAATATTACAACCTTTAAGAAGGTAGG
TTTTAAGAAATACGAGAAATAACTCATACGCGAAGATAGACAAAATGAAA
TCCAATGAACTCGAAGAAGATGAGATTCAATTGTGATTTATCAAAAGAGA
ATGTGCCATATAAAAGTAATAGAATTCCGATGGTGATTTAGAACAAAATT
ATTGTACGAAGAGCTCGTTTCATGATTACTGAAATCTGTAATGAAGCGTC
AGTTAATAAATGTCGATGGTCGGCGGATAACGGTTAGGCATTGTCATTTA
TACTTTTATGAAGACGTAATTTGAAAACCTTGACGCTAATCGAAGCTTAA
TTGTGATTTTAATTTAGTGGAAAATATACTAGAAGAACTTCAAAAAGATT
TAAAAAAGGCCTATGCCGACAAAGAAATACGAACGAAAAGAACGGAGAAG
TGGATCCGAAAATGCAGGTTGATGGAAACATCATGGTTTAGACCAGCGCG
TATGCGTTATGCGAAAAATCAAATTCGGAGTTTGAAATTAAAGGCGTCTC
AGGATCTGATTGAGATTCAAGCACTGAAGATGACTCTACAAGAAAGAGAA
CACGAGCTAGACGCTCTCAAAGTAAAATATCGGACAGTTAATCCCGTCAT
CTCTCCATTCGGGCAATCTACGGTGGAATTATTTGAACCGCAACAGGAAA
TAGTGACGGACGAAACAAGTCAATTCAAAAATGCAAAACGGAAAAACAGA
CCGGGTAGAGCAGCGAGAATAAAAAAGCGATATCTCATGGAAGCCATATA
TATGGAACAAAATAGAAAACCTACCAATCTTTGATTGTTGTAAAATTTTA
AAAATTCGATGAATAAACATTTTGTTTTTTTAATTCCTTGTTGATTTAGA
TCTTATTATTGATTTTGTGTAAAATCAACATGCCAGTGAAATTGTGTATT
AATATATTTCAAACCAAAATACTTTCTATGTCCAACAAATACTAATGTCG
ATTTTATCGGTGCTAATATTAATTTTGTGTCAAAAATCTTTTATCTTCAT
ATTTATTTATAATTGAAATCATAATTCAATCGTGGCAAAATCTATATTAT
TTGATTTGTATTAAATCTAAAA
back to top

protein sequence of SMED30034827-orf-1

>SMED30034827-orf-1 ID=SMED30034827-orf-1|Name=SMED30034827-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
METSWFRPARMRYAKNQIRSLKLKASQDLIEIQALKMTLQEREHELDALK
VKYRTVNPVISPFGQSTVELFEPQQEIVTDETSQFKNAKRKNRPGRAARI
KKRYLMEAIYMEQNRKPTNL*
back to top

protein sequence of SMED30034827-orf-2

>SMED30034827-orf-2 ID=SMED30034827-orf-2|Name=SMED30034827-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MLNNATNEFCLQVCVEWCIKNSIVQIKSKENAHIKKLINLRKIFGISKFS
VENTVINLSKIVLNDDEERVLKFGPNHCIKNRLDETKLCAKIESLYFHIA
RSMKGINGNYVKYDGVYR*
back to top

protein sequence of SMED30034827-orf-3

>SMED30034827-orf-3 ID=SMED30034827-orf-3|Name=SMED30034827-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MKFSPTSPHTLKKQQEEIHSYLRVYNQYKAAAEQSPKTTNYCEEAFQNAF
ISIFHCSHPSIWFLFDEIERNLAYHKLTLTKAQLKQEIKKESMIFSVSKY
PL*
back to top

protein sequence of SMED30034827-orf-4

>SMED30034827-orf-4 ID=SMED30034827-orf-4|Name=SMED30034827-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MLNLSYLLPQFLNSKFLQKFFLQFLFQYFFQLNIYSRRKIRMNYTKKHIY
YNLKKCRLIEIRERIIGKMKSNKVEEDYIQLGCFKIDRRNFKNDLGNVLY
YGSDNIIPMVTLNKIILDISIFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015155PFU
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation