SMED30034823

Overview
NameSMED30034823
Smed IDSMED30034823
Length (bp)1181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034823 (SMED30034823) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034823 (SMED30034823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034823 (SMED30034823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034823 (SMED30034823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 42

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034823h1SMcG0021126 SmedASXL_014591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034823h1SMcG0021126 SmedASXL_014591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig45408newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig45408uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021126 Contig45408newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021126 Contig45408uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig10577newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig10577uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig45408newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig45408uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021126 Contig45408newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021126 Contig45408uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig10577newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034823h1SMcG0021127 Contig10577uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034823h1SMcG0021127 dd_Smed_v4_822_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034823h1SMcG0021126 dd_Smed_v6_15812_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034823h1SMcG0021126 dd_Smed_v6_15812_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynx musculatureSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30034823h1SMcG0021127 dd_Smed_v6_822_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034823h1SMcG0021126 dd_Smed_v4_15812_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034823 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004569:7958..13045 -5668
Homology
BLAST of SMED30034823 vs. UniProt/SwissProt
Match: sp|Q9GZ69|TPM_MIMNO (Tropomyosin OS=Mimachlamys nobilis OX=106276 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.883e-8
Identity = 64/211 (30.33%), Postives = 115/211 (54.50%), Query Frame = 1
Query:  205 LDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            L+ +  Q  +++ +V  L+RR+  LE D   S   L +   +++   K ADE+ER RK  E + N  +ER +E+   ++ A      A  K+D+A  +L  T   +   E +++AA  K+ E E+E+    A  K LQ Q+++  ++E   EE I  L K +++AE+RA +AE +V++ + +V+RL+ ++  E E   +I  D+    +E 
Sbjct:   71 LENSEKQITQLESDVGGLQRRLTLLEEDYERSEEKLNSTTEKLEEASKAADESERNRKVLEGRSNSYEERIDELEKQLETAKNVATDADHKFDEAARKLAITEVDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVVKLQKEVDRLEDELLAEKERYKAISDDLDQTFAEI 281          
BLAST of SMED30034823 vs. UniProt/SwissProt
Match: sp|Q8WR63|TPM_TRIPS (Tropomyosin OS=Trichinella pseudospiralis OX=6337 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.087e-6
Identity = 67/230 (29.13%), Postives = 118/230 (51.30%), Query Frame = 1
Query:  148 ELKKKAEELSDENGVKSMELDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            EL K  EEL+  N     +L++   +  E + EV  L RR++ LE D   +   L+    +++   + ADE+ER RK  E +   ++ER  ++ A +K A    E A  KYD+   +L      +   E + +A   KI E E+E++      K L+   E+ +++E   EE I  L ++++EAE+RA+ AE  V + + +V+RL+ ++  E E   +I +++     E 
Sbjct:   56 ELDKAQEELTGANA----QLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTADESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQEL 281          
BLAST of SMED30034823 vs. UniProt/SwissProt
Match: sp|O02389|TPM_CHLNI (Tropomyosin OS=Chlamys nipponensis akazara OX=6571 PE=2 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.481e-6
Identity = 61/211 (28.91%), Postives = 113/211 (53.55%), Query Frame = 1
Query:  205 LDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            L+ +  Q  +++ +V  L+RR++ LE D   S   L     +++   K ADE+ER RK  E + N  +ER + +   ++ A      A  K+D+A  +L  T   +   E +++AA  K+ E E+E+    A  K LQ Q+++  ++E   EE I  L K +++AE+RA +AE ++ + + +V+RL+ ++  E E   +I  ++    +E 
Sbjct:   71 LENSDKQITQLESDVGALQRRLQLLEEDFERSEEKLATTTEKLEEASKAADESERNRKVLEGRSNTAEERIDVLEKQLETAKNVATDADQKFDEAARKLAITEVDLERAETRLEAADAKVHELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLSKNLKDAETRATEAERQLTKLQKEVDRLEDELLAEKERYKAISDELDQTFAEI 281          
BLAST of SMED30034823 vs. UniProt/SwissProt
Match: sp|O16127|TPM_ECHGR (Tropomyosin A (Fragment) OS=Echinococcus granulosus OX=6210 PE=2 SV=3)

HSP 1 Score: 51.2174 bits (121), Expect = 5.385e-6
Identity = 62/211 (29.38%), Postives = 111/211 (52.61%), Query Frame = 1
Query:  205 LDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            L++   ++   + EV  + RR+  LE D   SS  L     ++D+  K A+E+ER RK  E +   +DER  ++   +K A    E A  KYD+A  RL  T   +   E++++ +  KI E E+E++      K L+   +E +++E   EE I  L ++++ AE RA +AE +V + + +V+RL+ ++  E E   +I  ++    +E 
Sbjct:   65 LEETEKRATNAEAEVAAMTRRIRLLEEDFEQSSGRLTETSTKLDDASKAAEESERNRKTLETRSISDDERMAQLEEQVKEAKYIAEDAERKYDEAARRLAVTEVDLERAESRLETSESKIVELEEELRIVGNNMKSLEVSEQESLQREESYEETIRDLTERLKTAEQRAAEAERQVSKLQNEVDRLEDELLSEKERYRAISGELDTTFAEL 275          
BLAST of SMED30034823 vs. UniProt/SwissProt
Match: sp|Q95VA8|TPM_TRISP (Tropomyosin OS=Trichinella spiralis OX=6334 PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 5.783e-6
Identity = 67/230 (29.13%), Postives = 116/230 (50.43%), Query Frame = 1
Query:  148 ELKKKAEELSDENGVKSMELDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            EL K  EEL+  N     +L++   +  E + EV  L RR++ LE D   +   L     ++    + ADE+ER RK  E +   ++ER  ++ A +K A    E A  KYD+   +L      +   E + +A   KI E E+E++      K L+   E+ +++E   EE I  L ++++EAE+RA+ AE  V + + +V+RL+ ++  E E   +I +++     E 
Sbjct:   56 ELDKAQEELTGANA----QLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLIIATEKLGEASQTADESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQEL 281          
BLAST of SMED30034823 vs. TrEMBL
Match: E5KWJ5 (Tropomyosin 2 low molecular weight isoform (Fragment) OS=Mesocestoides corti OX=53468 PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.067e-8
Identity = 51/204 (25.00%), Postives = 109/204 (53.43%), Query Frame = 1
Query:  235 VKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL 846
             + EV  L+RR+  LE D  ++   L     +++   K ADE+ER+R+  + +Q  +D R E++   I+        A  KY++A ++L    ES++  E +++ A  +I   E E++      K ++       +++   +  +  L KQ++EAE R Q+AE+E+ +++ ++ RL++++  E     S+++DM ++ ++ +  
Sbjct:    1 AEAEVAALQRRIRLLEDDLESTDTRLTDATAKLEEASKAADESERFRRALQSRQVTDDSRIEQLQQRIQKTAKEAAEAERKYNEATQKLATAEESLANAEKRVEDAEERIRSMEHELRAITTNLKTMELSESTASKQKQTYQTTLEKLTKQLEEAEKRTQQAESEMTRRQEELSRLETELDAEKTMNASLQEDMEHIFADLQNF 204          
BLAST of SMED30034823 vs. TrEMBL
Match: A0A564Z0F8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11345 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 3.164e-8
Identity = 52/206 (25.24%), Postives = 110/206 (53.40%), Query Frame = 1
Query:  229 NEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL 846
            ++ + EV  L+RR+  LE D  ++   L     +++   K ADE+ER+R+  + +Q  +D R E++   I+        A  KY +A ++L    +++S  E +++ A  +I   E E++      K ++       +++   +  +  L KQ+ EAE R ++AE E+ +++ ++ RL++++ ME     S+++DM ++ +E + L
Sbjct:   46 DKAEAEVAALQRRIRLLEDDLESTDTRLTDATAKLEEASKAADESERFRRALQSRQVTDDSRIEQLQQRIQKTAKEAAEAERKYQEATQKLATAEDALSAAEKRVEDAEDRIRSMEHELRAITTNLKTMELSESTASKQKQTYQATLEKLTKQLAEAEKRTERAEEEMTRRQEELTRLEAELDMEKTLNASLREDMESIVAELQNL 251          
BLAST of SMED30034823 vs. TrEMBL
Match: A0A5K3ESV6 (Tropomyosin 2 high molecular weight isoform OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 8.912e-8
Identity = 49/195 (25.13%), Postives = 106/195 (54.36%), Query Frame = 1
Query:  256 LRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFK 840
            L+RR+  LE D  ++   L     +++   K ADE+ER+R+  + +Q  +D R E++   I+        A  KY++A ++L    ES++  E +++ A  +I   E E++      K ++       +++   +  +  L KQ++EAE R Q+AE+E+ +++ ++ RL++++  E     S+++DM ++ ++ +
Sbjct:   88 LQRRIRLLEDDLESTDTRLTDATAKLEEASKAADESERFRRALQSRQVTDDSRIEQLQQRIQKTAKEAAEAERKYNEATQKLATAEESLANAEKRVEDAEERIRSMEHELRAITTNLKTMELSESTASKQKQTYQTTLEKLTKQLEEAEKRTQQAESEMTRRQEELSRLETELDAEKTMNASLQEDMEHIFADLQ 282          
BLAST of SMED30034823 vs. TrEMBL
Match: A0A504ZCL6 (Tropomyosin 1 low molecular weight isoform OS=Fasciola gigantica OX=46835 GN=FGIG_01974 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.101e-7
Identity = 60/202 (29.70%), Postives = 108/202 (53.47%), Query Frame = 1
Query:  241 VEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL 846
             EV  + RR+  LE D   SS  L   L++++   K A+E+ER  +    + +  D+  E++      A  +   A  K+++    L  T E++ + E ++ AA  KI + E  +K   +  K ++ + EE +E+E   EE  N LR+ V+EAESRA  AEAEV ++  +++R K ++  E+    +++++M  + SEF  +
Sbjct:  146 AEVAAMTRRIRLLEEDLEVSSSRLTETLSKLEEASKTAEESERACRNVGNRLSTYDKNVEQLEKTADEAVFAAREADRKFEEVSRNLALTEENLRQAEGRVTAAEEKIKDLEGTLKSLTSSLKTMEIKQEESVEREKTLEERANKLRQHVEEAESRANAAEAEVNRRTQEIKRTKERIAAEHTTYETLRREMDTMISEFHSI 347          
BLAST of SMED30034823 vs. TrEMBL
Match: A1KYZ4 (Tropomyosin OS=Argopecten irradians OX=31199 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.107e-7
Identity = 70/224 (31.25%), Postives = 123/224 (54.91%), Query Frame = 1
Query:  166 EELSDENGVKSMELDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEF 837
            E+L D N     +L+ A  Q  +++ +V  L+RR++ LE D   S   L +   +++   K ADE+ER RK  E K N N+ER +E+   + +A    + A  K+D+A  +L  T   +   E +++AA  K+ E E+E+    A  K LQ Q+++  ++E   EE I  L K +++AE+RA +AE +V + + +V+RL+ ++  E E   +I  ++    +E 
Sbjct:   62 EQLQDAN----TKLENAEKQITQLESDVAGLQRRLQLLEEDYERSEEKLNSTSEKLEEASKAADESERNRKALEGKNNTNEERIDELEKQLDSAKNVAQDADSKFDEAARKLAITEVDLERAETRLEAADAKVLELEEELTVVGANIKTLQVQNDQASQREDSYEETIRDLTKSLKDAENRATEAERQVTKLQKEVDRLEDELLAEKERYKAISDELDQTFAEI 281          
BLAST of SMED30034823 vs. Planmine SMEST
Match: SMESG000024340.1 (SMESG000024340.1)

HSP 1 Score: 431.409 bits (1108), Expect = 1.108e-152
Identity = 250/251 (99.60%), Postives = 250/251 (99.60%), Query Frame = 1
Query:   94 MSDEANGMTVKDVKESVLELKKKAEELSDENGVKSMELDKAASQSNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDXXXXXXXXXXXXXXXLQSQSXXXXXXXXXXXXYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL 846
            MSDEANGMTVKDVKESVLELKKKAEELSDENGVKSMELDKAASQ NEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDEKEKEVKEKVAKYKKLQSQSEERMEKEAKREEYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL
Sbjct:    1 MSDEANGMTVKDVKESVLELKKKAEELSDENGVKSMELDKAASQGNEVKVEVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERKQNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKIDAARRKIDEKEKEVKEKVAKYKKLQSQSEERMEKEAKREEYINFLRKQVQEAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKKL 251          
The following BLAST results are available for this feature:
BLAST of SMED30034823 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GZ69|TPM_MIMNO3.883e-830.33Tropomyosin OS=Mimachlamys nobilis OX=106276 PE=1 ... [more]
sp|Q8WR63|TPM_TRIPS1.087e-629.13Tropomyosin OS=Trichinella pseudospiralis OX=6337 ... [more]
sp|O02389|TPM_CHLNI1.481e-628.91Tropomyosin OS=Chlamys nipponensis akazara OX=6571... [more]
sp|O16127|TPM_ECHGR5.385e-629.38Tropomyosin A (Fragment) OS=Echinococcus granulosu... [more]
sp|Q95VA8|TPM_TRISP5.783e-629.13Tropomyosin OS=Trichinella spiralis OX=6334 PE=2 S... [more]
back to top
BLAST of SMED30034823 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E5KWJ51.067e-825.00Tropomyosin 2 low molecular weight isoform (Fragme... [more]
A0A564Z0F83.164e-825.24Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3ESV68.912e-825.13Tropomyosin 2 high molecular weight isoform OS=Mes... [more]
A0A504ZCL64.101e-729.70Tropomyosin 1 low molecular weight isoform OS=Fasc... [more]
A1KYZ45.107e-731.25Tropomyosin OS=Argopecten irradians OX=31199 PE=2 ... [more]
back to top
BLAST of SMED30034823 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034823 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024340.11.108e-15299.60SMESG000024340.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034823 ID=SMED30034823|Name=SMED30034823|organism=Schmidtea mediterranea sexual|type=transcript|length=1181bp
TTTTGAAATATTTTAGTTGATTTATCATAAAATAATTGTTAACATAAAAT
TTATAAAATTTAAACTAGTTTATTTTAAATAAATTAAGTTCAAATGTCTG
ATGAAGCAAATGGAATGACTGTTAAAGATGTTAAAGAATCAGTATTAGAA
TTAAAGAAAAAAGCTGAAGAATTATCTGATGAAAATGGTGTGAAGTCTAT
GGAATTAGACAAGGCTGCATCACAGAGCAATGAAGTCAAAGTTGAAGTTG
ATTTGCTAAGAAGACGAGTAGAATCTTTAGAAGGTGATTGCGTTACTTCT
TCTCATACTTTAGAAGCTATGCTAAATCAGATAGATAACGTCGGGAAAAT
AGCAGATGAAAATGAAAGATGGAGAAAAGAATACGAAAGAAAACAGAATG
ACAACGATGAAAGAGCTGAAGAAATGTCTGCTATAATTAAAGCAGCATGC
GCATCTACAGAATCAGCGACACTAAAATATGATGATGCATTGGAACGGTT
GAATCAAACCGTCGAAAGTATTAGTGAAATGGAAAATAAGATCGATGCTG
CTCGAAGAAAAATTGATGAAAAAGAAAAGGAAGTCAAAGAAAAAGTAGCG
AAATACAAAAAGTTGCAATCACAGTCTGAAGAAAGAATGGAAAAAGAAGC
TAAGCGAGAGGAATATATAAATTTTCTCAGAAAACAAGTTCAAGAAGCAG
AGTCGCGTGCTCAGAAGGCTGAAGCTGAAGTGCTTCAGAAAAAGGCTGAC
GTTGAAAGGCTGAAAAGTAAAGTGAAGATGGAAAATGAAGGCGTTTGCAG
TATCAAGAAAGATATGAGCAATTTGTGTTCGGAATTTAAGAAGTTATGAT
TTTAGGCTGTTCTCGAGTGGCAAACAATTTTTCCATTGCGGGAGTTTTTG
CATGAATTATTTAGAATTCTTTTTGTTTTTTGTTTTTCCTTGCGAGAGAG
AAACTTTGATTTTCGTGATTTCAGTTATAATCTTGGTTAGAGGTGCCATT
TGATTGGCTGATGTGAAATGCGCAACAGCAGTATTTATGTGCACAATATG
GTTTTATTGATTATTGGCTCGTTGATAATTATGTGTGTGTTTGTGTGCTT
GATGATGATGGTGATGATCAATAATCAATTTTTATATAGCTTTATTGAAT
CAATAAATTTATTCATAGTTCTGAAAAAAAA
back to top

protein sequence of SMED30034823-orf-1

>SMED30034823-orf-1 ID=SMED30034823-orf-1|Name=SMED30034823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MSDEANGMTVKDVKESVLELKKKAEELSDENGVKSMELDKAASQSNEVKV
EVDLLRRRVESLEGDCVTSSHTLEAMLNQIDNVGKIADENERWRKEYERK
QNDNDERAEEMSAIIKAACASTESATLKYDDALERLNQTVESISEMENKI
DAARRKIDEKEKEVKEKVAKYKKLQSQSEERMEKEAKREEYINFLRKQVQ
EAESRAQKAEAEVLQKKADVERLKSKVKMENEGVCSIKKDMSNLCSEFKK
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000533Tropomyosin
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0008307structural constituent of muscle
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005862muscle thin filament tropomyosin
GO:0005884actin filament
Vocabulary: biological process
TermDefinition
GO:0006936muscle contraction
GO:0007015actin filament organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 82..116
NoneNo IPR availableCOILSCoilCoilcoord: 19..67
NoneNo IPR availablePANTHERPTHR19269:SF45TROPOMYOSIN-1, ISOFORMS 33/34coord: 5..138
NoneNo IPR availablePANTHERPTHR19269TROPOMYOSINcoord: 5..138
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 11..139
IPR000533TropomyosinPFAMPF00261Tropomyosincoord: 5..137
e-value: 1.1E-11
score: 44.6