Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30034818
Length (bp)901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30034818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30034818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034818SMESG000010241.1 SmedASXL_015882SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034818SMESG000010241.1 Contig48972newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034818SMESG000010241.1 Contig48972uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30034818SMESG000010241.1 dd_Smed_v4_7644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 144.821 bits (364), Expect = 3.483e-38
Identity = 70/98 (71.43%), Postives = 82/98 (83.67%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F   +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  804 FNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 901          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 133.65 bits (335), Expect = 5.176e-38
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:   50 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 145          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 134.42 bits (337), Expect = 4.962e-37
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  138 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 233          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 137.117 bits (344), Expect = 1.967e-35
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  791 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 886          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 104.76 bits (260), Expect = 1.986e-24
Identity = 51/98 (52.04%), Postives = 69/98 (70.41%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F +G   NI+D++L  +EQY++NLED+++ERTE+   EK+K E LL  MLP SVA  L K   V  E +DLVT++FSDIVGFT +SA S P++V   L
Sbjct:  812 FNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLL 909          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 131.724 bits (330), Expect = 2.853e-34
Identity = 61/97 (62.89%), Postives = 80/97 (82.47%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            R+ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQV T L
Sbjct:  388 RDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLL 484          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 132.109 bits (331), Expect = 4.230e-34
Identity = 61/97 (62.89%), Postives = 80/97 (82.47%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            R+ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQV T L
Sbjct: 1015 RDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLL 1111          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 131.724 bits (330), Expect = 5.065e-34
Identity = 61/97 (62.89%), Postives = 80/97 (82.47%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            R+ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQV T L
Sbjct:  956 RDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLL 1052          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 131.724 bits (330), Expect = 5.232e-34
Identity = 61/97 (62.89%), Postives = 80/97 (82.47%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            R+ ++ N++DNLL RMEQYANNLE +V+ERT++YL EKKK E+LL+ +LP ++A  LI  + V AESYD VTI+FSDIVGFT+LS++STPMQV T L
Sbjct:  977 RDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLL 1073          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-11 (Receptor-type guanylate cyclase gcy-11 [Source:UniProtKB/Swiss-Prot;Acc:Q18331])

HSP 1 Score: 116.316 bits (290), Expect = 9.639e-29
Identity = 55/96 (57.29%), Postives = 76/96 (79.17%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +G  GNI DN+++ +++Y NNLED+++ERTEQ  +E+K+ E LL  +LPKSVA+ L   QPV+AE YD V+I+FSDIVGFTALS++STP+QV   L
Sbjct:  926 KGLKGNIADNIMNLLDRYRNNLEDVIKERTEQLEDERKRNESLLLQLLPKSVANSLKNGQPVDAEFYDSVSIYFSDIVGFTALSSKSTPLQVVNML 1021          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 140.584 bits (353), Expect = 6.527e-37
Identity = 67/97 (69.07%), Postives = 82/97 (84.54%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            ++ ++GNI+DNLL RME YANNLE++V+ERT+ Y EEKKK E LLY +LP+SVA QLI  QPV AE++D VTI+FSDIVGFTA+SAESTPMQV  FL
Sbjct:  882 KDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFL 978          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 140.584 bits (353), Expect = 6.527e-37
Identity = 67/97 (69.07%), Postives = 82/97 (84.54%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            ++ ++GNI+DNLL RME YANNLE++V+ERT+ Y EEKKK E LLY +LP+SVA QLI  QPV AE++D VTI+FSDIVGFTA+SAESTPMQV  FL
Sbjct:  882 KDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFL 978          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302277)

HSP 1 Score: 125.561 bits (314), Expect = 8.961e-32
Identity = 62/98 (63.27%), Postives = 73/98 (74.49%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             R G + NI+D ++  ME+YANNLEDIV ERT    EEK K EDLL+ MLP+SVA +L   Q V   SYDLVTI+FSDIVGFTA+SAESTP+QV  FL
Sbjct:  824 MRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFL 921          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302279)

HSP 1 Score: 125.561 bits (314), Expect = 8.961e-32
Identity = 62/98 (63.27%), Postives = 73/98 (74.49%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             R G + NI+D ++  ME+YANNLEDIV ERT    EEK K EDLL+ MLP+SVA +L   Q V   SYDLVTI+FSDIVGFTA+SAESTP+QV  FL
Sbjct:  824 MRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFL 921          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302278)

HSP 1 Score: 125.561 bits (314), Expect = 8.961e-32
Identity = 62/98 (63.27%), Postives = 73/98 (74.49%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             R G + NI+D ++  ME+YANNLEDIV ERT    EEK K EDLL+ MLP+SVA +L   Q V   SYDLVTI+FSDIVGFTA+SAESTP+QV  FL
Sbjct:  824 MRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFL 921          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 136.346 bits (342), Expect = 1.657e-35
Identity = 66/91 (72.53%), Postives = 79/91 (86.81%), Query Frame = 1
Query:  391 NILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTP+QV T L
Sbjct:  569 NILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLL 659          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 135.576 bits (340), Expect = 4.514e-35
Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+V T L
Sbjct:  814 GYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLL 908          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 135.576 bits (340), Expect = 4.514e-35
Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPM+V T L
Sbjct:  814 GYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGEMVQAEAFDSVTIYFSDIVGFTALSAESTPMEVVTLL 908          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 124.79 bits (312), Expect = 4.968e-32
Identity = 63/92 (68.48%), Postives = 72/92 (78.26%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
             G S NILD+LLSRMEQYA NLE+IV ERT +  EEKK+AE LL  MLP+SVA QLI  + V AE+YD VTI+FSDI GFTA+SA  TPMQV
Sbjct:  248 HGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQV 339          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 125.946 bits (315), Expect = 7.086e-32
Identity = 60/86 (69.77%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  406 LLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            LLSRMEQYANNLE++V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTP+QV T L
Sbjct:  806 LLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLL 891          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000009648.1 (natriuretic peptide receptor 1 [Source:NCBI gene;Acc:100492092])

HSP 1 Score: 139.043 bits (349), Expect = 1.846e-36
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F    S NILDNLLSRMEQYANNLE++V++RT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  424 FNRESSTNILDNLLSRMEQYANNLEELVEDRTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 521          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000009610.1 (natriuretic peptide receptor 1 [Source:NCBI gene;Acc:100492092])

HSP 1 Score: 139.043 bits (349), Expect = 1.862e-36
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F    S NILDNLLSRMEQYANNLE++V++RT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  454 FNRESSTNILDNLLSRMEQYANNLEELVEDRTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 551          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000009776.1 (natriuretic peptide receptor 1 [Source:NCBI gene;Acc:100492092])

HSP 1 Score: 139.043 bits (349), Expect = 1.935e-36
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F    S NILDNLLSRMEQYANNLE++V++RT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  462 FNRESSTNILDNLLSRMEQYANNLEELVEDRTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 559          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000009544.1 (natriuretic peptide receptor 1 [Source:NCBI gene;Acc:100492092])

HSP 1 Score: 139.043 bits (349), Expect = 2.395e-36
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F    S NILDNLLSRMEQYANNLE++V++RT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  472 FNRESSTNILDNLLSRMEQYANNLEELVEDRTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 569          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000009487.1 (natriuretic peptide receptor 1 [Source:NCBI gene;Acc:100492092])

HSP 1 Score: 139.043 bits (349), Expect = 2.561e-36
Identity = 69/98 (70.41%), Postives = 81/98 (82.65%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F    S NILDNLLSRMEQYANNLE++V++RT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  486 FNRESSTNILDNLLSRMEQYANNLEELVEDRTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 583          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 144.436 bits (363), Expect = 3.370e-38
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F + +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  800 FNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 897          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 137.502 bits (345), Expect = 9.818e-36
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  791 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 886          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 136.732 bits (343), Expect = 1.528e-35
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  791 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 886          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 135.191 bits (339), Expect = 3.034e-35
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  357 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 452          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2f (guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:105119])

HSP 1 Score: 104.375 bits (259), Expect = 2.248e-24
Identity = 51/98 (52.04%), Postives = 69/98 (70.41%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F +G   NI+D++L  +EQY++NLED+++ERTE+   EK+K E LL  MLP SVA  L K   V  E +DLVT++FSDIVGFT +SA S P++V   L
Sbjct:  812 FNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPLSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLL 909          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.673e-37
Identity = 70/98 (71.43%), Postives = 82/98 (83.67%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F   +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  804 FNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 901          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.163e-37
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F + +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  800 FNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 897          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 2.357e-37
Identity = 70/98 (71.43%), Postives = 83/98 (84.69%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F + +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  800 FNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 897          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P46197|ANPRB_BOVIN (Atrial natriuretic peptide receptor 2 OS=Bos taurus OX=9913 GN=NPR2 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.263e-35
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  791 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 886          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P20594|ANPRB_HUMAN (Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 9.444e-35
Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG + +ILDNLL RMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTPMQV T L
Sbjct:  791 KEGGT-SILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL 886          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A183VR86 (Guanylate cyclase domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS2992 PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.275e-43
Identity = 74/98 (75.51%), Postives = 87/98 (88.78%), Query Frame = 1
Query:  358 LKY*FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            +KY    GDS N+LDNLLSRMEQY NNLE++V++RT QYLEEKKK EDLLYSMLP+SVA QL +NQPV AES+++VTI+FSDIVGFT+LSAESTPMQV
Sbjct:    1 MKYLILSGDSNNVLDNLLSRMEQYTNNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQV 98          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A0B6YYW2 (Guanylate cyclase domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF42168 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.743e-41
Identity = 72/93 (77.42%), Postives = 82/93 (88.17%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            REGD GNILDNLLSRMEQYANNLE +V +RT+ YLEEK+KAEDLLYSMLP+ VA QLIK Q VNAE+Y+ VTI+FSDI GFTALSA+ST M+V
Sbjct:    4 REGDKGNILDNLLSRMEQYANNLEALVSDRTQDYLEEKRKAEDLLYSMLPRMVASQLIKGQSVNAETYEQVTIYFSDICGFTALSADSTAMEV 96          
BLAST of Guanylate cyclase vs. TrEMBL
Match: B7QN24 (Guanylate cyclase (Fragment) OS=Ixodes scapularis OX=6945 GN=8043725 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.935e-40
Identity = 74/97 (76.29%), Postives = 85/97 (87.63%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +E +SGNILDNLLSRMEQYANNLE +V+ERT  YLEEK+KAEDLLY +LP+SVA QLIK Q V AESYD+VTI+FSDIVGFT+LSA+STPMQV   L
Sbjct:  108 KESESGNILDNLLSRMEQYANNLESLVEERTSDYLEEKRKAEDLLYQLLPRSVASQLIKGQSVRAESYDIVTIYFSDIVGFTSLSAQSTPMQVVDLL 204          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A183RPK2 (Guanylate cyclase domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 5.522e-40
Identity = 73/101 (72.28%), Postives = 85/101 (84.16%), Query Frame = 1
Query:  382 DSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFLFGRIFDH 684
            DS N+LDNLLSRMEQYANNLE++V++RT QYLEEKKK EDLLYS+   SVA QL +NQPV AES+++VTI+FSDIVGFT+LSAESTPMQV      RIF H
Sbjct:    7 DSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSI---SVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQV-----CRIFIH 99          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A094ZKT0 (Guanylate cyclase OS=Schistosoma haematobium OX=6185 GN=MS3_03470 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 5.654e-40
Identity = 74/94 (78.72%), Postives = 87/94 (92.55%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            F+ GDS N+LDNLLSRMEQYANNLE++V++RT QYLEEKKK EDLLYSMLP+SVA QL +NQPV AES+++VTI+FSDIVGFT+LSAESTPMQV
Sbjct:  807 FQAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQV 900          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 137.502 bits (345), Expect = 6.873e-36
Identity = 66/91 (72.53%), Postives = 79/91 (86.81%), Query Frame = 1
Query:  385 SGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNT 657
            S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQV T
Sbjct:  841 SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVET 931          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 137.117 bits (344), Expect = 9.653e-36
Identity = 67/96 (69.79%), Postives = 79/96 (82.29%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTA+SAESTPMQV T L
Sbjct:  799 RGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLL 894          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 137.117 bits (344), Expect = 1.032e-35
Identity = 67/96 (69.79%), Postives = 79/96 (82.29%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTA+SAESTPMQV T L
Sbjct:  814 RGYGSNILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLL 909          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 137.117 bits (344), Expect = 1.047e-35
Identity = 67/93 (72.04%), Postives = 80/93 (86.02%), Query Frame = 1
Query:  385 SGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQV T L
Sbjct:  822 SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLL 914          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 137.117 bits (344), Expect = 1.047e-35
Identity = 67/93 (72.04%), Postives = 80/93 (86.02%), Query Frame = 1
Query:  385 SGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            S +ILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQV T L
Sbjct:  822 SRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLL 914          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 8.534e-38
Identity = 69/98 (70.41%), Postives = 83/98 (84.69%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            F + +S NILDNLLSRMEQYANNLE++V+ERT+ YLEEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT+LSAESTPMQV T L
Sbjct:  570 FNKENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLL 667          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 132.109 bits (331), Expect = 2.708e-35
Identity = 64/91 (70.33%), Postives = 76/91 (83.52%), Query Frame = 1
Query:  391 NILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             ILDNLLSRMEQYANNLE++V+ERT+ YLEEK KAE LLY +LP SVA QL + + V AE++D VTI+ SDIVGFTA+SA+STPMQV  FL
Sbjct:  260 TILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFL 350          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000957.1 (pep scaffold:Pmarinus_7.0:GL476384:418059:422325:-1 gene:ENSPMAG00000000869.1 transcript:ENSPMAT00000000957.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 1.377e-32
Identity = 56/79 (70.89%), Postives = 66/79 (83.54%), Query Frame = 1
Query:  385 SGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTA 621
            S NILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTA
Sbjct:   34 SSNILDNLLSRMEQYANNLEGLVEERTQAYLEEKRKAEALLYQILPHPVAEQLKRGEMVAAEAFDSVTIYFSDIVGFTA 112          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000956.1 (pep scaffold:Pmarinus_7.0:GL476384:418059:425928:-1 gene:ENSPMAG00000000869.1 transcript:ENSPMAT00000000956.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 8.414e-32
Identity = 57/84 (67.86%), Postives = 68/84 (80.95%), Query Frame = 1
Query:  370 FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTA 621
            F +  S NILDNLLSRMEQYANNLE +V+ERT+ YLEEK+KAE LLY +LP  VA QL + + V AE++D VTI+FSDIVGFTA
Sbjct:  108 FNKERSSNILDNLLSRMEQYANNLEGLVEERTQAYLEEKRKAEALLYQILPHPVAEQLKRGEMVAAEAFDSVTIYFSDIVGFTA 191          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 1.901e-25
Identity = 52/92 (56.52%), Postives = 68/92 (73.91%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            EG   NILDN++S++E+YAN+LE++V +RT Q   EKKK + LL S+LP  V  QL   + V  E Y+LVTIFF DIVGFTA+SA STP++V
Sbjct:  380 EGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEV 471          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 116.701 bits (291), Expect = 2.324e-29
Identity = 57/97 (58.76%), Postives = 77/97 (79.38%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            + G   NI DN+++ ME YA+NLE++V +RT+Q ++EK+K + LL S+LP+ VA QL K + V AES++ VTI+FSDIVGFT+LSAESTPMQV TFL
Sbjct:  246 KSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFL 342          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 113.62 bits (283), Expect = 8.480e-29
Identity = 53/95 (55.79%), Postives = 74/95 (77.89%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            G + NI+DN+++ M +Y + LEDIV+ERT+Q  EEK K ++LLY MLP+ +A +L K  PV+AES+  VTIFFSDIVGFT+++A+STP+QV   L
Sbjct:  195 GKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLL 289          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 113.62 bits (283), Expect = 1.967e-28
Identity = 57/107 (53.27%), Postives = 78/107 (72.90%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL--FGRIFDHTLN 693
            G   NI+DN+++ +E+YANNLE +V+ERT Q  +EK+K E+LL  MLP SVA  L+  + V AE++D V+IFFSDIVGFT+LS+ESTP+QV   L     +FD  +N
Sbjct:  270 GKQSNIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIIN 376          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 107.071 bits (266), Expect = 3.651e-26
Identity = 52/92 (56.52%), Postives = 65/92 (70.65%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            +G   +I+DN+L  ME Y   LE IV ERT Q  +EK K ++LLY MLP+ +A  L + +PV AESY  VTIFFSDIVGFT L+A STP+QV
Sbjct:  315 KGGKSSIVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQV 406          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 106.686 bits (265), Expect = 4.658e-26
Identity = 53/95 (55.79%), Postives = 69/95 (72.63%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            G S  ++D++L +M+ Y+NNLE +V+ERT Q   EK K + LLY MLP+ VA QL   + V AE +D VT+FFSDIVGFT LS+ STP+QV TFL
Sbjct:  220 GRSLRLVDSMLGKMDIYSNNLEVLVEERTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFL 314          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 137.117 bits (344), Expect = 8.500e-36
Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
Query:  379 GDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTP+QV T L
Sbjct:  744 GYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLL 838          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 135.576 bits (340), Expect = 3.446e-35
Identity = 67/96 (69.79%), Postives = 79/96 (82.29%), Query Frame = 1
Query:  376 EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
             G   NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D VTI+FSDIVGFTALSAESTP+QV T L
Sbjct:  802 RGYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLL 897          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 133.65 bits (335), Expect = 1.489e-34
Identity = 66/97 (68.04%), Postives = 84/97 (86.60%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG S +IL+NLLSRMEQYANNLE++V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTP+QV T L
Sbjct:  748 KEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLL 843          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 133.65 bits (335), Expect = 1.528e-34
Identity = 65/91 (71.43%), Postives = 78/91 (85.71%), Query Frame = 1
Query:  391 NILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            NILDNLLSRMEQYANNLE++V+ERT+ Y EEK+KAE LLY +LP SVA QL + + V AE++D V+I+FSDIVGFTALSAESTPM+V T L
Sbjct:  816 NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLL 906          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 133.265 bits (334), Expect = 1.793e-34
Identity = 66/97 (68.04%), Postives = 84/97 (86.60%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQVNTFL 663
            +EG S +IL+NLLSRMEQYANNLE++V+ERT+ YLEEK+KAE+LLY +LP SVA QL + + V AE++D VTI+FSDIVGFT++SAESTP+QV T L
Sbjct:  800 KEG-STSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLL 895          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 189.119 bits (479), Expect = 7.050e-54
Identity = 91/93 (97.85%), Postives = 93/93 (100.00%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            +EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQ+
Sbjct:  876 KEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQI 968          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 189.119 bits (479), Expect = 7.357e-54
Identity = 91/93 (97.85%), Postives = 93/93 (100.00%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            +EGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQ+
Sbjct:  883 KEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQI 975          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 164.851 bits (416), Expect = 1.991e-45
Identity = 80/93 (86.02%), Postives = 87/93 (93.55%), Query Frame = 1
Query:  373 REGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            + GD+GNILDNLLSRMEQYANNLE +V +RTEQYLEEK+KAEDLLYSMLPK VAHQLIKNQ V AESYD+VTIFFSDIVGFTALSAESTPMQ+
Sbjct:  895 KGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQI 987          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 161.77 bits (408), Expect = 2.127e-44
Identity = 77/98 (78.57%), Postives = 90/98 (91.84%), Query Frame = 1
Query:  358 LKY*FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            ++Y  + GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQV
Sbjct:  788 MRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQV 885          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 161.384 bits (407), Expect = 3.599e-44
Identity = 77/98 (78.57%), Postives = 90/98 (91.84%), Query Frame = 1
Query:  358 LKY*FREGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQV 651
            ++Y  + GDSGNILDNLLSRMEQYANNLE++V +RTEQYLEEK+K EDLLYSMLPKSVA QLI+N+ V AESY++V+I+FSDIVGFTALSAESTPMQV
Sbjct:  847 MRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQV 944          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR13.483e-3871.43natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR25.176e-3870.10natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
NPR24.962e-3770.10natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
NPR21.967e-3570.10natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2F1.986e-2452.04guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-282.853e-3462.89Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-284.230e-3462.89Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-285.065e-3462.89Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-285.232e-3462.89Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-119.639e-2957.29Receptor-type guanylate cyclase gcy-11 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG311836.527e-3769.07gene:FBgn0051183 transcript:FBtr0346151[more]
CG311836.527e-3769.07gene:FBgn0051183 transcript:FBtr0083187[more]
CG426378.961e-3263.27gene:FBgn0261360 transcript:FBtr0302277[more]
CG426378.961e-3263.27gene:FBgn0261360 transcript:FBtr0302279[more]
CG426378.961e-3263.27gene:FBgn0261360 transcript:FBtr0302278[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b1.657e-3572.53natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr1a4.514e-3570.53natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a4.514e-3570.53natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
si:dkey-37g12.14.968e-3268.48si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
npr27.086e-3269.77natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000009648.11.846e-3670.41natriuretic peptide receptor 1 [Source:NCBI gene;A... [more]
ENSXETT00000009610.11.862e-3670.41natriuretic peptide receptor 1 [Source:NCBI gene;A... [more]
ENSXETT00000009776.11.935e-3670.41natriuretic peptide receptor 1 [Source:NCBI gene;A... [more]
ENSXETT00000009544.12.395e-3670.41natriuretic peptide receptor 1 [Source:NCBI gene;A... [more]
ENSXETT00000009487.12.561e-3670.41natriuretic peptide receptor 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr13.370e-3871.43natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr29.818e-3670.10natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr21.528e-3570.10natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr23.034e-3570.10natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2f2.248e-2452.04guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16066|ANPRA_HUMAN1.673e-3771.43Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|P18910|ANPRA_RAT2.163e-3771.43Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P18293|ANPRA_MOUSE2.357e-3771.43Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P46197|ANPRB_BOVIN8.263e-3570.10Atrial natriuretic peptide receptor 2 OS=Bos tauru... [more]
sp|P20594|ANPRB_HUMAN9.444e-3570.10Atrial natriuretic peptide receptor 2 OS=Homo sapi... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VR861.275e-4375.51Guanylate cyclase domain-containing protein OS=Tri... [more]
A0A0B6YYW21.743e-4177.42Guanylate cyclase domain-containing protein (Fragm... [more]
B7QN241.935e-4076.29Guanylate cyclase (Fragment) OS=Ixodes scapularis ... [more]
A0A183RPK25.522e-4072.28Guanylate cyclase domain-containing protein OS=Sch... [more]
A0A094ZKT05.654e-4078.72Guanylate cyclase OS=Schistosoma haematobium OX=61... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b6.873e-3672.53atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a9.653e-3669.79natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a1.032e-3569.79natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.047e-3572.04atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b1.047e-3572.04atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.18.534e-3870.41pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR12.708e-3570.33natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000000957.11.377e-3270.89pep scaffold:Pmarinus_7.0:GL476384:418059:422325:-... [more]
ENSPMAT00000000956.18.414e-3267.86pep scaffold:Pmarinus_7.0:GL476384:418059:425928:-... [more]
ENSPMAT00000008986.11.901e-2556.52pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO309852.324e-2958.76Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279238.480e-2955.79Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342751.967e-2853.27Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362033.651e-2656.52Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362044.658e-2655.79Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olgc78.500e-3670.53membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc73.446e-3569.79membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
npr21.489e-3468.04natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc21.528e-3471.43membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
npr21.793e-3468.04natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010241.17.050e-5497.85SMESG000010241.1[more]
SMESG000010241.17.357e-5497.85SMESG000010241.1[more]
SMESG000056411.11.991e-4586.02SMESG000056411.1[more]
SMESG000068881.12.127e-4478.57SMESG000068881.1[more]
SMESG000068881.13.599e-4478.57SMESG000068881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034818 ID=SMED30034818|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=901bp
CAAGTGTACGGGTGTCACACAGTGTAGTGATAGGATATTTATTGATGATT
TTATAGCACAATTATATACTTTTAATAATTAATTTTCTACCAAACCGGGC
GAGGATTTTGAGTGTTTTGAACGGTTCAGGGTCCCCCTCATGCTCTAGTT
ATATTCTCAATATTGAAGTATAAGGCATAAGGCATAAATATCAAGACAAA
CATTCCCCTAAAAGAACAGAGGAATTTAACACTGTGCATCGGGCCCATAA
AGTAAAAGCAACAAGCCGCCAACAATGAAGTTGATGATGAATGATATAAA
AAGCAAAAACCCCTTGGTTCTTTGTAGACCCGTATGCAAATTGAATTGGG
ATATTAATTGAAATATTAATTCAGGGAAGGCGACAGTGGCAATATTCTGG
ATAATCTTCTTTCACGAATGGAACAGTATGCCAACAATTTGGAAGACATT
GTTCAAGAAAGAACCGAACAGTATTTGGAAGAAAAGAAAAAAGCAGAAGA
TCTTCTCTATTCAATGTTACCGAAATCGGTCGCCCACCAGTTAATTAAAA
ACCAGCCAGTAAATGCCGAGAGCTATGATCTGGTGACGATTTTCTTCAGT
GACATCGTCGGATTCACGGCTTTATCTGCCGAGTCAACCCCGATGCAAGT
AAATACATTTTTATTTGGACGTATATTTGACCATACGCTAAACCCGCAAA
CCTTCATATTAGCAGAGCAGCATTCATAATGTCCTTATATTTGGTATTAA
CATTTAAATATTGAATTCGTTACTTTGCCAAGGATGTTTCGGCGCTCAAA
TGGTCCTTAACGTTGTTCTGGAACCCAAGTTTTGAAATGACATGATCCGG
AACAATAAAGCCTTCTTTATATATTAGTGTTTTGAGACCAGAATTTCTTC
C
back to top

protein sequence of SMED30034818-orf-1

>SMED30034818-orf-1 ID=SMED30034818-orf-1|Name=SMED30034818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNA
ESYDLVTIFFSDIVGFTALSAESTPMQVNTFLFGRIFDHTLNPQTFILAE
QHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR011645HNOB_dom_associated
IPR001054A/G_cyclase
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0006182cGMP biosynthetic process
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004383guanylate cyclase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016829lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011645Haem NO binding associatedPFAMPF07701HNOBAcoord: 12..42
e-value: 1.1E-5
score: 25.0
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 49..82
e-value: 1.3E-7
score: 31.5
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 57..82
score: 10.365
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 42..92
e-value: 2.1E-9
score: 39.0
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 43..82
NoneNo IPR availablePANTHERPTHR11920:SF479ATRIAL NATRIURETIC PEPTIDE RECEPTOR 2coord: 1..82
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 1..82