Small nuclear ribonucleoprotein Sm D3

Overview
NameSmall nuclear ribonucleoprotein Sm D3
Smed IDSMED30034802
Length (bp)557
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small nuclear ribonucleoprotein Sm D3 (SMED30034802) t-SNE clustered cells

Violin plots show distribution of expression levels for Small nuclear ribonucleoprotein Sm D3 (SMED30034802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small nuclear ribonucleoprotein Sm D3 (SMED30034802) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small nuclear ribonucleoprotein Sm D3 (SMED30034802) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034802

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034802SMESG000010007.1 SmedASXL_018780SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034802SMESG000010007.1 dd_Smed_v4_562_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Match: SNRPD3 (small nuclear ribonucleoprotein D3 polypeptide [Source:HGNC Symbol;Acc:HGNC:11160])

HSP 1 Score: 136.346 bits (342), Expect = 5.273e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 136.346 bits (342), Expect = 5.273e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 136.346 bits (342), Expect = 5.273e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Match: SNRPD3 (small nuclear ribonucleoprotein D3 polypeptide [Source:HGNC Symbol;Acc:HGNC:11160])

HSP 1 Score: 135.576 bits (340), Expect = 7.098e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Match: GGT1 (gamma-glutamyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4250])

HSP 1 Score: 92.0485 bits (227), Expect = 1.967e-24
Identity = 42/61 (68.85%), Postives = 51/61 (83.61%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNV 225
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ V
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQV 61          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Celegans
Match: snr-1 (Small nuclear ribonucleoprotein Sm D3 [Source:UniProtKB/Swiss-Prot;Acc:Q17348])

HSP 1 Score: 127.102 bits (318), Expect = 1.145e-37
Identity = 60/81 (74.07%), Postives = 67/81 (82.72%), Query Frame = 1
Query:   46 SVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            SVGVPIKILHE+EGH VTLET+ GE+YRGKL EAEDNMN QL +   T R G+  QL NV+IRG+KIRF ILPDMLKNAPM
Sbjct:    3 SVGVPIKILHEAEGHMVTLETVTGEVYRGKLSEAEDNMNCQLAETVVTFRDGRSHQLDNVFIRGNKIRFMILPDMLKNAPM 83          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Celegans
Match: lsm-4 (Probable U6 snRNA-associated Sm-like protein LSm4 [Source:UniProtKB/Swiss-Prot;Acc:Q19952])

HSP 1 Score: 55.8398 bits (133), Expect = 2.642e-10
Identity = 24/72 (33.33%), Postives = 42/72 (58.33%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L   +  MN+ L D+ FT + G K  ++   Y+RGS I++  +P+
Sbjct:    3 LPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEAYVRGSTIKYLRIPE 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Celegans
Match: lsm-4 (Probable U6 snRNA-associated Sm-like protein LSm4 [Source:UniProtKB/Swiss-Prot;Acc:Q19952])

HSP 1 Score: 55.8398 bits (133), Expect = 2.642e-10
Identity = 24/72 (33.33%), Postives = 42/72 (58.33%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L   +  MN+ L D+ FT + G K  ++   Y+RGS I++  +P+
Sbjct:    3 LPLSLLKTAQNHPMLVELKNGETYNGHLKACDSWMNIHLVDVIFTSKDGDKFFKMSEAYVRGSTIKYLRIPE 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Fly
Match: SmD3 (gene:FBgn0023167 transcript:FBtr0087986)

HSP 1 Score: 134.806 bits (338), Expect = 1.629e-40
Identity = 60/82 (73.17%), Postives = 70/82 (85.37%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH +T ET+ GE+YRGKLIEAEDNMN Q+  IT T R G+ + L+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Fly
Match: CG17768 (gene:FBgn0032240 transcript:FBtr0100253)

HSP 1 Score: 54.299 bits (129), Expect = 2.077e-9
Identity = 24/72 (33.33%), Postives = 42/72 (58.33%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  +  MN+ L D+  T + G +  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Fly
Match: CG17768 (gene:FBgn0032240 transcript:FBtr0304111)

HSP 1 Score: 54.299 bits (129), Expect = 2.077e-9
Identity = 24/72 (33.33%), Postives = 42/72 (58.33%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  +  MN+ L D+  T + G +  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQSHPMLVELKNGETYNGHLVSCDSWMNINLRDVICTSKDGDRFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Fly
Match: SmD1 (gene:FBgn0261933 transcript:FBtr0075952)

HSP 1 Score: 44.2838 bits (103), Expect = 6.065e-6
Identity = 26/71 (36.62%), Postives = 38/71 (53.52%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   +  MN  L  +  T ++     L+ + IRG+ IR+FILPD L
Sbjct:    8 MKLSHE----TVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Match: snrpd3l (small nuclear ribonucleoprotein D3 polypeptide, like [Source:ZFIN;Acc:ZDB-GENE-030131-5219])

HSP 1 Score: 136.732 bits (343), Expect = 2.160e-41
Identity = 63/82 (76.83%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+VSQL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVSQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Match: snrpd3l (small nuclear ribonucleoprotein D3 polypeptide, like [Source:ZFIN;Acc:ZDB-GENE-030131-5219])

HSP 1 Score: 136.732 bits (343), Expect = 2.160e-41
Identity = 63/82 (76.83%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+VSQL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVSQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Match: snrpd3 (small nuclear ribonucleoprotein D3 polypeptide [Source:ZFIN;Acc:ZDB-GENE-040625-55])

HSP 1 Score: 135.961 bits (341), Expect = 4.299e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMANITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 135.961 bits (341), Expect = 4.299e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMANITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Match: snrpd3 (small nuclear ribonucleoprotein D3 polypeptide [Source:ZFIN;Acc:ZDB-GENE-040625-55])

HSP 1 Score: 135.961 bits (341), Expect = 4.299e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMANITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Match: snrpd3 (small nuclear ribonucleoprotein D3 polypeptide [Source:NCBI gene;Acc:549847])

HSP 1 Score: 136.346 bits (342), Expect = 4.780e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Match: nenf (Xenopus tropicalis LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated (lsm4), mRNA. [Source:RefSeq mRNA;Acc:NM_204040])

HSP 1 Score: 55.4546 bits (132), Expect = 7.016e-9
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L ++  T R G K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:447999])

HSP 1 Score: 47.3654 bits (111), Expect = 7.289e-7
Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   + +MN  L  +  T ++ +  QL+ + IRG+ IR+FILPD L
Sbjct:    8 MKLSHE----TVTVELKNGTQVHGTITGVDVSMNTHLKAVKMTVKNREPVQLETLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:447999])

HSP 1 Score: 47.3654 bits (111), Expect = 8.181e-7
Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   + +MN  L  +  T ++ +  QL+ + IRG+ IR+FILPD L
Sbjct:    8 MKLSHE----TVTVELKNGTQVHGTITGVDVSMNTHLKAVKMTVKNREPVQLETLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:447999])

HSP 1 Score: 46.9802 bits (110), Expect = 1.595e-6
Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   + +MN  L  +  T ++ +  QL+ + IRG+ IR+FILPD L
Sbjct:    8 MKLSHE----TVTVELKNGTQVHGTITGVDVSMNTHLKAVKMTVKNREPVQLETLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Match: Snrpd3 (small nuclear ribonucleoprotein D3 [Source:MGI Symbol;Acc:MGI:1914582])

HSP 1 Score: 136.346 bits (342), Expect = 3.620e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Match: Snrpd3 (small nuclear ribonucleoprotein D3 [Source:MGI Symbol;Acc:MGI:1914582])

HSP 1 Score: 90.8929 bits (224), Expect = 5.253e-24
Identity = 42/72 (58.33%), Postives = 54/72 (75.00%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFI 258
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+     G  + + +
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQWPHEGEDVGWDV 72          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Match: Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:MGI Symbol;Acc:MGI:1354692])

HSP 1 Score: 55.8398 bits (133), Expect = 6.563e-10
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L ++  T R G K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Match: Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:MGI Symbol;Acc:MGI:1354692])

HSP 1 Score: 55.8398 bits (133), Expect = 6.563e-10
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L ++  T R G K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Match: Lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:MGI Symbol;Acc:MGI:1354692])

HSP 1 Score: 47.7506 bits (112), Expect = 2.927e-7
Identity = 22/71 (30.99%), Postives = 39/71 (54.93%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L      +   K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINL-----REDGDKFWRMPECYIRGSTIKYLRIPD 67          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Match: sp|P62323|SMD3_XENLA (Small nuclear ribonucleoprotein Sm D3 OS=Xenopus laevis OX=8355 GN=snrpd3 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.532e-40
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Match: sp|P62320|SMD3_MOUSE (Small nuclear ribonucleoprotein Sm D3 OS=Mus musculus OX=10090 GN=Snrpd3 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.532e-40
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Match: sp|P62318|SMD3_HUMAN (Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.532e-40
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Match: sp|O44437|SMD3_DROME (Small nuclear ribonucleoprotein Sm D3 OS=Drosophila melanogaster OX=7227 GN=SmD3 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.633e-39
Identity = 60/82 (73.17%), Postives = 70/82 (85.37%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH +T ET+ GE+YRGKLIEAEDNMN Q+  IT T R G+ + L+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Match: sp|Q17348|SMD3_CAEEL (Small nuclear ribonucleoprotein Sm D3 OS=Caenorhabditis elegans OX=6239 GN=snr-1 PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.457e-36
Identity = 60/81 (74.07%), Postives = 67/81 (82.72%), Query Frame = 1
Query:   46 SVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            SVGVPIKILHE+EGH VTLET+ GE+YRGKL EAEDNMN QL +   T R G+  QL NV+IRG+KIRF ILPDMLKNAPM
Sbjct:    3 SVGVPIKILHEAEGHMVTLETVTGEVYRGKLSEAEDNMNCQLAETVVTFRDGRSHQLDNVFIRGNKIRFMILPDMLKNAPM 83          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Match: A7RM92 (Small nuclear ribonucleoprotein Sm D3 OS=Nematostella vectensis OX=45351 GN=v1g86522 PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 7.413e-41
Identity = 64/82 (78.05%), Postives = 74/82 (90.24%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIKILHE+EGH +TLETLNGE+YRGKLIEAEDNMN Q+ +IT T R G+VSQL+ V++RGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKILHEAEGHVITLETLNGEVYRGKLIEAEDNMNCQMSNITVTARDGRVSQLEQVFVRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Match: A0A131XFX2 (Small nuclear ribonucleoprotein Sm D3 OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.006e-40
Identity = 63/82 (76.83%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKL+EAEDNMN Q+C+IT T R G+V+QL+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLVEAEDNMNCQMCNITVTYRDGRVAQLENVYIRGSKIRFMILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Match: A0A224Z8Q6 (Small nuclear ribonucleoprotein Sm D3 OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.006e-40
Identity = 63/82 (76.83%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKL+EAEDNMN Q+C+IT T R G+V+QL+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLVEAEDNMNCQMCNITVTYRDGRVAQLENVYIRGSKIRFMILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Match: A0A131YTB5 (Small nuclear ribonucleoprotein Sm D3 OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.006e-40
Identity = 63/82 (76.83%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKL+EAEDNMN Q+C+IT T R G+V+QL+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLVEAEDNMNCQMCNITVTYRDGRVAQLENVYIRGSKIRFMILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Match: L7M666 (Small nuclear ribonucleoprotein Sm D3 OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.006e-40
Identity = 63/82 (76.83%), Postives = 73/82 (89.02%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKL+EAEDNMN Q+C+IT T R G+V+QL+NVYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLVEAEDNMNCQMCNITVTYRDGRVAQLENVYIRGSKIRFMILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Match: snrpd3l (small nuclear ribonucleoprotein D3 polypeptide [Source:NCBI gene;Acc:103046811])

HSP 1 Score: 136.346 bits (342), Expect = 2.709e-41
Identity = 63/82 (76.83%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+VSQL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVSQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Match: lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:103043545])

HSP 1 Score: 55.0694 bits (131), Expect = 1.042e-9
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L ++  T R G K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:103035501])

HSP 1 Score: 48.9062 bits (115), Expect = 1.416e-7
Identity = 27/71 (38.03%), Postives = 43/71 (60.56%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   + +MN  L  +  T ++ + +QL+++ IRG+ IR+FILPD L
Sbjct:    8 MKLSHE----TVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPTQLESLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:103035501])

HSP 1 Score: 48.1358 bits (113), Expect = 2.590e-7
Identity = 25/71 (35.21%), Postives = 42/71 (59.15%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            ++ L +    TVT+E  NG    G +   + +MN  L  +  T ++ + +QL+++ IRG+ IR+FILPD L
Sbjct:    4 VRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPTQLESLSIRGNNIRYFILPDSL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Match: oscp1a (LSM10, U7 small nuclear RNA associated [Source:NCBI gene;Acc:103027130])

HSP 1 Score: 45.4394 bits (106), Expect = 2.273e-6
Identity = 18/69 (26.09%), Postives = 40/69 (57.97%), Query Frame = 1
Query:   67 ILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +L    G   T++  +    RG+++  +  MN++L  + + DR G+VS++ +++I G  +R+  +PD +
Sbjct:   19 LLQGLHGQVTTVDLRDESTARGRVVNVDAFMNIRLEKVLYRDRKGRVSEMADLFITGRNVRYVHIPDHM 87          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Yeast
Match: SMD3 (Core Sm protein Sm D3; part of heteroheptameric complex (with Smb1p, Smd1p, Smd2p, Sme1p, Smx3p, and Smx2p) that is part of the spliceosomal U1, U2, U4, and U5 snRNPs; homolog of human Sm D3 [Source:SGD;Acc:S000004137])

HSP 1 Score: 101.293 bits (251), Expect = 9.849e-29
Identity = 40/79 (50.63%), Postives = 63/79 (79.75%), Query Frame = 1
Query:   52 GVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            G+P+K+L+E++GH V+LE   G  YRGKL+E+ED+MNVQL D+  T+  G V+ +  +++RGS+I+F ++PD+LKNAP+
Sbjct:    5 GIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPL 83          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Nematostella
Match: EDO47464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM92])

HSP 1 Score: 143.28 bits (360), Expect = 1.025e-44
Identity = 64/82 (78.05%), Postives = 74/82 (90.24%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIKILHE+EGH +TLETLNGE+YRGKLIEAEDNMN Q+ +IT T R G+VSQL+ V++RGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKILHEAEGHVITLETLNGEVYRGKLIEAEDNMNCQMSNITVTARDGRVSQLEQVFVRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Nematostella
Match: EDO45138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS4])

HSP 1 Score: 54.6842 bits (130), Expect = 5.395e-10
Identity = 24/72 (33.33%), Postives = 42/72 (58.33%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  +  MN+ L ++  T R G K  ++   Y+RGS I++  +PD
Sbjct:    3 LPLSLLRTAQNHPMLVELKNGETYNGHLVSCDTWMNINLREVICTSRDGDKFWKIPECYVRGSNIKYLRIPD 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Nematostella
Match: EDO27563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8X0])

HSP 1 Score: 47.3654 bits (111), Expect = 1.988e-7
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG +  G +   + +MN  L  +  T ++ +  QL+++ IRG+ IR+FILP+ L
Sbjct:    8 MKLSHE----TVTIELKNGTVIHGTITGVDMSMNTHLKTVKMTVKNREPMQLESLSIRGNNIRYFILPESL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Nematostella
Match: EDO35984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ4])

HSP 1 Score: 46.9802 bits (110), Expect = 2.719e-7
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG +  G +   + +MN  L  +  T ++ +  QL+++ IRG+ IR+FILP+ L
Sbjct:    8 MKLSHE----TVTIELKNGTVIHGTITGVDMSMNTHLKTVKMTVKNREPMQLESLSIRGNNIRYFILPESL 74          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Match: snrpd3l (small nuclear ribonucleoprotein D3 polypeptide [Source:NCBI gene;Acc:101173956])

HSP 1 Score: 136.346 bits (342), Expect = 2.912e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Match: snrpd3l (small nuclear ribonucleoprotein D3 polypeptide [Source:NCBI gene;Acc:101173956])

HSP 1 Score: 136.346 bits (342), Expect = 2.912e-41
Identity = 62/82 (75.61%), Postives = 71/82 (86.59%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPM 288
            MS+GVPIK+LHE+EGH VT ET  GE+YRGKLIEAEDNMN Q+ +IT T R G+V+QL+ VYIRGSKIRF ILPDMLKNAPM
Sbjct:    1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPM 82          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Match: lsm4 (LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:NCBI gene;Acc:101168448])

HSP 1 Score: 55.0694 bits (131), Expect = 1.229e-9
Identity = 25/72 (34.72%), Postives = 43/72 (59.72%), Query Frame = 1
Query:   55 VPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSG-KVSQLQNVYIRGSKIRFFILPD 267
            +P+ +L  ++ H + +E  NGE Y G L+  ++ MN+ L ++  T R G K  ++   YIRGS I++  +PD
Sbjct:    2 LPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPD 73          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Match: snrpd1 (small nuclear ribonucleoprotein D1 polypeptide [Source:NCBI gene;Acc:101162381])

HSP 1 Score: 48.9062 bits (115), Expect = 9.488e-8
Identity = 27/71 (38.03%), Postives = 43/71 (60.56%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDML 273
            +K+ HE    TVT+E  NG    G +   + +MN  L  +  T ++ + +QL+++ IRG+ IR+FILPD L
Sbjct:    1 MKLSHE----TVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPTQLESLSIRGNNIRYFILPDSL 67          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Match: LSM10 (organic solute carrier partner 1a [Source:ZFIN;Acc:ZDB-GENE-080204-2])

HSP 1 Score: 48.521 bits (114), Expect = 1.965e-7
Identity = 21/69 (30.43%), Postives = 41/69 (59.42%), Query Frame = 1
Query:   61 IKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPD 267
            + +L   +G   T++  +    RG ++  +  MN++L D+ F DR G+ +QLQ+++I G  +R+  +PD
Sbjct:   17 VVLLQGLQGEVTTVDLRDESSARGLVLNVDAFMNIRLKDVLFLDRRGQTAQLQDLFITGRNVRYVHIPD 85          
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Planmine SMEST
Match: SMESG000010007.1 (SMESG000010007.1)

HSP 1 Score: 189.119 bits (479), Expect = 3.018e-62
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 1
Query:   43 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPMXXXXXXXXXXXXXXXXXXXXXXXXXXXNFRAPVSRGRGFR 408
            MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPMLKRATGTKGLGTGRGKTTMLLRGRGRGNFRAPVSRGRGFR
Sbjct:    1 MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTDRSGKVSQLQNVYIRGSKIRFFILPDMLKNAPMLKRATGTKGLGTGRGKTTMLLRGRGRGNFRAPVSRGRGFR 122          
The following BLAST results are available for this feature:
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNRPD35.273e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
GGT15.273e-4175.61gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
GGT15.273e-4175.61gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
SNRPD37.098e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
GGT11.967e-2468.85gamma-glutamyltransferase 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snr-11.145e-3774.07Small nuclear ribonucleoprotein Sm D3 [Source:Uni... [more]
lsm-42.642e-1033.33Probable U6 snRNA-associated Sm-like protein LSm4 ... [more]
lsm-42.642e-1033.33Probable U6 snRNA-associated Sm-like protein LSm4 ... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SmD31.629e-4073.17gene:FBgn0023167 transcript:FBtr0087986[more]
CG177682.077e-933.33gene:FBgn0032240 transcript:FBtr0100253[more]
CG177682.077e-933.33gene:FBgn0032240 transcript:FBtr0304111[more]
SmD16.065e-636.62gene:FBgn0261933 transcript:FBtr0075952[more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpd3l2.160e-4176.83small nuclear ribonucleoprotein D3 polypeptide, li... [more]
snrpd3l2.160e-4176.83small nuclear ribonucleoprotein D3 polypeptide, li... [more]
snrpd34.299e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
p2rx4b4.299e-4175.61purinergic receptor P2X, ligand-gated ion channel,... [more]
snrpd34.299e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpd34.780e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
nenf7.016e-934.72Xenopus tropicalis LSM4 homolog, U6 small nuclear ... [more]
snrpd17.289e-738.03small nuclear ribonucleoprotein D1 polypeptide [So... [more]
snrpd18.181e-738.03small nuclear ribonucleoprotein D1 polypeptide [So... [more]
snrpd11.595e-638.03small nuclear ribonucleoprotein D1 polypeptide [So... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snrpd33.620e-4175.61small nuclear ribonucleoprotein D3 [Source:MGI Sym... [more]
Snrpd35.253e-2458.33small nuclear ribonucleoprotein D3 [Source:MGI Sym... [more]
Lsm46.563e-1034.72LSM4 homolog, U6 small nuclear RNA and mRNA degrad... [more]
Lsm46.563e-1034.72LSM4 homolog, U6 small nuclear RNA and mRNA degrad... [more]
Lsm42.927e-730.99LSM4 homolog, U6 small nuclear RNA and mRNA degrad... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62323|SMD3_XENLA2.532e-4075.61Small nuclear ribonucleoprotein Sm D3 OS=Xenopus l... [more]
sp|P62320|SMD3_MOUSE2.532e-4075.61Small nuclear ribonucleoprotein Sm D3 OS=Mus muscu... [more]
sp|P62318|SMD3_HUMAN2.532e-4075.61Small nuclear ribonucleoprotein Sm D3 OS=Homo sapi... [more]
sp|O44437|SMD3_DROME1.633e-3973.17Small nuclear ribonucleoprotein Sm D3 OS=Drosophil... [more]
sp|Q17348|SMD3_CAEEL1.457e-3674.07Small nuclear ribonucleoprotein Sm D3 OS=Caenorhab... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RM927.413e-4178.05Small nuclear ribonucleoprotein Sm D3 OS=Nematoste... [more]
A0A131XFX24.006e-4076.83Small nuclear ribonucleoprotein Sm D3 OS=Hyalomma ... [more]
A0A224Z8Q64.006e-4076.83Small nuclear ribonucleoprotein Sm D3 OS=Rhipiceph... [more]
A0A131YTB54.006e-4076.83Small nuclear ribonucleoprotein Sm D3 OS=Rhipiceph... [more]
L7M6664.006e-4076.83Small nuclear ribonucleoprotein Sm D3 OS=Rhipiceph... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpd3l2.709e-4176.83small nuclear ribonucleoprotein D3 polypeptide [So... [more]
lsm41.042e-934.72LSM4 homolog, U6 small nuclear RNA and mRNA degrad... [more]
snrpd11.416e-738.03small nuclear ribonucleoprotein D1 polypeptide [So... [more]
snrpd12.590e-735.21small nuclear ribonucleoprotein D1 polypeptide [So... [more]
oscp1a2.273e-626.09LSM10, U7 small nuclear RNA associated [Source:NCB... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SMD39.849e-2950.63Core Sm protein Sm D3; part of heteroheptameric co... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO474641.025e-4478.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451385.395e-1033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275631.988e-736.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359842.719e-736.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snrpd3l2.912e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
snrpd3l2.912e-4175.61small nuclear ribonucleoprotein D3 polypeptide [So... [more]
lsm41.229e-934.72LSM4 homolog, U6 small nuclear RNA and mRNA degrad... [more]
snrpd19.488e-838.03small nuclear ribonucleoprotein D1 polypeptide [So... [more]
LSM101.965e-730.43organic solute carrier partner 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of Small nuclear ribonucleoprotein Sm D3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010007.13.018e-62100.00SMESG000010007.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034802 ID=SMED30034802|Name=Small nuclear ribonucleoprotein Sm D3|organism=Schmidtea mediterranea sexual|type=transcript|length=557bp
CCTTGTTTAAATATATATCAAATTTAAAAAAATACTTTCGTTATGTCTGT
CGGTGTTCCAATTAAAATATTACATGAATCAGAAGGCCATACTGTTACAC
TGGAAACTTTAAATGGTGAATTATACCGTGGAAAATTAATCGAAGCAGAA
GATAATATGAATGTCCAATTATGTGATATCACATTCACTGATAGATCTGG
AAAAGTTAGTCAACTGCAGAATGTCTATATTCGGGGAAGTAAAATTAGAT
TTTTTATTCTACCTGACATGTTGAAAAATGCTCCAATGCTCAAACGAGCA
ACTGGTACGAAAGGTCTTGGAACCGGCAGAGGAAAAACAACAATGCTTTT
GCGTGGAAGAGGCAGAGGAAACTTTCGGGCTCCTGTATCCAGAGGAAGAG
GATTTCGTTAAATGTTAATAAAATCTAGTTGTATTATTAAGTCTTTTGTT
GTTTATCAAAGTTGTAAAATATTAATACAACTAAATTGACGTGTAATATT
GTTTGGCAAATATGTTAATTGTCAATAAACTTAAGTAGTTGTTAAAGTTT
TCAGTTG
back to top

protein sequence of SMED30034802-orf-1

>SMED30034802-orf-1 ID=SMED30034802-orf-1|Name=SMED30034802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MSVGVPIKILHESEGHTVTLETLNGELYRGKLIEAEDNMNVQLCDITFTD
RSGKVSQLQNVYIRGSKIRFFILPDMLKNAPMLKRATGTKGLGTGRGKTT
MLLRGRGRGNFRAPVSRGRGFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027141LSm4/Sm_D1/D3
IPR034099SmD3
IPR001163LSM_dom_euk/arc
IPR010920LSM_dom_sf
Vocabulary: biological process
TermDefinition
GO:0000387spliceosomal snRNP assembly
GO:0006396RNA processing
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0071208histone pre-mRNA DCP binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005685U1 snRNP
GO:0005687U4 snRNP
GO:0005737cytoplasm
GO:0005829cytosol
GO:0030529intracellular ribonucleoprotein complex
GO:0034709methylosome
GO:0034715pICln-Sm protein complex
GO:0034719SMN-Sm protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001163LSM domain, eukaryotic/archaea-typeSMARTSM00651Sm3coord: 8..73
e-value: 5.3E-14
score: 62.5
IPR001163LSM domain, eukaryotic/archaea-typePFAMPF01423LSMcoord: 9..72
e-value: 2.7E-15
score: 55.8
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 1..84
e-value: 4.6E-32
score: 111.3
NoneNo IPR availablePANTHERPTHR23338:SF17SMALL NUCLEAR RIBONUCLEOPROTEIN SM D3coord: 1..102
IPR027141Like-Sm (LSM) domain containing protein, LSm4/SmD1/SmD3PANTHERPTHR23338SMALL NUCLEAR RIBONUCLEOPROTEIN SMcoord: 1..102
IPR034099Small nuclear ribonucleoprotein Sm D3CDDcd01721Sm_D3coord: 6..75
e-value: 1.44856E-44
score: 137.652
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 6..113