SMED30034801

Overview
NameSMED30034801
Smed IDSMED30034801
Length (bp)2242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034801 (SMED30034801) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034801 (SMED30034801) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034801 (SMED30034801) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034801 (SMED30034801) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034801

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30034801SMESG000051345.1 SmedASXL_019569SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30034801SMESG000051345.1 dd_Smed_v4_4605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034801SMESG000051345.1 dd_Smed_v4_4605_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034801SMESG000051345.1 Contig32592newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034801SMESG000051345.1 Contig32592uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30034801 vs. Ensembl Human
Match: RSBN1L (round spermatid basic protein 1 like [Source:HGNC Symbol;Acc:HGNC:24765])

HSP 1 Score: 308.916 bits (790), Expect = 3.120e-95
Identity = 159/374 (42.51%), Postives = 224/374 (59.89%), Query Frame = -3
Query:  702 NLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1823
            NL +L+  ++  + +++E   NGG  ++HAY +ELS L   ++E F   +   +F E +N+     + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH      +    R+ KDV+CF    + ++++R++LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L DNDIYFIPRNVVHQFKT+SAV S+AWH+RL+ Y+
Sbjct:   66 NLKRLDTLEF-KQLIHIEHQPNGGASVIHAYSNELSHLSPMEMERFAEEFVGLVFSENENSA----AFYVMGIVHGAATYLPDFLDYFSFNFPNSPVKMEILG-KKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKCTLPWGTLSSLKLQSRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVHCGEWPDQP---RITKDVICFHAEDFLEVVQRMQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHIRLKLYH 424          
BLAST of SMED30034801 vs. Ensembl Human
Match: RSBN1 (round spermatid basic protein 1 [Source:HGNC Symbol;Acc:HGNC:25642])

HSP 1 Score: 308.916 bits (790), Expect = 3.994e-94
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  223 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 590          
BLAST of SMED30034801 vs. Ensembl Human
Match: RSBN1 (round spermatid basic protein 1 [Source:HGNC Symbol;Acc:HGNC:25642])

HSP 1 Score: 308.916 bits (790), Expect = 1.983e-93
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  292 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 659          
BLAST of SMED30034801 vs. Ensembl Human
Match: RSBN1L (round spermatid basic protein 1 like [Source:HGNC Symbol;Acc:HGNC:24765])

HSP 1 Score: 310.457 bits (794), Expect = 3.792e-93
Identity = 159/374 (42.51%), Postives = 223/374 (59.63%), Query Frame = -3
Query:  702 NLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1823
            NL +L+  ++  + +++E   NGG  ++HAY +ELS L   ++E F   +   +F E +N+     + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH           R+ KDV+CF    + ++++R++LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L DNDIYFIPRNVVHQFKT+SAV S+AWH+RL+ Y+
Sbjct:  336 NLKRLDTLEF-KQLIHIEHQPNGGASVIHAYSNELSHLSPMEMERFAEEFVGLVFSENENS----AAFYVMGIVHGAATYLPDFLDYFSFNFPNSPVKMEILG-KKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKCTLPWGTLSSLKLQSRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVH---CGEWPDQPRITKDVICFHAEDFLEVVQRMQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHIRLKLYH 694          
BLAST of SMED30034801 vs. Ensembl Human
Match: RSBN1 (round spermatid basic protein 1 [Source:HGNC Symbol;Acc:HGNC:25642])

HSP 1 Score: 308.916 bits (790), Expect = 6.932e-93
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  340 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 707          
BLAST of SMED30034801 vs. Ensembl Celegans
Match: dpy-21 (Lysine-specific demethylase 9 [Source:UniProtKB/Swiss-Prot;Acc:Q9GRZ3])

HSP 1 Score: 241.891 bits (616), Expect = 5.221e-67
Identity = 138/401 (34.41%), Postives = 210/401 (52.37%), Query Frame = -3
Query:  696 KYMYVEKYENGGGYILHAYQDELSQ-LDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDR--------------------------------HTTAAVGVLKAVHPPNTKSKNGNY----RVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1787
            K++ + ++ NG   I+    +++ Q L  ++++ F  ++ +  F E   NN  P  L+ IG++  +A  L D   +LA    N  VK   +  K  ++T+ + +Y ++  +    G FR+GPL S+S+VGTK EE GG FK+++  L   PFL  +MPWG  S++ G+    S+DGPI W+R GEQ VP+    +  +                 P   RG   R+TA NDRT+ HAD   +  +                                  +TAAVGVL+ +  P+    +  Y    + VK+V+ FD      +   L +D+ EPP SQC + W DDA LN +R EG R+ ++ L +ND+YF+PRNV+HQF+T+SA SSVAWHVRLR YY +
Sbjct: 1236 KFVRIRRHPNGMATIISCDYNQIKQHLGPNEMKHFERQFVRLGFAE---NNGVP--LFAIGVMENAAEALHDQFEWLAKNSPNTQVKVGSLTNKQFIETMPMKKYYESAMETLDMGTFRFGPLMSLSMVGTKNEEAGGNFKEMLDALNAAPFLGPIMPWGDFSEVQGIKEDTSDDGPIFWVRPGEQMVPTDGKNRSTEPRH--------------PLATRGNDRRETAFNDRTNAHADQVRESTEDDPTTTTTTTTTTSSSSSSSKSKKSAKSDPTFVKSTAAVGVLQGIRNPDANDDDEYYEDERKAVKEVIVFDAHDLHKVAHHLAMDLYEPPVSQC-HRWVDDAILNTMRREGIRYAKLELHENDMYFLPRNVIHQFRTVSACSSVAWHVRLRHYYDV 1616          
BLAST of SMED30034801 vs. Ensembl Fly
Match: CG10600 (gene:FBgn0032717 transcript:FBtr0331194)

HSP 1 Score: 336.65 bits (862), Expect = 8.440e-100
Identity = 169/361 (46.81%), Postives = 231/361 (63.99%), Query Frame = -3
Query:  702 YMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1784
            Y  VE+Y NGG  I+H YQ E+  L   ++E  V+ +F+  F E +      Y+ + +GI+H +AR LPDLL ++A+ Y  L VK  ++   +D++T T+ +Y + V +NY  G FRYGPLH +SLVG   EE GGYF D++  +E NPFL++ MPW   S L    P  SNDGPILWIR GEQ VP++    K  +       N    + NL    R    R+T + DRT  HADH   G +R TTAAVG+LKAVH   T S+N   R+ KDVV F  + +  +++ L+LD+ EPP SQC   W +DA+LNQLR EG R+ R+ L DNDIYF+PRN++HQF+T++AV+SVAWH+RLR+YY
Sbjct:  508 YFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQG----YAHHVMGIVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQISLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQ-TDPRQSNDGPILWIRAGEQLVPTAELNSKTPLKRQRTRINE---LRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHCGQTYSQN---RITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQ-WIEDAKLNQLRREGVRYARIQLCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYY 856          
BLAST of SMED30034801 vs. Ensembl Fly
Match: CG10600 (gene:FBgn0032717 transcript:FBtr0081120)

HSP 1 Score: 336.65 bits (862), Expect = 9.034e-100
Identity = 169/361 (46.81%), Postives = 231/361 (63.99%), Query Frame = -3
Query:  702 YMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1784
            Y  VE+Y NGG  I+H YQ E+  L   ++E  V+ +F+  F E +      Y+ + +GI+H +AR LPDLL ++A+ Y  L VK  ++   +D++T T+ +Y + V +NY  G FRYGPLH +SLVG   EE GGYF D++  +E NPFL++ MPW   S L    P  SNDGPILWIR GEQ VP++    K  +       N    + NL    R    R+T + DRT  HADH   G +R TTAAVG+LKAVH   T S+N   R+ KDVV F  + +  +++ L+LD+ EPP SQC   W +DA+LNQLR EG R+ R+ L DNDIYF+PRN++HQF+T++AV+SVAWH+RLR+YY
Sbjct:  509 YFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQG----YAHHVMGIVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQISLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQ-TDPRQSNDGPILWIRAGEQLVPTAELNSKTPLKRQRTRINE---LRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHCGQTYSQN---RITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQ-WIEDAKLNQLRREGVRYARIQLCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYY 857          
BLAST of SMED30034801 vs. Ensembl Fly
Match: CG10600 (gene:FBgn0032717 transcript:FBtr0273228)

HSP 1 Score: 336.65 bits (862), Expect = 9.683e-100
Identity = 169/361 (46.81%), Postives = 231/361 (63.99%), Query Frame = -3
Query:  702 YMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1784
            Y  VE+Y NGG  I+H YQ E+  L   ++E  V+ +F+  F E +      Y+ + +GI+H +AR LPDLL ++A+ Y  L VK  ++   +D++T T+ +Y + V +NY  G FRYGPLH +SLVG   EE GGYF D++  +E NPFL++ MPW   S L    P  SNDGPILWIR GEQ VP++    K  +       N    + NL    R    R+T + DRT  HADH   G +R TTAAVG+LKAVH   T S+N   R+ KDVV F  + +  +++ L+LD+ EPP SQC   W +DA+LNQLR EG R+ R+ L DNDIYF+PRN++HQF+T++AV+SVAWH+RLR+YY
Sbjct:  538 YFQVEQYPNGGASIVHLYQHEIDALSPDEMEELVDEFFEVCFAEDEQG----YAHHVMGIVHDAARYLPDLLEHMAENYSTLTVKAGVLGRNSDIETCTMSQYNEQVVRNYCQGTFRYGPLHQISLVGKVHEEVGGYFPDLLGRIEMNPFLRKTMPWACNSILQ-TDPRQSNDGPILWIRAGEQLVPTAELNSKTPLKRQRTRINE---LRNLQYLPRLSEARETMIEDRTKAHADHVGHGHERITTAAVGILKAVHCGQTYSQN---RITKDVVAFAAQDFNTMVEMLQLDLHEPPISQCVQ-WIEDAKLNQLRREGVRYARIQLCDNDIYFLPRNIIHQFRTVTAVTSVAWHLRLRQYY 886          
BLAST of SMED30034801 vs. Ensembl Zebrafish
Match: RSBN1 (round spermatid basic protein 1-like [Source:NCBI gene;Acc:100330644])

HSP 1 Score: 301.982 bits (772), Expect = 1.510e-93
Identity = 166/424 (39.15%), Postives = 233/424 (54.95%), Query Frame = -3
Query:  702 NTNCSNGSLSNNSTPVKGTQKSNKHNLSSSIFNHDSESKR---IHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1964
             T CS  +   +  PV       + +L    ++   E+K+    H +  +  + L       + ++ EK  NGG  +LHAY DELS L   + E F   + K  F E         + Y + ++HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G +F + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ VP++   K         +      I NL    R    R+    DRT  HADH     D  +TAAVGVLKAVH       +   R+ KDVVCF    + D+++RL+LD+ EPP SQC   W DDA+LNQLR EG R++R+ L D+DIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+
Sbjct:  111 QTVCSGDTPPLSEDPVGHAYIKEEKDLGE--YDAPKEAKKPFLTHQDHYIRSSWLQTNTCFSRLIHEEKQPNGGASVLHAYADELSLLRPGETEKFAQEFMKLAFAEQPKGA----ARYALAVVHGAAAYLPDFLDYFAFNFPNTPVKVEILG-KKDIETTTIANFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDFFPEFLDMLEESPFLKMTLPWGSLSSLKLDCRSQSDDGPIMWVRPGEQMVPTADMPKSPFKRRRSMNE-----IKNLHYLPRASEPREVLFEDRTRAHADHVGQSFDWQSTAAVGVLKAVH---FGEWSDQPRITKDVVCFHAEDFNDVVQRLQLDLYEPPVSQCVQ-WVDDAKLNQLRREGIRYVRMQLCDDDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYH 518          
BLAST of SMED30034801 vs. Ensembl Zebrafish
Match: RSBN1 (round spermatid basic protein 1-like [Source:NCBI gene;Acc:100330644])

HSP 1 Score: 304.294 bits (778), Expect = 2.587e-92
Identity = 166/424 (39.15%), Postives = 233/424 (54.95%), Query Frame = -3
Query:  702 NTNCSNGSLSNNSTPVKGTQKSNKHNLSSSIFNHDSESKR---IHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1964
             T CS  +   +  PV       + +L    ++   E+K+    H +  +  + L       + ++ EK  NGG  +LHAY DELS L   + E F   + K  F E         + Y + ++HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G +F + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ VP++   K         +      I NL    R    R+    DRT  HADH     D  +TAAVGVLKAVH       +   R+ KDVVCF    + D+++RL+LD+ EPP SQC   W DDA+LNQLR EG R++R+ L D+DIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+
Sbjct:  227 QTVCSGDTPPLSEDPVGHAYIKEEKDLGE--YDAPKEAKKPFLTHQDHYIRSSWLQTNTCFSRLIHEEKQPNGGASVLHAYADELSLLRPGETEKFAQEFMKLAFAEQPKGA----ARYALAVVHGAAAYLPDFLDYFAFNFPNTPVKVEILG-KKDIETTTIANFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDFFPEFLDMLEESPFLKMTLPWGSLSSLKLDCRSQSDDGPIMWVRPGEQMVPTADMPKSPFKRRRSMNE-----IKNLHYLPRASEPREVLFEDRTRAHADHVGQSFDWQSTAAVGVLKAVH---FGEWSDQPRITKDVVCFHAEDFNDVVQRLQLDLYEPPVSQCVQ-WVDDAKLNQLRREGIRYVRMQLCDDDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYH 634          
BLAST of SMED30034801 vs. Ensembl Xenopus
Match: rsbn1l (round spermatid basic protein 1 like [Source:NCBI gene;Acc:550058])

HSP 1 Score: 309.301 bits (791), Expect = 2.513e-93
Identity = 157/360 (43.61%), Postives = 215/360 (59.72%), Query Frame = -3
Query:  702 MYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1781
            +++E   NGG  ++HAY  ELSQL   ++E F   +   +F E +N      + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R G +  +SLVG   EE G YF + +  LE +PFLK+ +PWG  S L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH       N N R+ KDV+CF    + ++++RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L D+DIYFIPRNVVHQFKT+SAV S+AWH+RL+ Y+
Sbjct:  296 IHIEHQPNGGASLIHAYSSELSQLSPVEMERFSEEFVTLVFSENENCA----AFYVMGIVHGAATYLPDFLDYFSFNFPNSPVKMEILG-KKDIETTTISNFHAQVKRTYSHGTYRAGAMRQISLVGAVDEEVGDYFPEFLDMLETSPFLKRTLPWGTCSSLQLKSRKESDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRASEPREMLFEDRTRAHADHIGQGFERETTAAVGVLKAVH---CVEWNENPRITKDVICFHAEDFLEVVQRLQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDDDIYFIPRNVVHQFKTVSAVCSLAWHIRLKMYH 641          
BLAST of SMED30034801 vs. Ensembl Xenopus
Match: rsbn1 (round spermatid basic protein 1 [Source:NCBI gene;Acc:100127593])

HSP 1 Score: 302.753 bits (774), Expect = 8.728e-92
Identity = 155/379 (40.90%), Postives = 218/379 (57.52%), Query Frame = -3
Query:  705 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRY 1841
            H E  +  N L+      + M+ E   NGG  +LHAY DELS L   ++E F   + +  F    N N+   + Y + ++HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G +F + +  LE +PFLK  +PWG +S L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    ++ +++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y
Sbjct:  251 HQEHCIRTNTLDRGSKFSRLMHEENQSNGGAPVLHAYMDELSFLSPVEMERFAEEFLERTF----NENDKSAAYYALAVVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTIANFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDFFPEFLDMLEESPFLKMTLPWGTMSTLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWESTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFSHVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQY 615          
BLAST of SMED30034801 vs. Ensembl Xenopus
Match: rsbn1 (round spermatid basic protein 1 [Source:NCBI gene;Acc:100127593])

HSP 1 Score: 117.857 bits (294), Expect = 1.548e-27
Identity = 60/173 (34.68%), Postives = 91/173 (52.60%), Query Frame = -3
Query: 1323 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQV 1841
            H E  +  N L+      + M+ E   NGG  +LHAY DELS L   ++E F   + +  F    N N+   + Y + ++HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G +F + +  LE +PFLK +
Sbjct:  251 HQEHCIRTNTLDRGSKFSRLMHEENQSNGGAPVLHAYMDELSFLSPVEMERFAEEFLERTF----NENDKSAAYYALAVVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTIANFHTQVSRTYCCGTYRAGPMRQISLVGAVDEEVGDFFPEFLDMLEESPFLKVI 418          
BLAST of SMED30034801 vs. Ensembl Mouse
Match: Rsbn1 (rosbin, round spermatid basic protein 1 [Source:MGI Symbol;Acc:MGI:2444993])

HSP 1 Score: 308.531 bits (789), Expect = 4.613e-93
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  340 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 707          
BLAST of SMED30034801 vs. Ensembl Mouse
Match: Rsbn1 (rosbin, round spermatid basic protein 1 [Source:MGI Symbol;Acc:MGI:2444993])

HSP 1 Score: 308.531 bits (789), Expect = 4.613e-93
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  340 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 707          
BLAST of SMED30034801 vs. Ensembl Mouse
Match: Rsbn1l (round spermatid basic protein 1-like [Source:MGI Symbol;Acc:MGI:3036237])

HSP 1 Score: 307.76 bits (787), Expect = 1.431e-92
Identity = 161/377 (42.71%), Postives = 225/377 (59.68%), Query Frame = -3
Query:  699 KLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYH 1829
            K NL +L+   +  + +++E   NGG  ++HAY +ELS L   +++ F   +   +F E +++     + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH      +    RV KDV+CF    + ++++R++LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L DNDIYFIPRNVVHQFKT+SAV S+AWHVRL ++YH
Sbjct:  312 KNNLRRLDTLAF-RQLIHIEHQPNGGAAVIHAYSNELSCLSPMEMQRFAEEFVGLVFSENESS----AAFYVMGIVHGAATYLPDFLDYFSYNFPNSPVKMEILG-KKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEASPFLKCTLPWGTLSSLKLESRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVH---CGQRPDQPRVTKDVICFHAEDFLEVVQRMQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHVRL-KFYH 672          
BLAST of SMED30034801 vs. Ensembl Mouse
Match: Rsbn1l (round spermatid basic protein 1-like [Source:MGI Symbol;Acc:MGI:3036237])

HSP 1 Score: 214.542 bits (545), Expect = 5.183e-60
Identity = 113/301 (37.54%), Postives = 167/301 (55.48%), Query Frame = -3
Query:  885 KYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQ 1787
            + +++E   NGG  ++HAY +ELS L   +++ F   +   +F E +++     + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH      +    RV KDV+CF    + ++++R++LD+ EPP SQ
Sbjct:  325 QLIHIEHQPNGGAAVIHAYSNELSCLSPMEMQRFAEEFVGLVFSENESS----AAFYVMGIVHGAATYLPDFLDYFSYNFPNSPVKMEILG-KKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEASPFLKCTLPWGTLSSLKLESRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVH---CGQRPDQPRVTKDVICFHAEDFLEVVQRMQLDLHEPPLSQ 612          
BLAST of SMED30034801 vs. Ensembl Mouse
Match: Rsbn1 (rosbin, round spermatid basic protein 1 [Source:MGI Symbol;Acc:MGI:2444993])

HSP 1 Score: 108.612 bits (270), Expect = 2.996e-26
Identity = 75/268 (27.99%), Postives = 107/268 (39.93%), Query Frame = -3
Query: 1038 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAA 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N     + Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   +                                               +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAA
Sbjct:   17 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNA----AYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQM----------------------------------------------TLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAA 228          
BLAST of SMED30034801 vs. UniProt/SwissProt
Match: sp|Q28DE6|RSBNL_XENTR (Lysine-specific demethylase RSBN1L OS=Xenopus tropicalis OX=8364 GN=rsbn1l PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.332e-92
Identity = 157/360 (43.61%), Postives = 215/360 (59.72%), Query Frame = -3
Query:  702 MYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1781
            +++E   NGG  ++HAY  ELSQL   ++E F   +   +F E +N      + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R G +  +SLVG   EE G YF + +  LE +PFLK+ +PWG  S L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH       N N R+ KDV+CF    + ++++RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L D+DIYFIPRNVVHQFKT+SAV S+AWH+RL+ Y+
Sbjct:  296 IHIEHQPNGGASLIHAYSSELSQLSPVEMERFSEEFVTLVFSENENCA----AFYVMGIVHGAATYLPDFLDYFSFNFPNSPVKMEILG-KKDIETTTISNFHAQVKRTYSHGTYRAGAMRQISLVGAVDEEVGDYFPEFLDMLETSPFLKRTLPWGTCSSLQLKSRKESDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRASEPREMLFEDRTRAHADHIGQGFERETTAAVGVLKAVH---CVEWNENPRITKDVICFHAEDFLEVVQRLQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDDDIYFIPRNVVHQFKTVSAVCSLAWHIRLKMYH 641          
BLAST of SMED30034801 vs. UniProt/SwissProt
Match: sp|Q6PCB5|RSBNL_HUMAN (Lysine-specific demethylase RSBN1L OS=Homo sapiens OX=9606 GN=RSBN1L PE=1 SV=2)

HSP 1 Score: 310.457 bits (794), Expect = 1.821e-92
Identity = 159/374 (42.51%), Postives = 223/374 (59.63%), Query Frame = -3
Query:  702 NLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1823
            NL +L+  ++  + +++E   NGG  ++HAY +ELS L   ++E F   +   +F E +N+     + Y +GI+HG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L   S   S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAVH           R+ KDV+CF    + ++++R++LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L DNDIYFIPRNVVHQFKT+SAV S+AWH+RL+ Y+
Sbjct:  336 NLKRLDTLEF-KQLIHIEHQPNGGASVIHAYSNELSHLSPMEMERFAEEFVGLVFSENENS----AAFYVMGIVHGAATYLPDFLDYFSFNFPNSPVKMEILG-KKDIETTTMSNFHAQVKRTYSHGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKCTLPWGTLSSLKLQSRKDSDDGPIMWVRPGEQMIPVADMPKSPFKRKRTTNE-----IKNLQYLPRTSEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVH---CGEWPDQPRITKDVICFHAEDFLEVVQRMQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDNDIYFIPRNVVHQFKTVSAVCSLAWHIRLKLYH 694          
BLAST of SMED30034801 vs. UniProt/SwissProt
Match: sp|Q80T69|RSBN1_MOUSE (Lysine-specific demethylase 9 OS=Mus musculus OX=10090 GN=Rsbn1 PE=1 SV=3)

HSP 1 Score: 308.531 bits (789), Expect = 3.227e-92
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  340 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 707          
BLAST of SMED30034801 vs. UniProt/SwissProt
Match: sp|Q5VWQ0|RSBN1_HUMAN (Lysine-specific demethylase 9 OS=Homo sapiens OX=9606 GN=RSBN1 PE=1 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 3.329e-92
Identity = 159/382 (41.62%), Postives = 219/382 (57.33%), Query Frame = -3
Query:  696 HMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1841
            H E  +  N L        +++ E   NGG  +LHAY DELS L   ++E F   +    F E + N  +    Y + I+HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ +P++   K         +      I NL    R    R+    DRT  HADH   G D  +TAAVGVLKAV        +   R+ KDV+CF    +TD+++RL+LD+ EPP SQC   W D+A+LNQ+R EG R+ R+ L DNDIYFIPRNV+HQFKT+SAV S+AWH+RL++Y+ +
Sbjct:  340 HQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAY----YALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTISNFHTQVNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNE-----IKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQ---FGEWSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQCVQ-WVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPV 707          
BLAST of SMED30034801 vs. UniProt/SwissProt
Match: sp|Q9GRZ3|DPY21_CAEEL (Lysine-specific demethylase 9 OS=Caenorhabditis elegans OX=6239 GN=dpy-21 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 6.641e-66
Identity = 138/401 (34.41%), Postives = 210/401 (52.37%), Query Frame = -3
Query:  696 KYMYVEKYENGGGYILHAYQDELSQ-LDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDR--------------------------------HTTAAVGVLKAVHPPNTKSKNGNY----RVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHI 1787
            K++ + ++ NG   I+    +++ Q L  ++++ F  ++ +  F E   NN  P  L+ IG++  +A  L D   +LA    N  VK   +  K  ++T+ + +Y ++  +    G FR+GPL S+S+VGTK EE GG FK+++  L   PFL  +MPWG  S++ G+    S+DGPI W+R GEQ VP+    +  +                 P   RG   R+TA NDRT+ HAD   +  +                                  +TAAVGVL+ +  P+    +  Y    + VK+V+ FD      +   L +D+ EPP SQC + W DDA LN +R EG R+ ++ L +ND+YF+PRNV+HQF+T+SA SSVAWHVRLR YY +
Sbjct: 1236 KFVRIRRHPNGMATIISCDYNQIKQHLGPNEMKHFERQFVRLGFAE---NNGVP--LFAIGVMENAAEALHDQFEWLAKNSPNTQVKVGSLTNKQFIETMPMKKYYESAMETLDMGTFRFGPLMSLSMVGTKNEEAGGNFKEMLDALNAAPFLGPIMPWGDFSEVQGIKEDTSDDGPIFWVRPGEQMVPTDGKNRSTEPRH--------------PLATRGNDRRETAFNDRTNAHADQVRESTEDDPTTTTTTTTTTSSSSSSSKSKKSAKSDPTFVKSTAAVGVLQGIRNPDANDDDEYYEDERKAVKEVIVFDAHDLHKVAHHLAMDLYEPPVSQC-HRWVDDAILNTMRREGIRYAKLELHENDMYFLPRNVIHQFRTVSACSSVAWHVRLRHYYDV 1616          
BLAST of SMED30034801 vs. TrEMBL
Match: A0A074ZH41 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06247 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 7.779e-143
Identity = 220/458 (48.03%), Postives = 298/458 (65.07%), Query Frame = -3
Query:  702 NTNCSNGSLSNNS-TPVKGTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNH-PYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNY-----------------------------------RVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1964
            +TN SNG   ++S    K ++K +    +S+ + HD     I   ++  + + +P  +L   MYVE YENGGGY LH+Y DEL+ L+  +LELF  +YF+ LF E +    H P+S YCIG++HG+A+++P+LLSYL+  Y  L V TN +E KN  ++ ++  Y+++V+K Y  G+FR+GPLH++S+VGTKGEE G +  D+++ +E +PFL+ V PWG LS LSGM P  SNDGPI+W RHGEQAVP   +    K+     S      ++ L +  R   +RQ  V DRT CHADHADDGL RHTTAAVG+LK ++PP + SK                                       R++KDVV FDPRHY DL++RL+LD+MEPPASQCG +WADDAELNQL  EG+R++R+ LRDNDIYFIPRNVVHQFKT+SA  S+AWHVRL++YY
Sbjct:    8 DTNTSNGVGPDHSHLTSKFSRKRHSAECASAKYGHDPLRHLIQSFARSKVPR-SPLRHLSDLMYVEHYENGGGYALHSYADELAHLNKVELELFTKKYFRTLFTERRKRGIHVPFSYYCIGVVHGAAKRIPELLSYLSVMYPELKVNTNPLERKNASESTSISRYSEDVFKAYTRGIFRFGPLHAISIVGTKGEERGCFSNDLLRMIESDPFLRLVTPWGALSSLSGMDPHDSNDGPIIWARHGEQAVPVCATSSLSKMRLVQGSG-----LLELLSNARTRRVRQVLVPDRTPCHADHADDGLGRHTTAAVGLLKGIYPPCSLSKTHQPKQINSSAPSSPASDKPAVQDDAFENPYSPTPSPPGRIIKDVVVFDPRHYPDLVRRLRLDVMEPPASQCGTFWADDAELNQLHTEGFRYVRLPLRDNDIYFIPRNVVHQFKTVSAGVSIAWHVRLKQYY 459          
BLAST of SMED30034801 vs. TrEMBL
Match: A0A183MT89 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS19264 PE=4 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 9.444e-143
Identity = 228/450 (50.67%), Postives = 293/450 (65.11%), Query Frame = -3
Query:  702 SNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNH-PYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRG------GVI------------RQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHP--PNTKSK--------------NGNY---------------RVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1901
            S+ H + +S   HD  +  I + S L + + +PK +L   ++VE YENGGGY LH+Y DEL+ L   +L L   +YFK LF E +      P+S YCIG++HG+AR++P+LLSYL+  Y NL V TN +E KN  +T+++ +Y KNV K Y NG++R+GPLH++S+VG KGEE G + K +I+ +E++PFLK V PWG LS LSGM P  SNDGPILW RHGEQ                       +P+   PTT+RG      G I            RQ AV+DRT+CHADHADDGL RHTTAAVG+LKAV+P  P  +S+              NG+                R+VKDVV FDPRHY DLI+RL+LDIMEPPASQCG++WADD ELNQL  EG+R++R+ LRDNDIYFIPRNVVHQFK++SAVSS+AWHVRL+ YY
Sbjct:   38 SSCHAVVTSSNRHDPLAHIIRLSSNLKVPR-SPKRHLCDMIHVEHYENGGGYALHSYADELAHLTADELALLARKYFKILFTERRKRGIRVPFSHYCIGVVHGAARRMPELLSYLSSAYPNLNVSTNPLEQKNATETLSLSQYVKNVQKTYANGIYRFGPLHALSIVGVKGEERGFFDKSLIEMIEKDPFLKLVTPWGVLSSLSGMDPRESNDGPILWSRHGEQ----------------------TIPL--FPTTMRGRRRVINGCITDVVIGRRALGGRQIAVHDRTNCHADHADDGLSRHTTAAVGLLKAVYPHRPGEESELPYSSSCPLHFEDANGDLSSNTNPYAYKLNQPARIVKDVVVFDPRHYVDLIERLRLDIMEPPASQCGSFWADDGELNQLHSEGFRYVRLPLRDNDIYFIPRNVVHQFKSVSAVSSIAWHVRLKNYY 462          
BLAST of SMED30034801 vs. TrEMBL
Match: A0A094ZWS4 (Round spermatid basic protein 1-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_07148 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.584e-142
Identity = 225/454 (49.56%), Postives = 288/454 (63.44%), Query Frame = -3
Query:  702 GTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNH-PYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRG------GVI------------RQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHP-------------------------------PNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1913
             +  S  H + +S   HD  +  I + S L + + +PK +L   ++VE YENGGGY LH+Y DEL+ L   +L L   +YFK LF E +      P+S YCIG++HG+AR++P+LLSYL+  Y NL V TN +E KN  +T+++ +Y KNV K Y NG++R+GPLH++S+VG KGEE G + K +I+ +E++PFLK V PWG LS LSGM P  SNDGPILW RHGEQ                       +P+   PTT+RG      G I            RQ AV+DRT+CHADHADDGL RHTTAAVG+LKAV+P                               P     N   R+VKDVV FDPRHY DLI+RL+LDIMEPPASQCG++WADD ELNQL  EG+R++R+ LRDNDIYFIPRNV+HQFK++SAVSS+AWHVRL+ YY
Sbjct:   34 ASSNSTCHAVVTSSNRHDPLAHIIRLSSNLKVPR-SPKRHLCDMIHVEHYENGGGYALHSYADELAHLTADELALLARKYFKILFTERRKRGIRVPFSHYCIGVVHGAARRMPELLSYLSSAYPNLNVSTNPLEQKNATETLSLSQYVKNVQKTYANGIYRFGPLHALSIVGVKGEERGFFDKSLIEMIEKDPFLKLVTPWGVLSSLSGMDPRESNDGPILWSRHGEQ----------------------TIPL--FPTTMRGRRRVINGCITDVVIGRRALGGRQIAVHDRTNCHADHADDGLSRHTTAAVGLLKAVYPHRSGEESELPYSSSCPLHFEDANGDLNSNTNPYAYKLNQPARIVKDVVVFDPRHYVDLIERLRLDIMEPPASQCGSFWADDGELNQLHSEGFRYVRLPLRDNDIYFIPRNVIHQFKSVSAVSSIAWHVRLKNYY 462          
BLAST of SMED30034801 vs. TrEMBL
Match: A0A430QI12 (Lysine-specific demethylase 9 OS=Schistosoma bovis OX=6184 GN=DC041_0010293 PE=4 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 1.882e-142
Identity = 225/454 (49.56%), Postives = 288/454 (63.44%), Query Frame = -3
Query:  702 GTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNH-PYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRG------GVI------------RQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHP-------------------------------PNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1913
             +  S  H + +S   HD  +  I + S L + + +PK +L   ++VE YENGGGY LH+Y DEL+ L   +L L   +YFK LF E +      P+S YCIG++HG+AR++P+LLSYL+  Y NL V TN +E KN  +T+++ +Y KNV K Y NG++R+GPLH++S+VG KGEE G + K +I+ +E++PFLK V PWG LS LSGM P  SNDGPILW RHGEQ                       +P+   PTT+RG      G I            RQ AV+DRT+CHADHADDGL RHTTAAVG+LKAV+P                               P     N   R+VKDVV FDPRHY DLI+RL+LDIMEPPASQCG++WADD ELNQL  EG+R++R+ LRDNDIYFIPRNV+HQFK++SAVSS+AWHVRL+ YY
Sbjct:   34 ASSNSTCHAVVTSSNRHDPLAHIIRLSSNLKVPR-SPKRHLCDMIHVEHYENGGGYALHSYADELAHLTADELALLARKYFKILFTERRKRGIRVPFSHYCIGVVHGAARRMPELLSYLSSAYPNLNVSTNPLEQKNATETLSLSQYVKNVQKTYANGIYRFGPLHALSIVGVKGEERGFFDKSLIEMIEKDPFLKLVTPWGVLSSLSGMDPRESNDGPILWSRHGEQ----------------------TIPL--FPTTMRGRRRVINGCITDVVIGRRALGGRQIAVHDRTNCHADHADDGLSRHTTAAVGLLKAVYPHRSGEESELPYSSSCPLHFEDANGDLNSNTNPYAYKLNQPARIVKDVVVFDPRHYVDLIERLRLDIMEPPASQCGSFWADDGELNQLHSEGFRYVRLPLRDNDIYFIPRNVIHQFKSVSAVSSIAWHVRLKNYY 462          
BLAST of SMED30034801 vs. TrEMBL
Match: G4V923 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_034450 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 6.578e-142
Identity = 207/361 (57.34%), Postives = 263/361 (72.85%), Query Frame = -3
Query:  702 MYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNH-PYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1781
            ++VE YENGGGY LH+Y DEL+ L   +L L   +YFK LF E +      P+S YCIG++HG+AR++P+LLSYL+  Y NL V TN +E KN  +T+++ +Y KNV K Y NG++R+GPLH++S+VG KGEE G + K +I+ +E++PFLK V PWG LS LSGM P  SNDGPILW RHGEQ +P   +  + +           V    +     GG  RQ  ++DRT+CHADHADDGL RHTTAAVG+LKAV+P        N  +VKDVV FDPRHY DLI+RL+LDIMEPPASQCG++WADD ELNQL  EG+R++R+ LRDNDIYFIPRNVVHQFK++SAVSS+AWHVRL+ YY
Sbjct:    2 IHVEHYENGGGYALHSYADELAHLTADELALLARKYFKILFTERRKRGVRVPFSHYCIGVVHGAARRMPELLSYLSSAYPNLNVSTNPLEQKNATETLSLSQYVKNVQKTYANGIYRFGPLHALSIVGVKGEERGFFDKSLIEMIEKDPFLKLVTPWGVLSSLSGMDPRESNDGPILWSRHGEQTIPLFPTTMRSRRRVINGCITDVV----MGRRALGG--RQITIHDRTNCHADHADDGLSRHTTAAVGLLKAVYP---HRPGENSEIVKDVVVFDPRHYVDLIERLRLDIMEPPASQCGSFWADDGELNQLHSEGFRYVRLPLRDNDIYFIPRNVVHQFKSVSAVSSIAWHVRLKNYY 353          
BLAST of SMED30034801 vs. Ensembl Cavefish
Match: RSBN1L (round spermatid basic protein 1 like [Source:NCBI gene;Acc:103037480])

HSP 1 Score: 313.153 bits (801), Expect = 4.004e-93
Identity = 157/362 (43.37%), Postives = 218/362 (60.22%), Query Frame = -3
Query:  702 KYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1787
            ++++VE+  NGG  +LHAY  ELS L   +++ F   +    F E +N   H    Y +GIIHG+A  LPD L Y + K+ +  VK  ++  K D++T T+  +   V + Y +G +R G +  +SLVG   EE G YF + +  L+++PFL++ +PWG  S L  +SP  S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAV            R+ KDVVCF    + ++++RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L DNDIY+IPR+VVHQFKT+SAV S+AWHVRLR+Y+
Sbjct:  362 RFVHVEQQPNGGALVLHAYIRELSVLSPEEMQRFAQEFVMLSFCEDENGAAH----YVMGIIHGAASYLPDFLDYFSLKFPSSPVKMEILG-KKDIETTTMANFNAQVKRTYSHGTYRAGAMRQISLVGAVDEEVGDYFPEFLTMLQQSPFLERTLPWGTFSSLKHISPTDSDDGPIMWVRPGEQMIPVTDMPKSPFKRKRSTNE-----IKNLQYLPRASEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAV---RCGESAEPPRITKDVVCFHAADFPEVVQRLQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIQLYDNDIYYIPRSVVHQFKTVSAVCSLAWHVRLRQYH 709          
BLAST of SMED30034801 vs. Ensembl Cavefish
Match: RSBN1 (round spermatid basic protein 1 [Source:HGNC Symbol;Acc:HGNC:25642])

HSP 1 Score: 308.145 bits (788), Expect = 1.289e-92
Identity = 160/362 (44.20%), Postives = 213/362 (58.84%), Query Frame = -3
Query:  702 KYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1787
            K ++ EK  NGG  +LHAY DELS L   D E F   + +  F ET        + Y + ++HG+A  LPD L Y A  + N  VK  ++  K D++T T+  +   V + Y +G +R GP+  +SLVG   EE G YF + +  LE +PFLK  +PWG LS L     + S+DGPI+W+R GEQ VP++   K         +      I NL    R    R+    DRT  HADH     D  +TAAVGVLKAV        +   R+ KDVVCF    + D+++RL+LD+ EPP SQC   W DDA+LNQLR EG R++RV L D+DIYFIPRNV+HQFKT+SAV S+AWH+RLR+Y+
Sbjct:  342 KLIHEEKQPNGGASVLHAYADELSFLRPGDTERFAREFLELAFSETSKGA----ARYALSVVHGAAAYLPDFLDYFAFNFPNTPVKMEILG-KKDIETTTIANFHSQVNRTYCSGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLKLDCRSQSDDGPIMWVRPGEQMVPTADMPKSPFKRRRSMNE-----IKNLHYLPRTSEPREVLFEDRTRAHADHVGQSFDWQSTAAVGVLKAVQ---FGEWSDRPRITKDVVCFHAEDFNDVVQRLQLDLYEPPVSQCVQ-WVDDAKLNQLRREGIRYVRVQLCDDDIYFIPRNVIHQFKTVSAVCSLAWHIRLRQYH 689          
BLAST of SMED30034801 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004696.1 (pep scaffold:Pmarinus_7.0:GL476335:2037719:2051015:1 gene:ENSPMAG00000004282.1 transcript:ENSPMAT00000004696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 1.536e-49
Identity = 96/240 (40.00%), Postives = 131/240 (54.58%), Query Frame = -3
Query:  882 HGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQC 1601
            HG+A  LPD L Y A  + +  VK  ++  K D++T T+  ++  V + Y NG +R G +  +SLVG   EE G YF + +  LE +PFLK  +PWG +S L   S   S+DGPILW+R GEQ +P++   K                + NL    R    R+    DRT  HADH   G DR TTAAVGVLKAV       ++   RV KDVV F    + ++++RL+LD+ EPP SQ 
Sbjct:    1 HGAAAYLPDFLDYFAFSFPSTSVKVEVLG-KKDIETTTMESFSTQVQRTYCNGTYRAGAMRQISLVGVVDEEVGDYFPEFLDMLEESPFLKLTLPWGSISSLRLESRMESDDGPILWVRPGEQMIPTADMPKSPCKKRRSE-------VKNLHYLPRLSEPREVLFEDRTRAHADHIGQGFDRQTTAAVGVLKAV---RFGERDDEARVTKDVVAFHAGDFVEVVQRLQLDLHEPPMSQV 229          
BLAST of SMED30034801 vs. Ensembl Nematostella
Match: EDO31883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWP7])

HSP 1 Score: 303.138 bits (775), Expect = 2.382e-96
Identity = 163/367 (44.41%), Postives = 213/367 (58.04%), Query Frame = -3
Query:  702 KDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1802
            K +L   M++E   NGG   +H Y +E+  L    +E FV    K  FRE    +    + + +GI+H +A  LP+L  Y    + NL VK +L+  K D++T+ +G+Y K V   Y  G  R GPL   SLVGT  EE GGYF + +  LE   FL++ MPWG LS L       SNDGPI+W+R GEQ VP++              N     + NL    R    R+    DRT CHADH   G DR TTAAVG+LK V     KS     R  KDVVCF P  +  L+++LK+D+ EPP SQC   W DDA+LNQLR +G R+ R++LRDNDIYFIPRN++HQFKTISA +S+AWH+R + YY
Sbjct:    3 KTHLSHLMHIETDPNGGASSVHVYSEEIKGLSPEKMEKFV----KLFFREVYAEDEVGVARHVMGIVHNAADYLPELTRYFGTNHANLTVKASLIGKKLDIETIKMGDYLKRVEATYSQGTLRCGPLLQFSLVGTVQEEVGGYFPEFLDTLEECVFLRETMPWGRLSALKLDKRNRSNDGPIMWVRPGEQFVPTAELGSSPNKRRRLTVNE----LQNLHYLPRTSEPREMLAEDRTRCHADHVGQGFDRQTTAAVGLLKGVQVGEVKSDIN--RNCKDVVCFHPDSFNQLVQKLKIDLHEPPVSQC-IMWVDDAKLNQLRRDGIRYARLFLRDNDIYFIPRNIIHQFKTISACTSIAWHLRHKMYY 358          
BLAST of SMED30034801 vs. Ensembl Nematostella
Match: EDO31882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWP6])

HSP 1 Score: 132.88 bits (333), Expect = 2.984e-34
Identity = 60/102 (58.82%), Postives = 79/102 (77.45%), Query Frame = -3
Query:  702 NTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYY 1007
             TK+ + N R  KDVVCF P  +  L+++LK+D+ EPP SQC   W DDA+LNQLR +G R+ R++LRDNDIYFIPRN++HQFKTISA +S+AWH+R + YY
Sbjct:   52 QTKTTDIN-RNCKDVVCFHPDSFNQLVQKLKIDLHEPPVSQCI-MWVDDAKLNQLRRDGIRYARLFLRDNDIYFIPRNIIHQFKTISACTSIAWHLRHKMYY 151          
BLAST of SMED30034801 vs. Ensembl Medaka
Match: ENSORLT00000031531.1 (lysine-specific demethylase 9 [Source:NCBI gene;Acc:101159263])

HSP 1 Score: 315.849 bits (808), Expect = 4.511e-96
Identity = 161/361 (44.60%), Postives = 220/361 (60.94%), Query Frame = -3
Query:  705 KYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRY 1787
            ++M+ E+  NGGG +LHAY DEL++L  S++E F   + +  F E         + Y + ++H +A  LPD L Y A  + N  VK  ++  K D++T T+G +   V + Y  G +R GP+  +SLVG   EE G YF + +  LE +PFLK+ +PWG LS L     + S+DGPI+W+R GEQ VP++   K         +      I NL    R    R+    DRT  HADH     D  +TAAVGVLKAVH  N  +K    R+ KDVVCFD   +T++++RL+LD+ EPP SQC   W DDA+LNQLR EG R+IR  L D+DIYFIPRNV+HQFKT+SAV S+AWH+RL++Y
Sbjct:  319 RFMHEERQPNGGGAVLHAYADELARLSPSEMEGFAKEFLELAFAEKPKGA----AAYALSVVHRAAAYLPDFLDYFAFNFPNTPVKVEILG-KKDIETTTIGNFHSQVSRTYCAGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKRTLPWGTLSSLKLDCRSQSDDGPIMWVRPGEQMVPTADMPKSPFKRRRSMNE-----IKNLHFLPRTSEPREVLFEDRTKAHADHVGQSFDWQSTAAVGVLKAVHFGNGDAKP---RITKDVVCFDAGDFTEVVQRLQLDLYEPPVSQCVQ-WVDDAKLNQLRREGIRYIRAQLCDDDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQY 665          
BLAST of SMED30034801 vs. Ensembl Medaka
Match: RSBN1L (round spermatid basic protein 1-like [Source:NCBI gene;Acc:101171296])

HSP 1 Score: 300.442 bits (768), Expect = 2.555e-93
Identity = 154/362 (42.54%), Postives = 214/362 (59.12%), Query Frame = -3
Query:  699 YMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYH 1784
            ++++E   NGG  I HAY  +LS L       F   +    F E  +   H    Y +GI+HG A+ L D L Y + K+ ++ VK  ++  K D++T T+  +   V + Y +G +R G +  +SLVG   EE G YF + +  LE +PFLK  +PWG LS LS M P  S+DGPI+W+R GEQ +P +   K         +    + + +LP   R    R+    DRT  HADH   G DR TTAAVGVLKA+ P +   ++   RV KD+VCF    +  +++RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L  +DIYFIPRNV+HQFKT+SAV S+AWH+RLR+Y+ 
Sbjct:   71 FIHIENQPNGGALIAHAYTSQLSSLSADQRRRFAQEFVTLAFSEDTSQAAH----YVMGIVHGEAKYLTDFLDYFSTKFPSVPVKMEILG-KKDIETTTMSNFYTQVKRTYSHGTYRAGAMRQISLVGAVDEEVGDYFPEFLGMLEESPFLKLTLPWGTLSSLSHMCPTESDDGPIMWVRPGEQTIPVADVPKSPFKRKRSTNEVKNL-LQSLP---RTSEPREMLFEDRTRAHADHIGQGFDRQTTAAVGVLKAICPVD---RSEPPRVTKDIVCFHAGDFPYVVQRLQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIRLCHDDIYFIPRNVIHQFKTVSAVCSLAWHIRLRQYHQ 419          
BLAST of SMED30034801 vs. Ensembl Medaka
Match: ENSORLT00000013232.2 (round spermatid basic protein 1-like [Source:NCBI gene;Acc:101171487])

HSP 1 Score: 305.449 bits (781), Expect = 1.563e-89
Identity = 157/369 (42.55%), Postives = 216/369 (58.54%), Query Frame = -3
Query:  699 PKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYH 1805
            P+    + ++VE+  NGG  ++HAY D+L+ L  S+LE F   +    F E ++      + + +GIIHG+A  LPD L Y +  + N  VK  ++  K D++T T+  +   V + Y  G +R G +  VSLVG   EE G YF + I+ LE +PFL++ +PWG  S L   SP  S+DGPI+W+R GEQ +P +   K         +      I NL    R    R+    DRT  HADH   G +R TTAAVGVLKAV     +  +   R+ KDVVCF    + D++ RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L  +DIYFIPR VVHQFKT+SAV S+AWH+RL+ Y+ 
Sbjct:  327 PELEFGRLIHVEQQANGGASVVHAYYDQLACLSPSELERFAEEFVSLSFSEDESQ----AACFVMGIIHGAASYLPDFLDYFSYNFPNAPVKMEVL-GKKDIETTTMANFHSQVKRTYSQGTYRAGAMRQVSLVGAVDEEVGDYFPEFIRMLEESPFLERTLPWGTFSSLRLQSPTESDDGPIMWVRPGEQMIPMADMPKSPFKRKRSTNE-----IKNLQYLPRASEPREMLFEDRTRAHADHIGQGFERQTTAAVGVLKAVR--CGEDSDTPARITKDVVCFHAGDFPDVVMRLQLDLHEPPLSQCVQ-WIDDAKLNQLRREGIRYARIQLYHDDIYFIPRGVVHQFKTVSAVCSLAWHIRLKLYHQ 682          
BLAST of SMED30034801 vs. Ensembl Medaka
Match: RSBN1L (round spermatid basic protein 1-like [Source:NCBI gene;Acc:101171296])

HSP 1 Score: 305.064 bits (780), Expect = 4.115e-89
Identity = 154/362 (42.54%), Postives = 214/362 (59.12%), Query Frame = -3
Query:  699 YMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYH 1784
            ++++E   NGG  I HAY  +LS L       F   +    F E  +   H    Y +GI+HG A+ L D L Y + K+ ++ VK  ++  K D++T T+  +   V + Y +G +R G +  +SLVG   EE G YF + +  LE +PFLK  +PWG LS LS M P  S+DGPI+W+R GEQ +P +   K         +    + + +LP   R    R+    DRT  HADH   G DR TTAAVGVLKA+ P +   ++   RV KD+VCF    +  +++RL+LD+ EPP SQC   W DDA+LNQLR EG R+ R+ L  +DIYFIPRNV+HQFKT+SAV S+AWH+RLR+Y+ 
Sbjct:  378 FIHIENQPNGGALIAHAYTSQLSSLSADQRRRFAQEFVTLAFSEDTSQAAH----YVMGIVHGEAKYLTDFLDYFSTKFPSVPVKMEILG-KKDIETTTMSNFYTQVKRTYSHGTYRAGAMRQISLVGAVDEEVGDYFPEFLGMLEESPFLKLTLPWGTLSSLSHMCPTESDDGPIMWVRPGEQTIPVADVPKSPFKRKRSTNEVKNL-LQSLP---RTSEPREMLFEDRTRAHADHIGQGFDRQTTAAVGVLKAICPVD---RSEPPRVTKDIVCFHAGDFPYVVQRLQLDLHEPPLSQCVQ-WVDDAKLNQLRREGIRYARIRLCHDDIYFIPRNVIHQFKTVSAVCSLAWHIRLRQYHQ 726          
BLAST of SMED30034801 vs. Planmine SMEST
Match: SMESG000051345.1 (SMESG000051345.1)

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 554/554 (100.00%), Postives = 554/554 (100.00%), Query Frame = -3
Query:  579 MSENNSCALIDEISNNSDVKSEEIITLNNDKTNSTEFDNGVTVNALGGSFCIPKCNSLRKRLSTDPXXXXXXXXXXXXXXNISDDSNKYVNGNTNCSNGSLSNNSTPVKGTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVXXXXXXXXXXXXXXXXXXXSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHIPXXXXXXXXXTPGAKSSEETHNNNNHPISSASNPTEKNC 2240
            MSENNSCALIDEISNNSDVKSEEIITLNNDKTNSTEFDNGVTVNALGGSFCIPKCNSLRKRLSTDPESEVENENKVEKTENISDDSNKYVNGNTNCSNGSLSNNSTPVKGTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVPSSTSKKKRKISPSPNSNNSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHIPSTSSSSSTTTPGAKSSEETHNNNNHPISSASNPTEKNC
Sbjct:    1 MSENNSCALIDEISNNSDVKSEEIITLNNDKTNSTEFDNGVTVNALGGSFCIPKCNSLRKRLSTDPESEVENENKVEKTENISDDSNKYVNGNTNCSNGSLSNNSTPVKGTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYLYKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNNNNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTVTVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERNPFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVPSSTSKKKRKISPSPNSNNSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTAAVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPASQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAVSSVAWHVRLRRYYHIPSTSSSSSTTTPGAKSSEETHNNNNHPISSASNPTEKNC 554          
The following BLAST results are available for this feature:
BLAST of SMED30034801 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSBN1L3.120e-9542.51round spermatid basic protein 1 like [Source:HGNC ... [more]
RSBN13.994e-9441.62round spermatid basic protein 1 [Source:HGNC Symbo... [more]
RSBN11.983e-9341.62round spermatid basic protein 1 [Source:HGNC Symbo... [more]
RSBN1L3.792e-9342.51round spermatid basic protein 1 like [Source:HGNC ... [more]
RSBN16.932e-9341.62round spermatid basic protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dpy-215.221e-6734.41Lysine-specific demethylase 9 [Source:UniProtKB/S... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG106008.440e-10046.81gene:FBgn0032717 transcript:FBtr0331194[more]
CG106009.034e-10046.81gene:FBgn0032717 transcript:FBtr0081120[more]
CG106009.683e-10046.81gene:FBgn0032717 transcript:FBtr0273228[more]
back to top
BLAST of SMED30034801 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RSBN11.510e-9339.15round spermatid basic protein 1-like [Source:NCBI ... [more]
RSBN12.587e-9239.15round spermatid basic protein 1-like [Source:NCBI ... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rsbn1l2.513e-9343.61round spermatid basic protein 1 like [Source:NCBI ... [more]
rsbn18.728e-9240.90round spermatid basic protein 1 [Source:NCBI gene;... [more]
rsbn11.548e-2734.68round spermatid basic protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rsbn14.613e-9341.62rosbin, round spermatid basic protein 1 [Source:MG... [more]
Rsbn14.613e-9341.62rosbin, round spermatid basic protein 1 [Source:MG... [more]
Rsbn1l1.431e-9242.71round spermatid basic protein 1-like [Source:MGI S... [more]
Rsbn1l5.183e-6037.54round spermatid basic protein 1-like [Source:MGI S... [more]
Rsbn12.996e-2627.99rosbin, round spermatid basic protein 1 [Source:MG... [more]
back to top
BLAST of SMED30034801 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DE6|RSBNL_XENTR1.332e-9243.61Lysine-specific demethylase RSBN1L OS=Xenopus trop... [more]
sp|Q6PCB5|RSBNL_HUMAN1.821e-9242.51Lysine-specific demethylase RSBN1L OS=Homo sapiens... [more]
sp|Q80T69|RSBN1_MOUSE3.227e-9241.62Lysine-specific demethylase 9 OS=Mus musculus OX=1... [more]
sp|Q5VWQ0|RSBN1_HUMAN3.329e-9241.62Lysine-specific demethylase 9 OS=Homo sapiens OX=9... [more]
sp|Q9GRZ3|DPY21_CAEEL6.641e-6634.41Lysine-specific demethylase 9 OS=Caenorhabditis el... [more]
back to top
BLAST of SMED30034801 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZH417.779e-14348.03Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A183MT899.444e-14350.67Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A094ZWS41.584e-14249.56Round spermatid basic protein 1-like protein OS=Sc... [more]
A0A430QI121.882e-14249.56Lysine-specific demethylase 9 OS=Schistosoma bovis... [more]
G4V9236.578e-14257.34Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RSBN1L4.004e-9343.37round spermatid basic protein 1 like [Source:NCBI ... [more]
RSBN11.289e-9244.20round spermatid basic protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004696.11.536e-4940.00pep scaffold:Pmarinus_7.0:GL476335:2037719:2051015... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034801 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO318832.382e-9644.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318822.984e-3458.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30034801 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000031531.14.511e-9644.60lysine-specific demethylase 9 [Source:NCBI gene;Ac... [more]
RSBN1L2.555e-9342.54round spermatid basic protein 1-like [Source:NCBI ... [more]
ENSORLT00000013232.21.563e-8942.55round spermatid basic protein 1-like [Source:NCBI ... [more]
RSBN1L4.115e-8942.54round spermatid basic protein 1-like [Source:NCBI ... [more]
back to top
BLAST of SMED30034801 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000051345.10.000e+0100.00SMESG000051345.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034801 ID=SMED30034801|Name=SMED30034801|organism=Schmidtea mediterranea sexual|type=transcript|length=2242bp
TTTTTTTGCAGATAACTATTTATTATTTAAAAGAATTAAGCTGCCGCGAT
ACATTTGATACGTTACATTTGAGAATGACAGAACTCACAGACAATTAATA
ACCTTCTCATCAACCAGACCCAGAAATACACATCTAAAATCGGATTAGCA
TAAATGCAATATTGACTGATTCTGTTGACCGCTTTTAAAACTTAATAATA
TTTCCATAATTGGTAGAACTTATCGATAAGACACGCAAACATAAAATCAT
TCTTCAGAGAATATGATAAATGGAGAGAGAAAGAAGGAGAGAGAGAGAGA
GAAAGAGAGGTACATAATACATCAGAAGGCACTGATATTATCAATGTATA
AAACAAAATTATAGCTATTTTAATAAAAAGTTTACAGAGTGGAAAAATAA
AAGCAACGAACTAAAAACAAGCAATGAAAGTTGGCTGATACAAATGTAAT
ATTTACAGGAGTTTATTCATAAAAACGACTTGTGTAACGACGAATGGATG
ATTTATTTACAATATGCAGTTTGATAGGTTGATAATAACGCGGTGAAGAC
GCTGAATGATGGATGATACACGCTGCTAACAGTTCTTTTCCGTTGGATTA
GAAGCAGAGGAAATCGGATGATTATTGTTATTATGAGTTTCTTCAGAAGA
TTTAGCACCAGGAGTCGTCGTCGACGATGATGAAGATGTTGATGGAATAT
GATAATAGCGACGTAAACGGACATGCCAAGCAACACTGCTGACAGCGGAT
ATGGTCTTAAATTGATGGACAACATTTCTTGGAATGAAATAAATATCATT
ATCCCTTAACCAGACTCGGATGAATCGGTAACCTTCCACTCTCAACTGAT
TTAATTCTGCATCATCCGCCCAATAATTACCACACTGTGATGCAGGTGGT
TCCATTATGTCGAGTTTCAGTCTTTTTATTAAATCGGTATAATGCCTCGG
ATCAAAGCAAACTACATCTTTTACAACTCTGTAATTTCCATTTTTCGATT
TCGTATTCGGGGGATGAACGGCTTTCAGCACACCAACTGCGGCAGTAGTG
TGCCGATCGAGTCCATCATCGGCATGATCGGCATGGCAATGCGTGCGATC
ATTAACGGCAGTTTGTCTGATGACACCTCCTCTGACAGTCGTTGGCAGAT
TCATTATCGGGACAGCACTGTTGTTGGAATTCGGCGAGGGACTGATTTTT
CGTTTCTTTTTGCTGGTACTGCTGGGCACGGCCTGCTCCCCGTGCCTGAT
CCACAATATCGGGCCATCATTGCTCAAGGCCGGCGACATTCCCGATAATT
TCGATAACGGTCCCCAAGGCATCACTTGTTTCAAAAATGGATTTCGTTCG
AGATGTTTAATAATATCCTTGAAATAGCCACCAGTTTCTTCACCTTTCGT
CCCAACGAGACTCACCGAATGCAGCGGCCCGTAACGAAAAAGGCCATTTT
TGTAATTTTTATACACATTTTTGGCATATTCTCCCACAGTTACGGTTTGG
ACGTCGTTTTTAAACTCCATTAAATTCGTTTTAACAATAAGATTATCGTA
TTTATCAGCAAGATATGACAAAAGGTCTGGAAGTTTTCTCGCTGATCCGT
GTATAATACCAATACAATAGAGAGAATATGGATGGTTATTATTGTTTTGG
GTTTCTCTGAATAGACATTTAAAATATCGATTAACAAACAATTCCAAATC
GGAGTTGTCTAATTGAGACAATTCATCCTGATACGCATGAAGTATGTATC
CTCCGCCATTTTCATATTTTTCAACGTACATGTATTTGTATAAGTAATCT
TTAGGATTTAACTGATTCAAATTCAATTTACTCTCCATGTGAATGCGTTT
AGATTCTGAATCATGATTGAAAATAGAACTGCTAAGATTGTGTTTATTAG
ATTTCTGAGTTCCTTTTACGGGAGTACTATTATTTGATAATGAACCATTT
GAGCAGTTTGTATTTCCATTTACATATTTATTGCTATCATCGGATATATT
TTCAGTTTTTTCAACTTTATTTTCATTCTCGACCTCAGATTCAGGATCCG
TAGATAATCGTTTTCTCAACGAATTACATTTCGGAATGCAGAAACTTCCA
CCCAAAGCATTAACAGTGACACCATTATCAAATTCAGTTGAGTTTGTTTT
ATCATTGTTAAGAGTAATAATTTCTTCGCTTTTCACATCAGAATTATTTG
AAATCTCGTCTATTAAAGCACACGAATTATTTTCTGACATAA
back to top

protein sequence of SMED30034801-orf-1

>SMED30034801-orf-1 ID=SMED30034801-orf-1|Name=SMED30034801-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=555bp
MSENNSCALIDEISNNSDVKSEEIITLNNDKTNSTEFDNGVTVNALGGSF
CIPKCNSLRKRLSTDPESEVENENKVEKTENISDDSNKYVNGNTNCSNGS
LSNNSTPVKGTQKSNKHNLSSSIFNHDSESKRIHMESKLNLNQLNPKDYL
YKYMYVEKYENGGGYILHAYQDELSQLDNSDLELFVNRYFKCLFRETQNN
NNHPYSLYCIGIIHGSARKLPDLLSYLADKYDNLIVKTNLMEFKNDVQTV
TVGEYAKNVYKNYKNGLFRYGPLHSVSLVGTKGEETGGYFKDIIKHLERN
PFLKQVMPWGPLSKLSGMSPALSNDGPILWIRHGEQAVPSSTSKKKRKIS
PSPNSNNSAVPIMNLPTTVRGGVIRQTAVNDRTHCHADHADDGLDRHTTA
AVGVLKAVHPPNTKSKNGNYRVVKDVVCFDPRHYTDLIKRLKLDIMEPPA
SQCGNYWADDAELNQLRVEGYRFIRVWLRDNDIYFIPRNVVHQFKTISAV
SSVAWHVRLRRYYHIPSTSSSSSTTTPGAKSSEETHNNNNHPISSASNPT
EKNC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR026306RSBN1/Dpy-21
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..359
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..84
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 85..119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 518..554
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 336..359
NoneNo IPR availablePANTHERPTHR13354:SF9ROUND SPERMATID BASIC PROTEIN 1-LIKE PROTEINcoord: 98..535
IPR026306RSBN1/Dpy-21PANTHERPTHR13354ROUND SPERMATID BASIC PROTEIN 1coord: 98..535