Sodium/potassium-transporting ATPase subunit beta-1

Overview
NameSodium/potassium-transporting ATPase subunit beta-1
Smed IDSMED30034787
Length (bp)1046
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/potassium-transporting ATPase subunit beta-1 (SMED30034787) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-1 (SMED30034787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit beta-1 (SMED30034787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-1 (SMED30034787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30034787SMESG000032752.1 dd_Smed_v4_1688_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 61.6178 bits (148), Expect = 3.847e-10
Identity = 68/264 (25.76%), Postives = 103/264 (39.02%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNA----KNC--------QNGSNSDSTGP---CAFDLSQLGPCQ--NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIF----------CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFLSNIT 831
            +KKE  F GRT   W  + +F V+FY  LAG F     I T  +M+  I   +         PG +  PQ+        ++  PNDP SY+ Y      ++  Y  +        ++C        + G  +   G    C F L  LG C   N           CI   +N + G+ P    +   +   +           CTG    D DK+G+++Y+   N  G         Y+P+   L Q  YL P+ AV  +N+T
Sbjct:   20 EKKE--FLGRTGGSWFKILLFYVIFYGCLAGIF-----IGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTE----ISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL-----QYYPYYGKLLQPKYLQPLLAVQFTNLT 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 61.6178 bits (148), Expect = 3.847e-10
Identity = 68/264 (25.76%), Postives = 103/264 (39.02%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNA----KNC--------QNGSNSDSTGP---CAFDLSQLGPCQ--NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIF----------CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFLSNIT 831
            +KKE  F GRT   W  + +F V+FY  LAG F     I T  +M+  I   +         PG +  PQ+        ++  PNDP SY+ Y      ++  Y  +        ++C        + G  +   G    C F L  LG C   N           CI   +N + G+ P    +   +   +           CTG    D DK+G+++Y+   N  G         Y+P+   L Q  YL P+ AV  +N+T
Sbjct:   20 EKKE--FLGRTGGSWFKILLFYVIFYGCLAGIF-----IGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTE----ISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL-----QYYPYYGKLLQPKYLQPLLAVQFTNLT 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B2 (ATPase Na+/K+ transporting subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:805])

HSP 1 Score: 60.077 bits (144), Expect = 1.269e-9
Identity = 59/256 (23.05%), Postives = 108/256 (42.19%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKN--CQ---------NGSNSDSTGPCAFDLSQLGPCQ--NGSLQLANGTGL-CIYWHINNLYGWLPNISSSSGSKDGL-IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQD---SYLSPIAAVFLSNIT 831
            E  ++ +   F GRT   W F+ +F ++FY    G+   +FT+ T  +M+  +             PG   RP+ +N    + V  N +D  S+  + ++   ++  Y+ +    KN  C+         NG  +     C F+ +QLG C     S      TG  C++  +N +      I+  +G+   + + C G    D + +G+   +P+        G+I   YFP+  +    +Y  P+ AV   N+T
Sbjct:   19 EFVWNPRTHQFMGRTGTSWAFILLFYLVFY----GFLTAMFTL-TMWVMLQTVSDHTPKYQDRLATPGLMIRPKTEN----LDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRV------INFYAGANQSMNVTCAGKRDEDAENLGNFVMFPAN-------GNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVT 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B3 (ATPase Na+/K+ transporting subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:806])

HSP 1 Score: 58.9214 bits (141), Expect = 2.615e-9
Identity = 63/244 (25.82%), Postives = 98/244 (40.16%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYS-KTQPNAKNCQNGSNSDSTGP----CAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQD---SYLSPIAAVFLS 822
             Y+   G F GRT K WG + +F ++FY  LA  F+     FT  +M+  +           P+PG    P+       +  T + +DP SY  Y +  + ++  Y+ + Q N   C +G+  +  GP    C F +S L  C    +     + G   CI   +N + G  P            I C   N    + I ++  YP         G I   YFP+  +     YL P+ AV +S
Sbjct:   20 IYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFS-----FTMWVMLQTLNDEVPKYRDQIPSPGLMVFPK---PVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNP-CILVKMNRIIGLKPEGVPR-------IDCVSKN----EDIPNVAVYPHN-------GMIDLKYFPYYGKKLHVGYLQPLVAVQVS 236          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 49.6766 bits (117), Expect = 4.301e-6
Identity = 54/255 (21.18%), Postives = 100/255 (39.22%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAI-LFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNAKNC---------QNGSNSDSTGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFLSNITR 834
            E  +D +   F  RT + W  + +    FY+ LA    + ++T+F    +   IP      T     PG   RP     ++++    N ++P ++Q+Y      ++  Y+ +     N          Q+G+  +    C F  S L  C   ++ +   + G   CI   +N + G+ P +       D +         D + I SI YYP          S    Y+P+   L   +Y SP+ A+  +++ +
Sbjct:   91 EYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFL--TISPYIP----TFTERVKPPGVMIRP----FAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQP-CILLKMNRIVGFRPELG------DPVKVSCKVQRGDENDIRSISYYPES-------ASFDLRYYPYYGKLTHVNYTSPLVAMHFTDVVK 321          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 110.538 bits (275), Expect = 1.568e-27
Identity = 74/256 (28.91%), Postives = 111/256 (43.36%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTG------PCAFDLSQLGP-CQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGL----------IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            E  Y+KK GT  GRT K W  + +F ++FY+ LA ++    TIF K  +  K+P   G  T+ G  PG  Y+P +  + ++ ++  N  D  SY+ Y +Q + Y++ Y       + C  G ++D         PC FDLS     C   S         C+   +N L GW P     +   + +          I C G  + D + IG + Y PS  I G         Y+P++    Y  PIA V    I R
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMK-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNGIDG--------RYYPYVFTKGYQQPIAMVKFDTIPR 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 110.538 bits (275), Expect = 1.568e-27
Identity = 74/256 (28.91%), Postives = 111/256 (43.36%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTG------PCAFDLSQLGP-CQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGL----------IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            E  Y+KK GT  GRT K W  + +F ++FY+ LA ++    TIF K  +  K+P   G  T+ G  PG  Y+P +  + ++ ++  N  D  SY+ Y +Q + Y++ Y       + C  G ++D         PC FDLS     C   S         C+   +N L GW P     +   + +          I C G  + D + IG + Y PS  I G         Y+P++    Y  PIA V    I R
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMK-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNGIDG--------RYYPYVFTKGYQQPIAMVKFDTIPR 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 110.538 bits (275), Expect = 1.568e-27
Identity = 74/256 (28.91%), Postives = 111/256 (43.36%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTG------PCAFDLSQLGP-CQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGL----------IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            E  Y+KK GT  GRT K W  + +F ++FY+ LA ++    TIF K  +  K+P   G  T+ G  PG  Y+P +  + ++ ++  N  D  SY+ Y +Q + Y++ Y       + C  G ++D         PC FDLS     C   S         C+   +N L GW P     +   + +          I C G  + D + IG + Y PS  I G         Y+P++    Y  PIA V    I R
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMK-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNGIDG--------RYYPYVFTKGYQQPIAMVKFDTIPR 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 97.0561 bits (240), Expect = 7.905e-23
Identity = 76/259 (29.34%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDS------TGPCAFDLSQLGPCQNGSL-QLANGTGL-CIYWHINNLYGWLPNISSSSGS---------KDG--LIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             +  Y+K +GT  GRT   W  + +F ++FY  L+ +F    +IF +  +  K+P   G  T+ G  PG  Y+P +    ++ ++  N  D  S++ Y KQ + Y+S Y  T    ++C    N+D+      T PC FDL        G+  Q    +G  C+   +N L GW P ++   GS         K G   I C G  S D + +G ++Y P   I G         Y+P++   SY  PIA V    I R
Sbjct:   13 AQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLR-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTN-ETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRP-VNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETGIDG--------RYYPYVFVPSYQQPIAMVKFDTIPR 260          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 97.4413 bits (241), Expect = 8.112e-23
Identity = 76/259 (29.34%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDS------TGPCAFDLSQLGPCQNGSL-QLANGTGL-CIYWHINNLYGWLPNISSSSGS---------KDG--LIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             +  Y+K +GT  GRT   W  + +F ++FY  L+ +F    +IF +  +  K+P   G  T+ G  PG  Y+P +    ++ ++  N  D  S++ Y KQ + Y+S Y  T    ++C    N+D+      T PC FDL        G+  Q    +G  C+   +N L GW P ++   GS         K G   I C G  S D + +G ++Y P   I G         Y+P++   SY  PIA V    I R
Sbjct:   27 AQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLR-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTN-ETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRP-VNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETGIDG--------RYYPYVFVPSYQQPIAMVKFDTIPR 274          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0332370)

HSP 1 Score: 101.679 bits (252), Expect = 2.382e-24
Identity = 69/254 (27.17%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVA---KIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSY-QYYKKQFELYISDYSKTQ-PNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNI------------------SSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
            E+ Y+ +EGTF GRT K W  L +F  +FY VLA     LFTI  +G++       P  +  ++L G  PG  +RP  +      V+  +   P+   Y+ +  + ++ DY+ T+  + K+C  G   + T  C  +    G C   +         CI+  +N ++GW+P +                  + +   +   + C G+   D +   +I+Y+PSQ           + Y+PFLNQ  YLSP+ AV
Sbjct:   26 EMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAA----LFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFP--------SYYYPFLNQPGYLSPLVAV 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0079384)

HSP 1 Score: 101.679 bits (252), Expect = 2.382e-24
Identity = 69/254 (27.17%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVA---KIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSY-QYYKKQFELYISDYSKTQ-PNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNI------------------SSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
            E+ Y+ +EGTF GRT K W  L +F  +FY VLA     LFTI  +G++       P  +  ++L G  PG  +RP  +      V+  +   P+   Y+ +  + ++ DY+ T+  + K+C  G   + T  C  +    G C   +         CI+  +N ++GW+P +                  + +   +   + C G+   D +   +I+Y+PSQ           + Y+PFLNQ  YLSP+ AV
Sbjct:   26 EMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAA----LFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFP--------SYYYPFLNQPGYLSPLVAV 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079382)

HSP 1 Score: 92.8189 bits (229), Expect = 4.227e-21
Identity = 67/271 (24.72%), Postives = 111/271 (40.96%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYR--PQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGP------CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLP----------------------NISSSSGSKDGLIF--CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            G+  Y+ ++GT  GR    W  + IF V FY VLA   AI    F +  +  +IP    + +L G  PG  +R  P +DN  +T++        +Y+++    + +++ Y          QN  N D   P      C  D+    PC   +    + +  CI+  +N +YGW+P                       +  +   K   I+  C G N +D + IG++ Y P +   G         ++P+ N + YLSP+ AV      R
Sbjct:   28 GQFLYNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQ-TLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRGFPGY--------FYPYQNSEGYLSPLVAVHFQRPKR 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079383)

HSP 1 Score: 92.8189 bits (229), Expect = 4.227e-21
Identity = 67/271 (24.72%), Postives = 111/271 (40.96%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYR--PQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGP------CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLP----------------------NISSSSGSKDGLIF--CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            G+  Y+ ++GT  GR    W  + IF V FY VLA   AI    F +  +  +IP    + +L G  PG  +R  P +DN  +T++        +Y+++    + +++ Y          QN  N D   P      C  D+    PC   +    + +  CI+  +N +YGW+P                       +  +   K   I+  C G N +D + IG++ Y P +   G         ++P+ N + YLSP+ AV      R
Sbjct:   28 GQFLYNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQ-TLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRGFPGY--------FYPYQNSEGYLSPLVAVHFQRPKR 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100381)

HSP 1 Score: 92.8189 bits (229), Expect = 4.227e-21
Identity = 67/271 (24.72%), Postives = 111/271 (40.96%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYR--PQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGP------CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLP----------------------NISSSSGSKDGLIF--CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            G+  Y+ ++GT  GR    W  + IF V FY VLA   AI    F +  +  +IP    + +L G  PG  +R  P +DN  +T++        +Y+++    + +++ Y          QN  N D   P      C  D+    PC   +    + +  CI+  +N +YGW+P                       +  +   K   I+  C G N +D + IG++ Y P +   G         ++P+ N + YLSP+ AV      R
Sbjct:   28 GQFLYNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQ-TLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRGFPGY--------FYPYQNSEGYLSPLVAVHFQRPKR 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3a [Source:ZFIN;Acc:ZDB-GENE-990415-167])

HSP 1 Score: 71.633 bits (174), Expect = 7.949e-14
Identity = 68/250 (27.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYR---PQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNAKN--CQNGSNSDSTGP-----CAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDS---YLSPIAAVFL 819
            +  Y+ + G   GRT ++WG + +F ++FY  LA  F     +FT  +M+          TLN   P +  R   P +  + N++ +  N +DP  Y  Y +  E ++  Y+ ++  AKN  C  G  S+  G      C F  S L  C   ++ +   A G   C+   +N + G  P       S D  I CT    S + K   +QY+P +       G+I   YFP+  + +   Y+ P+ AV L
Sbjct:   20 DAIYNPRTGELFGRTARNWGLILLFYLVFYGFLAAMF-----VFTLWVML---------QTLNDDTPKYRDRVASPGLVIRPNSLNIEFNRSDPLEYGQYVQHLESFLHQYNDSE-QAKNDLCMAGQYSEQDGESLKKVCQFKRSLLYSCSGMEDTTFGYAKGQP-CVIVKMNRIIGLKP-------SGDPYINCT----SKSVKPLQMQYFPHE-------GTIDRMYFPYYGKKTHKGYVQPLVAVKL 235          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 63.5438 bits (153), Expect = 4.907e-11
Identity = 65/266 (24.44%), Postives = 106/266 (39.85%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--CQNGS---NSDSTG-------PCAFDLSQLGPCQNGSLQL--ANGTGLCIYWHINNLYGWLPNISSSSGSKDG---LIFCTGYN--------SSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNITR 834
            E F++ +   FCGRT   WG + +F + FY  LAG F +   +  + +   +  ++   +T     PG   RP+ +      +        +++ Y +    ++S Y+ T    KN  C+        DS G        C F  S L  C   + +    +    CI   +N + G LP       +KDG    + C            + D+DK+G + YYP         G+    Y+P+     Q +Y  P+ AV   NITR
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDRLST-----PGMMIRPKGEQLE---IAYTTEYTETWERYVQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-------AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPN-------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITR 254          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 63.5438 bits (153), Expect = 4.907e-11
Identity = 65/266 (24.44%), Postives = 106/266 (39.85%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--CQNGS---NSDSTG-------PCAFDLSQLGPCQNGSLQL--ANGTGLCIYWHINNLYGWLPNISSSSGSKDG---LIFCTGYN--------SSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNITR 834
            E F++ +   FCGRT   WG + +F + FY  LAG F +   +  + +   +  ++   +T     PG   RP+ +      +        +++ Y +    ++S Y+ T    KN  C+        DS G        C F  S L  C   + +    +    CI   +N + G LP       +KDG    + C            + D+DK+G + YYP         G+    Y+P+     Q +Y  P+ AV   NITR
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDRLST-----PGMMIRPKGEQLE---IAYTTEYTETWERYVQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-------AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPN-------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITR 254          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 62.3882 bits (150), Expect = 1.290e-10
Identity = 61/255 (23.92%), Postives = 104/255 (40.78%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQ---------PNAKNCQNGSNSDSTGP---CAFDLSQLGPCQNGSLQL---ANGTGLCIYWHINNLYGWLPNISSSSGSKDG---LIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNIT 831
            + F++ +     GRT   WG + +F ++FY+ LAG F +     T  +M+  +   Q         PG   RP+ +      +V +  N  S++ Y +  + ++  Y+ +Q         P+  N Q  S +    P   C F+ + L  C   + +     +G   CI   +N + G  P        KDG    + C G    D + IG I Y+P      ++Y      Y+    Q +Y  P+ AV   NI+
Sbjct:   15 DFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGVFCL-----TMYVMLLTLDDYQPTWQDRLATPGMMIRPKGEALE---IVYSRENTESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKP-CILIKLNRVIGMKP-------GKDGQSPYVTC-GAKKEDAESIGEIAYFPPNGTFNLMY----YPYYGMKAQVNYSQPLVAVKFMNIS 248          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b3b (ATPase Na+/K+ transporting subunit beta 3b [Source:ZFIN;Acc:ZDB-GENE-001127-1])

HSP 1 Score: 62.003 bits (149), Expect = 1.690e-10
Identity = 60/246 (24.39%), Postives = 99/246 (40.24%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNAKN-CQNG-----SNSDSTGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFL 819
            +  Y+ + G F GRT   W  +F+F ++FY  LAG F +   +  + +      +R  +   N   PG   RP+      ++ +  N + P  Y  Y +  E ++  Y+ +   A   CQ G      + +    C F  SQL  C    + +   + G   CI   +N + G  P         D  I CT       D    +Q YP +       G I  ++FP+   +   +Y+ P+ AV L
Sbjct:   17 DFIYNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFTLTMWVMLQTLDDHTPKYR--DRVAN---PGLMIRPR------SLDIAFNRSIPQQYSKYVQHLEAFLQSYNDSLQEANEPCQEGMYFEQDDVEEKKVCQFKRSQLRQCSGLSDTTFGYSEGNP-CIIVKMNRVIGLKPR-------GDPHIACT----VKGDGTLQMQLYPDE-------GKIDKSFFPYYGKILHKNYVQPLVAVKL 232          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 67.0106 bits (162), Expect = 6.874e-12
Identity = 67/260 (25.77%), Postives = 106/260 (40.77%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKT--QPNAKNCQNG--SNSDSTG--------PCAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNIS-----GIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E  ++ +   F GRT   WG +  F ++FY+ L G FA+     +  +M+  I            +PG   RP+ D       ++ N    S+  Y  Q    +  Y+ T        C +G  +  D TG         C F  S LG C    + +   + G+  C+   +N +  + P +  S  +    I CTG  ++    +GS  YYPS N S     G   G++   YFP+     Q +Y  P+ AV   N+T
Sbjct:   19 EFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFAL-----SMYVMLQTIDEYTPKYWDRLTSPGLMIRPKTDTLEIVYSISGN---SSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSP-CLLIKMNKIINFYPGVIPSLSNTSITINCTGTTANMDQMLGSRTYYPSSNPSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLT 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 58.151 bits (139), Expect = 5.682e-9
Identity = 59/247 (23.89%), Postives = 97/247 (39.27%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPS-YQYYKKQFELYISDYSKTQPNAKN---------CQNGSNSDSTGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            +KKE    GR  + W  + +F  + Y  LAG FA+       G++    P+         P PG + RPQ    +N +    N ++ S +  Y +    ++ DY+      KN          Q G + +    C F  S L  C   ++ S   A G   CI   +N + G+       +GS   +        +D   +G I +YPS     + Y      Y+  L   +Y SP+ A+  + + R
Sbjct:   58 EKKE--VLGRDKRSWALILLFYSVLYCFLAGMFALCMY----GLLATISPYVPTYRERVFP-PGLTIRPQ----ANALYFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKP-CILIKMNRILGY------QAGSGIPIYVTCEVLKADMSYLGPISFYPSDKFDLMYY-----PYYGKLTHVNYTSPLIAMQFTGVKR 281          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 58.151 bits (139), Expect = 5.816e-9
Identity = 59/247 (23.89%), Postives = 97/247 (39.27%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPS-YQYYKKQFELYISDYSKTQPNAKN---------CQNGSNSDSTGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            +KKE    GR  + W  + +F  + Y  LAG FA+       G++    P+         P PG + RPQ    +N +    N ++ S +  Y +    ++ DY+      KN          Q G + +    C F  S L  C   ++ S   A G   CI   +N + G+       +GS   +        +D   +G I +YPS     + Y      Y+  L   +Y SP+ A+  + + R
Sbjct:   59 EKKE--VLGRDKRSWALILLFYSVLYCFLAGMFALCMY----GLLATISPYVPTYRERVFP-PGLTIRPQ----ANALYFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKP-CILIKMNRILGY------QAGSGIPIYVTCEVLKADMSYLGPISFYPSDKFDLMYY-----PYYGKLTHVNYTSPLIAMQFTGVKR 282          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 58.151 bits (139), Expect = 5.855e-9
Identity = 59/247 (23.89%), Postives = 97/247 (39.27%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPS-YQYYKKQFELYISDYSKTQPNAKN---------CQNGSNSDSTGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            +KKE    GR  + W  + +F  + Y  LAG FA+       G++    P+         P PG + RPQ    +N +    N ++ S +  Y +    ++ DY+      KN          Q G + +    C F  S L  C   ++ S   A G   CI   +N + G+       +GS   +        +D   +G I +YPS     + Y      Y+  L   +Y SP+ A+  + + R
Sbjct:   55 EKKE--VLGRDKRSWALILLFYSVLYCFLAGMFALCMY----GLLATISPYVPTYRERVFP-PGLTIRPQ----ANALYFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKP-CILIKMNRILGY------QAGSGIPIYVTCEVLKADMSYLGPISFYPSDKFDLMYY-----PYYGKLTHVNYTSPLIAMQFTGVKR 278          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: tpst2 (tyrosylprotein sulfotransferase 2 [Source:Xenbase;Acc:XB-GENE-962493])

HSP 1 Score: 56.225 bits (134), Expect = 2.427e-8
Identity = 68/264 (25.76%), Postives = 100/264 (37.88%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSK------------TQPNAKNCQNGSNSD--STGPCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGL----------IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFLSNIT 831
            DKKE  F GRT   W  + +F ++FY  LAG F     I T  +++  I   +         PG +  P    K+    +  +PNDP SY  Y +  E +IS YS             T P     + G N D      C F    L  C    + +   A G   C+   +N +  + P    ++     +          I C G    D   I  ++YY     +G         Y+P+   L Q  YL P+ AV  +N+T
Sbjct:   21 DKKE--FLGRTGGSWFKILLFYLIFYGCLAGIF-----IGTIQVLLLTISEYEPKYQDRVAPPGLTQVP----KAVKTEINFSPNDPDSYNDYVQSMEKFISKYSNENQVSDKFEDCGTMPGQYRERGGLNKDGGQKKSCVFRRQWLQNCSGIDDQTFGFAEGKP-CVIVKLNRIVAFKPVPPQNNSLPPEMTANYNPYVIPIHCQGKRDEDIPNIREVKYYGMGGFAGFPLN-----YYPYYGKLLQPEYLQPLIAVQFTNLT 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 60.4622 bits (145), Expect = 7.186e-10
Identity = 69/267 (25.84%), Postives = 104/267 (38.95%), Query Frame = 1
Query:  133 DKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSK----------------TQPNAKNCQNGSNSDSTGPCAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIF-----------CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPF---LNQDSYLSPIAAVFLSNIT 831
            +KKE  F GRT   W  + +F V+FY  LAG F     I T  +M+  I   +         PG +  PQ+        ++  PNDP SY+ Y      ++  Y                  ++P  +   N    +    C F L  LG C    + S     G   CI   +N + G+ P    +   +   +            CTG    D DK+G+I+Y+    + G  Y      Y+P+   L Q  YL P+ AV  +N+T
Sbjct:   20 EKKE--FLGRTGGSWFKILLFYVIFYGCLAGIF-----IGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTE----ISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERK-VCRFKLDWLGNCSGLNDDSYGYREGKP-CIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYF---GMGG--YYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLT 268          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b2 (ATPase, Na+/K+ transporting, beta 2 polypeptide [Source:MGI Symbol;Acc:MGI:88109])

HSP 1 Score: 58.5362 bits (140), Expect = 2.632e-9
Identity = 58/256 (22.66%), Postives = 104/256 (40.62%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKN--CQ---------NGSNSDSTGPCAFDLSQLGPCQ--NGSLQLANGTGL-CIYWHINNLYGWLPNISSSSGSKDGL-IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQD---SYLSPIAAVFLSNIT 831
            E  ++ +   F GRT   W F+ +F ++FY  L   F++     T  +M+  +             PG   RP+ +N    + V  N +D  S+  + ++   ++  Y+ +    KN  C+         NG  +     C F+ +QLG C            TG  C++  +N +      I+  +G+   + + C G    D + +G    +P+        GSI   YFP+  +    +Y  P+ AV   N+T
Sbjct:   19 EFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSL-----TMWVMLQTVSDHTPKYQDRLATPGLMIRPKTEN----LDVIVNISDTESWGQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRV------INFYAGANQSMNVTCVGKRDEDAENLGHFVMFPAN-------GSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVT 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b3 (ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:MGI Symbol;Acc:MGI:107788])

HSP 1 Score: 53.5286 bits (127), Expect = 1.225e-7
Identity = 45/172 (26.16%), Postives = 73/172 (42.44%), Query Frame = 1
Query:  130 YDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYS-KTQPNAKNCQNGSNSDSTGP----CAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPN 621
            Y+   G F GRT K WG + +F ++FY    G+ A LFT FT   M+  +           P+PG    P+           + P   +Y+   +  E ++  YS + Q N  +C +G+     GP    C F +S L  C    + +   + G   CI   +N +   +P+
Sbjct:   21 YNPSSGEFLGRTSKSWGLILLFYLVFY----GFLAALFT-FTMWAMLQTLNDEVPKYRDQIPSPGLMVFPKPQTALEYTFSMSEPQ--TYKKLVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQP-CILVKMNRIIDLIPD 184          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.995e-26
Identity = 74/256 (28.91%), Postives = 111/256 (43.36%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTG------PCAFDLSQLGP-CQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGL----------IFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            E  Y+KK GT  GRT K W  + +F ++FY+ LA ++    TIF K  +  K+P   G  T+ G  PG  Y+P +  + ++ ++  N  D  SY+ Y +Q + Y++ Y       + C  G ++D         PC FDLS     C   S         C+   +N L GW P     +   + +          I C G  + D + IG + Y PS  I G         Y+P++    Y  PIA V    I R
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMK-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNGIDG--------RYYPYVFTKGYQQPIAMVKFDTIPR 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q24046|ATPB1_DROME (Sodium/potassium-transporting ATPase subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=nrv1 PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.388e-23
Identity = 69/254 (27.17%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVA---KIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSY-QYYKKQFELYISDYSKTQ-PNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNI------------------SSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
            E+ Y+ +EGTF GRT K W  L +F  +FY VLA     LFTI  +G++       P  +  ++L G  PG  +RP  +      V+  +   P+   Y+ +  + ++ DY+ T+  + K+C  G   + T  C  +    G C   +         CI+  +N ++GW+P +                  + +   +   + C G+   D +   +I+Y+PSQ           + Y+PFLNQ  YLSP+ AV
Sbjct:   26 EMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAA----LFTICMQGLLSTISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGFGQVLEPTDVCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQGFP--------SYYYPFLNQPGYLSPLVAV 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.032e-21
Identity = 76/259 (29.34%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDS------TGPCAFDLSQLGPCQNGSL-QLANGTGL-CIYWHINNLYGWLPNISSSSGS---------KDG--LIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             +  Y+K +GT  GRT   W  + +F ++FY  L+ +F    +IF +  +  K+P   G  T+ G  PG  Y+P +    ++ ++  N  D  S++ Y KQ + Y+S Y  T    ++C    N+D+      T PC FDL        G+  Q    +G  C+   +N L GW P ++   GS         K G   I C G  S D + +G ++Y P   I G         Y+P++   SY  PIA V    I R
Sbjct:   27 AQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLR-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTN-ETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRP-VNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETGIDG--------RYYPYVFVPSYQQPIAMVKFDTIPR 274          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|A8X4W9|AT1B3_CAEBR (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis briggsae OX=6238 GN=nkb-3 PE=3 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 3.014e-20
Identity = 73/256 (28.52%), Postives = 112/256 (43.75%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND-PSYQYYKKQFELYISDYSKT----QPNAKNCQNGSNSD-STGPCAFDLSQLGPCQNGSL-QLANGTGL-CIYWHINNLYGWLP----------NISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            +  Y+K++GT  GRT   W  + +F ++FY  L+ +F     IF K  +  K+P   G  T+ G  PG  Y+P +    ++ ++  N  D  S++ Y KQ + Y S Y+ T    +  A++      +D  + PC FDL        G+  Q    +G  C+   +N L GW P           I S   S    I C G    D + +G ++Y P   I G         Y+P++   SY  PIA V    I R
Sbjct:   37 QFLYNKQKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLAIFLK-TLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDGYFSRYNNTNDTRECGAEDSNEALQTDPDSLPCRFDLGLFEKANCGAKDQYGFKSGKPCVVVSLNRLIGWRPVDYDGNSVPEEIKSRYKSGSITINCEGATPFDKEHLGKVKYIPEAGIDG--------RYYPYVFLPSYQQPIAMVKFDTIPR 283          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q24048|ATPB2_DROME (Sodium/potassium-transporting ATPase subunit beta-2 OS=Drosophila melanogaster OX=7227 GN=nrv2 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.034e-19
Identity = 65/270 (24.07%), Postives = 112/270 (41.48%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYR--PQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGP------CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLP----------------------NISSSSGSKDGLIF--CTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            ++ YD ++ ++ GR+   W  + IF V FY VLA   AI    F +  +  +IP    + +L G  PG  +R  P +DN  +T++        +Y+++    + +++ Y          QN  N D   P      C  D+    PC   +    + +  CI+  +N +YGW+P                       +  +   K   I+  C G N +D + IG++ Y P +   G         ++P+ N + YLSP+ AV      R
Sbjct:   30 QMVYDSEDNSYFGRSMDSWAKIGIFYVAFYGVLAALVAICMWAFFQ-TLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRGFPGY--------FYPYQNSEGYLSPLVAVHFQRPKR 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A5K3FFJ4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.320e-36
Identity = 78/242 (32.23%), Postives = 122/242 (50.41%), Query Frame = 1
Query:  130 YDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPS-YQYYKKQFELYISDYSKTQPNAK----NCQNGSNS--DSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
            YDKKE  F  RT   W ++ ++  +F+++L G+FA +  +F + ++  + P R G+ +L    PG   RP ++   N  +++ +  DP  Y  Y       +S Y +           C+NG  +  D    C FDLS+LGPC   +         C+   +N +YGW+P+++  S     L+ C G N  D   IG ++YYP  NI+G  YG   N YFPFL Q+ Y SP+  +   NIT+
Sbjct:   26 YDKKEKAFLTRTCSSWAYILLYYCVFFAILFGFFASMLAVFLQFMVPERYPMRTGDQSLLKFRPGLGIRPVINEDQN--IISFSEKDPQVYFEYIDNLNALLSYYEEVNQKPAIGFATCENGVKTPNDPYKVCRFDLSELGPCTKENSYGYESGKPCVILKLNRIYGWMPDVTDPSFPHT-LVSCRGQNPEDQVNIGPLKYYPGTNINGTEYGVFHNQYFPFLGQNGYTSPLVGLQFENITK 264          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: C4PY08 (Putative sodium/potassium-dependent atpase beta subunit OS=Schistosoma mansoni OX=6183 GN=Smp_124240 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.255e-34
Identity = 82/236 (34.75%), Postives = 124/236 (52.54%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKT--QPNAK--NCQ--NGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTGL-CIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
             YD K  T  GRT   W    +F +++Y+ LA +F  L  +          P R G  +L    PG  +RP +D + + I  +A+ +  +Y  Y +  + Y+  Y++   +P+++  NC+   G   D    C F L  LGPC N +     G G  C+   +N ++GW+P+I   S S D L+ C+G NS+D + IGS+ YYPS+N SG  YG   +AY+P+L Q  YL PI AV
Sbjct:   25 IYDPKNKTLFGRTCCSWILCILFYLVYYACLATFFTCLLWLVLYCNAPENQPARTGAQSLLDFKPGLGFRPLLDVQKSLIRYSAD-DAQTYLPYTQNMDAYLDTYNQVNAKPDSQFANCKGKEGETKDVDKVCKFPLEVLGPC-NTANNYGYGKGTPCVLLKVNKVFGWMPSIERPSQSNDILVSCSGQNSADEENIGSLAYYPSKNFSGKQYGVFSSAYYPYLGQAGYLGPIVAV 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A068XXJ4 (Sodium:potassium dependent atpase beta subunit OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000413500 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.182e-34
Identity = 79/245 (32.24%), Postives = 122/245 (49.80%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQY-YKKQFELYISDYSKTQPNAK------NCQNGSNS--DSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             Y+KK+ +F GRT   W  +F++   FY++L+G+F  +  +F + I+ AK+P R G+ +L    PG   RP +D     I  ++   DP   Y Y       IS Y +   N K      NC N   S  +    C FDL  LGPC   +         C+   +N +YGW+P+++ ++     L+ C G N  D + +G +++YPS   +G  YG   N YFPFL Q+ Y SP+ AV    + +
Sbjct:   25 LYNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSS--RDPQVYYEYVDNLNALISYYEEI--NVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAA-IPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEK 264          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: U6JI80 (Sodium/potassium-transporting ATPase subunit beta-2 OS=Echinococcus granulosus OX=6210 GN=EGR_08763 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.501e-34
Identity = 79/245 (32.24%), Postives = 122/245 (49.80%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQY-YKKQFELYISDYSKTQPNAK------NCQNGSNS--DSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             Y+KK+ +F GRT   W  +F++   FY++L+G+F  +  +F + I+ AK+P R G+ +L    PG   RP +D     I  ++   DP   Y Y       IS Y +   N K      NC N   S  +    C FDL  LGPC   +         C+   +N +YGW+P+++ ++     L+ C G N  D + +G +++YPS   +G  YG   N YFPFL Q+ Y SP+ AV    + +
Sbjct:   25 LYNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSS--RDPQVYYEYVDNLNALISYYEEI--NVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAA-IPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEK 264          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A074ZE31 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08326 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.275e-34
Identity = 78/242 (32.23%), Postives = 126/242 (52.07%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDS--TGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQ-NISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             + FY K++GT  GRTPK WG +F F ++ Y+ LAG+F  + ++F  G +  +IP   G  +L   +PG ++ P++   +  +  T  P+  +  Y +    L +S Y  +      C +G+ + +    PC F L+ LGPC      L  G   CIY  +N +YGWLP++++ +   +  I C G N     ++G  +Y+P     SG  Y  I + YFPF+ Q  Y +P+AAV   NI +
Sbjct:   14 AKFFYSKEDGTVLGRTPKSWGLIFAFYLVAYAFLAGFFVGMISVFMYGYVSNEIPTLTGKQSLLSLSPGVAFAPRVTTTTAFLQFTTFPSSINAPYVEGVRRL-LSRYEASNLTTV-CPDGAAAITFPEQPCQFPLTSLGPCAEPEASLKAGLP-CIYLRLNRVYGWLPDLANDTVFPEAAIGCYGQNDIAKFQLGDPEYFPQLVTPSGEKYAKIPSTYFPFIGQAGYQAPLAAVRFPNIMK 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 72.7886 bits (177), Expect = 3.393e-14
Identity = 68/254 (26.77%), Postives = 104/254 (40.94%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--C-------QNGSNSDSTGP---CAFDLSQLGPCQNGSLQL--ANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E F++ +   FCGRT   WG +F+F + FY  LAG F     I T  +M+  +   +         PG   RP+ +      ++ A  N  S+  + +    ++S Y+ +    KN  C       Q  S+S    P   C F  S L  C   + +    +    CI   +N + G LP     + S    I C      DTDK+G + Y+P         G+    YFP+     Q +Y  P+ A+   NIT
Sbjct:   12 EFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMF-----ILTMYVMLLTLDDNKPTYQDRLATPGLMIRPKGEEME---IIYAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPS----ISCAP-KIDDTDKMGEVAYFPRN-------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNIT 245          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 70.0922 bits (170), Expect = 3.258e-13
Identity = 69/265 (26.04%), Postives = 105/265 (39.62%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--C-------QNGSNSDSTGP---CAFDLSQLGPCQNGSLQL--ANGTGLCIYWHINNLYGWLPNISSSSGS-----------KDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E F++ +   FCGRT   WG +F+F + FY  LAG F     I T  +M+  +   +         PG   RP+ +      ++ A  N  S+  + +    ++S Y+ +    KN  C       Q  S+S    P   C F  S L  C   + +    +    CI   +N + G LP     + S           KD  I        DTDK+G + Y+P         G+    YFP+     Q +Y  P+ A+   NIT
Sbjct:   12 EFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMF-----ILTMYVMLLTLDDNKPTYQDRLATPGLMIRPKGEEME---IIYAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISCAPKKYKIGKDEWI-------DDTDKMGEVAYFPRN-------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNIT 254          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b3b (sodium/potassium-transporting ATPase subunit beta-3-like [Source:NCBI gene;Acc:103044362])

HSP 1 Score: 63.5438 bits (153), Expect = 4.718e-11
Identity = 62/246 (25.20%), Postives = 99/246 (40.24%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKT-QPNAKNCQNG------SNSDSTGPCAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDS---YLSPIAAVFL 819
            +  Y+ + G F GRT   W  +F+F ++FY  LAG F++   +  + +      +R         +PG   RP+     +  V  +NP    Y  Y +  E ++  Y+ T Q     C  G      +N      C F  SQL  C    + +   A G   C+   +N + G +P         D  I CT    +  D    +QY+PS+       G     YFP+  + +   Y+ P+ AV L
Sbjct:   17 DFIYNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFSLTMWVMLQTLNDYTPKYRD-----RVASPGLMIRPKY---FDIEVNRSNPQ--QYNKYVQGLESFLQQYNDTLQEQNTVCTEGDYYMQENNELVKNVCQFKRSQLRQCSGLADTNFGYAEGQP-CVLIKMNRIIGLVPR-------GDPYINCT----AKRDTPLQMQYFPSE-------GRFDKMYFPYYGKKAHPNYVQPVVAVKL 233          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 62.3882 bits (150), Expect = 8.590e-11
Identity = 64/252 (25.40%), Postives = 97/252 (38.49%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--C-------QNGSNSDSTGP---CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E F++ +   FCGRT   WG +F+F + FY  LAG F     I T  +M+  +   +         PG   RP+ +      ++ A  N  S+  + +    ++S Y+ +    KN  C       Q  S+S    P   C F  S L  C          +GL      +  YG+              I        DTDK+G + Y+P         G+    YFP+     Q +Y  P+ A+   NIT
Sbjct:   18 EFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMF-----ILTMYVMLLTLDDNKPTYQDRLATPGLMIRPKGEEME---IIYAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDC----------SGL-----TDRYYGY--------DEGKPCIIIKLNRIDDTDKMGEVAYFPRN-------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNIT 231          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 62.003 bits (149), Expect = 1.280e-10
Identity = 64/258 (24.81%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQ---------PNAKNCQNGSNSDSTGP---CAFDLSQLGPCQ---NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDG---LIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E F++ +     GRT   WG + +F ++FY+ LAG F +     T  +M+  +   +         PG   RP+    S+  +  +  N  S+  Y K    +++ Y  +Q         P+    Q  S S    P   C F+ + LG C    + +    +G   CI+  +N + G LP        KDG    + C G    D++ +G + Y+PS         S    Y+P+     Q +Y  P+ AV   N+T
Sbjct:   15 EFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGMFCL-----TMYVMLLTLDDYKPTWQDRLATPGLMIRPK---GSSMEIQYSKQNTESWDKYVKTLNSFLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKP-CIFIKLNRVIGMLP-------GKDGQSPYVTC-GAKREDSELLGDMAYFPSN-------ASFNLMYYPYYGKKAQVNYSQPLVAVKFLNLT 248          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Nematostella
Match: EDO32320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE8])

HSP 1 Score: 68.1662 bits (165), Expect = 4.566e-13
Identity = 61/251 (24.30%), Postives = 110/251 (43.82%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGP------------------CAFDLSQLGPCQNGSLQLANG--TGL-CIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
             Y+K++G   GR  + W  + +F ++FY  LAG+FA + +IF     ++ +P R     L     G   +P ++   +  +   +PN   SY  +      +++ Y +        Q G+N D   P                  C FDL+ LGPC         G  TG  C +  +N ++ ++P    +SG     + C   ++ D+ K   I+ YP +N    V      +++P+  +D++L+P+ AV
Sbjct:   28 LYNKEKGEVMGRNGQSWAKIGLFFLVFYLCLAGFFAAMLSIF-----LSTLPDRADGPKLTQYIAG---KPVLNPVPSNKIEGYDPNKASSYSSHVSDINSFLNQYVR--------QGGANKDQFAPDFCNGTSGEPRPKDAKKQCRFDLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNFVP--EPNSGLSYIKVEC---DAKDSSKNNLIKVYPEENPGWPV------SFYPYRMEDNWLAPVIAV 251          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:101166353])

HSP 1 Score: 68.5514 bits (166), Expect = 1.035e-12
Identity = 66/267 (24.72%), Postives = 112/267 (41.95%), Query Frame = 1
Query:  130 YDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQ----PNAKNC--------QNGSNSDSTG---PCAFDLSQLGPC---QNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGS---------KDGLI--FCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQD---SYLSPIAAVFLSNITR 834
            +D  +G F GRT   W  + +F V+F+  LAG F     +    +++    F+        P PG S+ P++D    +  +       +Y  + K    ++S Y  ++       +NC        + G+  D+ G    C F  + LGPC   ++ +    +G   C+   +N +  + P   SS+ S         +  LI  FCT     D DKIG I+YY        + G     Y+P+  +     YL P+ AV  +N+T+
Sbjct:   15 WDSDKGEFMGRTGGSWFKITLFYVVFFGCLAGVFVGTIQV----MLLTLNDFKPTWQDRVAP-PGLSHTPKLDKAEVSYSIKGI---ETYLPFTKTLREFVSQYDDSKQLDASKFENCPAEPADYKERGTLDDNAGVRKACRFSRTLLGPCSGLEDETFGFKDGKP-CVIVKLNRIVNFRPRPPSSNDSIPEEAWPKVQPNLIPLFCTNKREEDADKIGEIKYYG-------INGGFPLQYYPYYGKRLHPHYLQPLVAVQFTNLTQ 265          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 65.0846 bits (157), Expect = 1.537e-11
Identity = 65/254 (25.59%), Postives = 100/254 (39.37%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKN--C-------QNGSNSDSTGP---CAFDLSQLGPCQ--NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E  ++ +   F GRT   WG + +F ++FY  LAG FA+   I  + +   K  ++    T     PG   RP  D      +V    N  S+  Y +  + +++ Y+ T    KN  C       Q  S      P   C F+ + L  C   N           CI   +N + G LP     + S    + C      D+DK+G + Y+P         G+    Y+P+     Q +Y  P+ AV   NIT
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTLDDHKPTWQDRLAT-----PGMVIRPNTDETFE--IVYNIQNTESWDMYAQALDKFLAPYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPS----VTCAA-KRDDSDKLGELVYFPPN-------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNIT 245          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:101157248])

HSP 1 Score: 61.2326 bits (147), Expect = 2.279e-10
Identity = 64/248 (25.81%), Postives = 100/248 (40.32%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILF--TIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDP-SYQYYKKQFELYISDYSKT-QPNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTG----------LCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQ---DSYLSPIAAVFL 819
             Y+ + G   GRT   W  + +F ++FY  LAG FA+     +FT    V K   R        P PG   RP      N++ ++ N +DP  Y  Y +  E ++  Y+ + Q   +NC +G      GP +  + +  P +   L   +G             C+   +N + G  P+        +  I CT        K   IQ Y S N      G I   +FP+  +   ++YL P+ AV L
Sbjct:   21 IYNPRTGELMGRTASSWALILLFYLVFYCFLAGLFALTMWVLLFTLDDYVPKYRDRV-------PYPGLVIRP------NSLDISFNKSDPLKYAQYVQHLEKFLERYNDSAQEKNENCISGEFYLQDGPISM-VRRACPFRRALLSFCSGLSDTNYGYQEGKPCVILKMNRIIGLKPD-------GEPYINCT------VKKDHPIQMYYSPN-----NGQIDKMFFPYYGKKAHENYLQPLVAVKL 236          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 58.151 bits (139), Expect = 3.122e-9
Identity = 61/248 (24.60%), Postives = 91/248 (36.69%), Query Frame = 1
Query:  121 EVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQF---ELYISDYSKTQPNAKNCQNGSNSDSTGP---CAFDLSQLGPCQ--NGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLN---QDSYLSPIAAVFLSNIT 831
            E  ++ +   F GRT   WG + +F ++FY  LAG FA+   I  + +   K  ++    T     PG   RP  D     +    N       Y K       L      +  P+    Q  S      P   C F+ + L  C   N           CI   +N + G LP     + S    + C      D+DK+G + Y+P         G+    Y+P+     Q +Y  P+ AV   NIT
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTLDDHKPTWQDRLAT-----PGMVIRPNTDETFEIVYNIQNTESWDIFYIKADSYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPS----VTCAA-KRDDSDKLGELVYFPPN-------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNIT 241          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000032752.1 (SMESG000032752.1)

HSP 1 Score: 506.523 bits (1303), Expect = 0.000e+0
Identity = 266/269 (98.88%), Postives = 267/269 (99.26%), Query Frame = 1
Query:  118 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITRXXXXXXXXXXXXXXXMAVNSMTIAVKLNTL 924
            GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPND SYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSL LANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSI+NAYFPFLNQDSYLSPIAAVFLSNITRNVQVNLVCNLINVINMAVNSMTIAVKLNTL
Sbjct:   29 GEVFYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDLSYQYYKKQFELYISDYSKTQPNAKNCQNGSNSDSTGPCAFDLSQLGPCQNGSLPLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIQNAYFPFLNQDSYLSPIAAVFLSNITRNVQVNLVCNLINVINMAVNSMTIAVKLNTL 297          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000064593.1 (SMESG000064593.1)

HSP 1 Score: 162.155 bits (409), Expect = 2.562e-47
Identity = 86/232 (37.07%), Postives = 127/232 (54.74%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSN---SDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
             Y+ K+GT CGRTPK WG + +F ++FYS L+G+F  + ++F  G +    P R G N++    PG +  P+  N+S  IV + N +   Y+ Y K    ++  Y+    +   C    +    + T  C FDLS LGPC N   +L  G  LC+Y   N +YGWLP I + + S D LI C G N  DT+ +G  ++YPS   +   YG I N ++PF+ Q +Y SP+ AV
Sbjct:   28 LYNNKKGTICGRTPKSWGLICVFYLIFYSCLSGFFLGMISVFMYGFVSKMEPMRTGRNSILTFTPGVNANPRSTNESALIVGSTNKDSKLYKNYLKMANEFLKKYTLNPVDGVKCNETVDQTPKNLTKFCKFDLSLLGPCANPEAELDKGL-LCVYVRPNKIYGWLPQIENPNLSNDILIECDGQNPGDTNNLGKPKFYPSYTNNTKTYGRIPNMFYPFVMQRNYSSPMVAV 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000064592.1 (SMESG000064592.1)

HSP 1 Score: 150.599 bits (379), Expect = 7.897e-43
Identity = 82/243 (33.74%), Postives = 124/243 (51.03%), Query Frame = 1
Query:  127 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGSN-SDSTGP------CAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAVFLSNITR 834
             Y+++ G  CGRT  +W  L ++ + FY VL  +F  +  IF   I+  K PFR G N++    PG +  P+M  +S  I+ T+N ++P +  Y      +   + KT P+ +N   G N SD   P      C F+ + LGPC +   +L +G  LC+Y  +N +YGWLP I   + S +  + C G    D + +G   YYP      I YG I N YFPF NQ +Y SP  A+    +++
Sbjct:   30 LYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKF---FLKTFPDLQNSSAGLNCSDDRTPTNISNFCIFNKTMLGPCADPEKELKSG-KLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSK 268          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000061673.1 (SMESG000061673.1)

HSP 1 Score: 137.502 bits (345), Expect = 9.493e-38
Identity = 77/237 (32.49%), Postives = 131/237 (55.27%), Query Frame = 1
Query:  124 VFYDKKEGTFCGRTPKDWG-FLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSK----TQPNAKNCQNGSNS--DSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
            + Y+K E  + GRTP DWG F+ +FL+L  S++A +  + F +FT+G++    PFR G+++     P  S+RP +D K+  ++  A+ +  +Y  Y +    +I  Y      ++ +   C +G  +  D   PC F++ QL  C        + T  C++  +N +YGW+P++++SS SKD L+ C G N  D +   +I YYP+  ++G +YG   N Y+P+L Q  Y  PI A+
Sbjct:   31 LIYNKNENKYLGRTPNDWGKFILLFLMLVGSLIAIFVGMFF-MFTEGVIDEDRPFRTGSHSALQNIPSLSFRPVIDFKT-ALIRYADSDPSTYMGYIQSMRTFIQTYEDADLISEDSYATCIDGKKTPDDINRPCRFNILQLDRCIKQYNFGYDRTKPCVFLKLNKVYGWVPDVTNSSVSKDVLVTCGGQNLEDIEYFPNILYYPNVTVNGNIYGYFSNLYYPYLVQYGYRQPIIAL 265          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000061672.1 (SMESG000061672.1)

HSP 1 Score: 135.961 bits (341), Expect = 1.333e-37
Identity = 78/241 (32.37%), Postives = 126/241 (52.28%), Query Frame = 1
Query:  124 VFYDKKEGTFCGRTPKDW----GFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDPS-YQYYKKQFELYISDYSK----TQPNAKNCQNGSNS--DSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQDSYLSPIAAV 813
            + YD     F GR+  DW     F FI L+L   +  G    +F +FT+G++   +P+R G N++    P  S+RP +D K  T ++  +  DPS Y  Y +     +  Y      ++ +   C +G  +  D T PC F++ QL  C        + T  C+   +N ++GWLP+I++SS SKD LI C G N+ D +   +++YYP+  I+G+VYG + + Y+P+L Q  Y  P+  V
Sbjct:    1 MIYDSANKKFLGRSKIDWVKFLAFFFICLILMIIIFIG----MFFLFTEGVINEDVPYRTGLNSILKNIPNLSFRPVIDFK--TALIRYSDADPSTYMLYIQSMRALVQTYEDADLISEDSYATCIDGKKTPDDITKPCRFNILQLDRCIKQYNFGYDRTKPCVLIKMNRIFGWLPDIANSSFSKDILIKCAGQNAEDVENFNTVRYYPNVTINGVVYGYMSSLYYPYLVQYGYRQPLVGV 235          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B13.847e-1025.76ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B13.847e-1025.76ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B21.269e-923.05ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
ATP1B32.615e-925.82ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
ATP1B44.301e-621.18ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-11.568e-2728.91Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.568e-2728.91Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.568e-2728.91Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-37.905e-2329.34Probable sodium/potassium-transporting ATPase subu... [more]
nkb-38.112e-2329.34Probable sodium/potassium-transporting ATPase subu... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv12.382e-2427.17gene:FBgn0015776 transcript:FBtr0332370[more]
nrv12.382e-2427.17gene:FBgn0015776 transcript:FBtr0079384[more]
nrv24.227e-2124.72gene:FBgn0015777 transcript:FBtr0079382[more]
nrv24.227e-2124.72gene:FBgn0015777 transcript:FBtr0079383[more]
nrv24.227e-2124.72gene:FBgn0015777 transcript:FBtr0100381[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b3a7.949e-1427.20ATPase Na+/K+ transporting subunit beta 3a [Source... [more]
atp1b2b4.907e-1124.44ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2b4.907e-1124.44ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2a1.290e-1023.92ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b3b1.690e-1024.39ATPase Na+/K+ transporting subunit beta 3b [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam151a6.874e-1225.77family with sequence similarity 151 member A [Sour... [more]
ATP1B45.682e-923.89pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B45.816e-923.89pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B45.855e-923.89pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
tpst22.427e-825.76tyrosylprotein sulfotransferase 2 [Source:Xenbase;... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Atp1b17.186e-1025.84ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
Atp1b22.632e-922.66ATPase, Na+/K+ transporting, beta 2 polypeptide [S... [more]
Atp1b31.225e-726.16ATPase, Na+/K+ transporting, beta 3 polypeptide [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93235|AT1B1_CAEEL1.995e-2628.91Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|Q24046|ATPB1_DROME2.388e-2327.17Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|Q9XUY5|AT1B3_CAEEL1.032e-2129.34Probable sodium/potassium-transporting ATPase subu... [more]
sp|A8X4W9|AT1B3_CAEBR3.014e-2028.52Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q24048|ATPB2_DROME3.034e-1924.07Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FFJ41.320e-3632.23Uncharacterized protein OS=Mesocestoides corti OX=... [more]
C4PY081.255e-3434.75Putative sodium/potassium-dependent atpase beta su... [more]
A0A068XXJ42.182e-3432.24Sodium:potassium dependent atpase beta subunit OS=... [more]
U6JI802.501e-3432.24Sodium/potassium-transporting ATPase subunit beta-... [more]
A0A074ZE314.275e-3432.23Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b3.393e-1426.77sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b3.258e-1326.04sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3b4.718e-1125.20sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b8.590e-1125.40sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2a1.280e-1024.81sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323204.566e-1324.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp1b1b1.035e-1224.72sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b1.537e-1125.59ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b3a2.279e-1025.81ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
atp1b2b3.122e-924.60ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032752.10.000e+098.88SMESG000032752.1[more]
SMESG000064593.12.562e-4737.07SMESG000064593.1[more]
SMESG000064592.17.897e-4333.74SMESG000064592.1[more]
SMESG000061673.19.493e-3832.49SMESG000061673.1[more]
SMESG000061672.11.333e-3732.37SMESG000061672.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034787 ID=SMED30034787|Name=Sodium/potassium-transporting ATPase subunit beta-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1046bp
CTGAATGCGATTTGAATAAATTTATAATTTATAATGTCATCCAATGAGAA
GCATGTTGAAACGCTTGAGGTCGAGGTGAAAAAGAAGAAGAAGAAATCTT
TGTCTTGTAAAAAGGTAGGAGAAGTATTTTACGACAAAAAGGAGGGAACA
TTTTGTGGACGAACTCCGAAGGATTGGGGGTTTCTCTTCATTTTCCTTGT
GCTGTTTTACTCGGTTTTGGCGGGTTATTTTGCCATTCTCTTTACGATAT
TCACTAAGGGAATCATGGTGGCCAAAATACCATTTAGGCAAGGCAACAAT
ACCCTCAATGGACCGGCGCCAGGGTTCAGCTACCGGCCACAAATGGACAA
CAAATCCAATACAATAGTCGTTACCGCCAATCCCAACGACCCGTCCTATC
AATATTATAAAAAGCAATTCGAGCTATATATCAGCGATTACTCCAAAACT
CAACCAAACGCGAAGAATTGTCAAAATGGCAGCAACTCAGATTCAACAGG
TCCATGTGCATTTGACCTCAGTCAACTGGGACCGTGTCAGAACGGCTCAT
TACAGCTGGCAAATGGGACAGGATTGTGCATTTATTGGCACATCAACAAT
CTGTACGGTTGGCTGCCAAATATTTCCAGCTCCAGCGGCAGCAAGGACGG
GCTCATTTTTTGCACTGGATATAACTCCAGCGATACCGACAAAATCGGAT
CAATCCAATACTATCCTTCACAGAACATCAGTGGTATTGTTTACGGCTCA
ATCAAGAATGCCTATTTTCCTTTCCTGAATCAAGATTCCTATCTGAGTCC
GATCGCAGCTGTCTTCCTGTCGAATATAACGAGAAATGTCCAAGTGAATC
TCGTATGCAATTTGATCAACGTGATAAACATGGCCGTTAACTCAATGACG
ATAGCAGTCAAGCTCAACACTCTCTAACCTGATATGAAGAACAGAACTCA
TTTTCTATATTTGTATTCTTTGATAGGTTAAAGTTATTCTTTGGGACATT
TCTCTCAAAATATTTTGTTTATTGAGAATAAATTAATGAGTTTAAA
back to top

protein sequence of SMED30034787-orf-1

>SMED30034787-orf-1 ID=SMED30034787-orf-1|Name=SMED30034787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MSSNEKHVETLEVEVKKKKKKSLSCKKVGEVFYDKKEGTFCGRTPKDWGF
LFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSY
RPQMDNKSNTIVVTANPNDPSYQYYKKQFELYISDYSKTQPNAKNCQNGS
NSDSTGPCAFDLSQLGPCQNGSLQLANGTGLCIYWHINNLYGWLPNISSS
SGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIKNAYFPFLNQ
DSYLSPIAAVFLSNITRNVQVNLVCNLINVINMAVNSMTIAVKLNTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006814sodium ion transport
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 18..278
e-value: 2.0E-42
score: 145.3
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 12..277
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 15..296
e-value: 1.8E-49
score: 170.7
NoneNo IPR availableTMHMMTMhelixcoord: 50..72