Ras-associating domain-containing protein

Overview
NameRas-associating domain-containing protein
Smed IDSMED30034775
Length (bp)2250
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-associating domain-containing protein (SMED30034775) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-associating domain-containing protein (SMED30034775) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-associating domain-containing protein (SMED30034775) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-associating domain-containing protein (SMED30034775) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034775

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034775SMESG000002146.1 Contig5459GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034775SMESG000002146.1 Contig5459GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30034775SMESG000002146.1 Contig5459GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034775SMESG000002146.1 Contig37621uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034775SMESG000002146.1 Contig37621newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30034775SMESG000002146.1 dd_Smed_v4_3216_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Match: RAPH1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:HGNC Symbol;Acc:HGNC:14436])

HSP 1 Score: 112.079 bits (279), Expect = 6.212e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  293 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 545          
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Match: RAPH1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:HGNC Symbol;Acc:HGNC:14436])

HSP 1 Score: 112.079 bits (279), Expect = 6.801e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  320 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 572          
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Match: RAPH1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:HGNC Symbol;Acc:HGNC:14436])

HSP 1 Score: 111.694 bits (278), Expect = 6.907e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  268 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 520          
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Match: RAPH1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:HGNC Symbol;Acc:HGNC:14436])

HSP 1 Score: 111.694 bits (278), Expect = 7.198e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  268 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 520          
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Match: RAPH1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:HGNC Symbol;Acc:HGNC:14436])

HSP 1 Score: 111.694 bits (278), Expect = 7.342e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  268 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 520          
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Match: mig-10 (Abnormal cell migration protein 10 [Source:UniProtKB/Swiss-Prot;Acc:P34400])

HSP 1 Score: 106.686 bits (265), Expect = 1.255e-23
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  213 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 464          
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Match: mig-10 (Abnormal cell migration protein 10 [Source:UniProtKB/Swiss-Prot;Acc:P34400])

HSP 1 Score: 106.686 bits (265), Expect = 1.255e-23
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  213 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 464          
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Match: mig-10 (Abnormal cell migration protein 10 [Source:UniProtKB/Swiss-Prot;Acc:P34400])

HSP 1 Score: 106.686 bits (265), Expect = 1.255e-23
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  213 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 464          
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Match: mig-10 (Abnormal cell migration protein 10 [Source:UniProtKB/Swiss-Prot;Acc:P34400])

HSP 1 Score: 106.686 bits (265), Expect = 1.325e-23
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  196 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 447          
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Match: mig-10 (Abnormal cell migration protein 10 [Source:UniProtKB/Swiss-Prot;Acc:P34400])

HSP 1 Score: 106.686 bits (265), Expect = 1.325e-23
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  196 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 447          
BLAST of Ras-associating domain-containing protein vs. Ensembl Fly
Match: pico (gene:FBgn0261811 transcript:FBtr0303995)

HSP 1 Score: 128.642 bits (322), Expect = 4.349e-30
Identity = 75/257 (29.18%), Postives = 135/257 (52.53%), Query Frame = 2
Query: 1052 PMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL-GENYPLGAMNVDAIKNL-----FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPY--SIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQM 1798
            P+++  V+ F+SD  +K+L++++ M    V ++L +KN        A+VE +  L+MER FE+HE+L+D + +W S   N + F+QR D   LF   + YL G     G  + +  + +     F + + +Q D    +Y+K   +  WKR   +L  +G+    K+K+K  +     + L   + +YT   GW K+W +PT + F FK    S +      + M CA D  ++ RW + +R+CKY  Q+ ++++ +
Sbjct:  315 PIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQTRQMLLDEFFDSHNQLQMD--GPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRD-LACLNLFHGHNVYTGL-GWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSL 567          
BLAST of Ras-associating domain-containing protein vs. Ensembl Fly
Match: pico (gene:FBgn0261811 transcript:FBtr0074805)

HSP 1 Score: 128.257 bits (321), Expect = 4.476e-30
Identity = 75/257 (29.18%), Postives = 135/257 (52.53%), Query Frame = 2
Query: 1052 PMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL-GENYPLGAMNVDAIKNL-----FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPY--SIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQM 1798
            P+++  V+ F+SD  +K+L++++ M    V ++L +KN        A+VE +  L+MER FE+HE+L+D + +W S   N + F+QR D   LF   + YL G     G  + +  + +     F + + +Q D    +Y+K   +  WKR   +L  +G+    K+K+K  +     + L   + +YT   GW K+W +PT + F FK    S +      + M CA D  ++ RW + +R+CKY  Q+ ++++ +
Sbjct:  236 PIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQTRQMLLDEFFDSHNQLQMD--GPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRD-LACLNLFHGHNVYTGL-GWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSL 488          
BLAST of Ras-associating domain-containing protein vs. Ensembl Fly
Match: pico (gene:FBgn0261811 transcript:FBtr0303996)

HSP 1 Score: 128.257 bits (321), Expect = 4.476e-30
Identity = 75/257 (29.18%), Postives = 135/257 (52.53%), Query Frame = 2
Query: 1052 PMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL-GENYPLGAMNVDAIKNL-----FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPY--SIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQM 1798
            P+++  V+ F+SD  +K+L++++ M    V ++L +KN        A+VE +  L+MER FE+HE+L+D + +W S   N + F+QR D   LF   + YL G     G  + +  + +     F + + +Q D    +Y+K   +  WKR   +L  +G+    K+K+K  +     + L   + +YT   GW K+W +PT + F FK    S +      + M CA D  ++ RW + +R+CKY  Q+ ++++ +
Sbjct:  236 PIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQTRQMLLDEFFDSHNQLQMD--GPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRD-LACLNLFHGHNVYTGL-GWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSL 488          
BLAST of Ras-associating domain-containing protein vs. Ensembl Fly
Match: pico (gene:FBgn0261811 transcript:FBtr0074804)

HSP 1 Score: 128.257 bits (321), Expect = 4.831e-30
Identity = 75/257 (29.18%), Postives = 135/257 (52.53%), Query Frame = 2
Query: 1052 PMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL-GENYPLGAMNVDAIKNL-----FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPY--SIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQM 1798
            P+++  V+ F+SD  +K+L++++ M    V ++L +KN        A+VE +  L+MER FE+HE+L+D + +W S   N + F+QR D   LF   + YL G     G  + +  + +     F + + +Q D    +Y+K   +  WKR   +L  +G+    K+K+K  +     + L   + +YT   GW K+W +PT + F FK    S +      + M CA D  ++ RW + +R+CKY  Q+ ++++ +
Sbjct:  364 PIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQTRQMLLDEFFDSHNQLQMD--GPLYMKADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRD-LACLNLFHGHNVYTGL-GWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHKSL 616          
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Match: raph1b (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1b [Source:ZFIN;Acc:ZDB-GENE-090311-54])

HSP 1 Score: 117.472 bits (293), Expect = 1.768e-26
Identity = 70/256 (27.34%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  TV  V+  L++K+    S   A+VE +P L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K+  + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  285 VKKLVIRVHMSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSPDWALVETIPELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGSSVSVPEIEGVLWLKEDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEAMKRT 537          
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Match: raph1b (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1b [Source:ZFIN;Acc:ZDB-GENE-090311-54])

HSP 1 Score: 115.931 bits (289), Expect = 5.435e-26
Identity = 69/256 (26.95%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  TV  ++  L++K+    S   A+VE +P L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K+  + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  285 VKKLVIRVHMSDESSKTMMVDERQTVRQLLDSLLDKSHCGYSPDWALVETIPELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGSSVSVPEIEGVLWLKEDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYVNYQEAMKRT 537          
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Match: wu:fj59g11 (wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202])

HSP 1 Score: 111.309 bits (277), Expect = 7.604e-25
Identity = 69/256 (26.95%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ VVR   SD+++K +++++  TV  V+  L++K+    SL  ++VE +  L+MER FE+HE L++ + +W    +N + F +R + Y LF+N + YL    E   +   N +A ++  F   +    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L D   +Y     +  ++ APT +    K +  +  KS  +   C  D   + +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  347 VKKLVVRVHLSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSLDWSLVEIITELQMERIFEDHENLVENLLNWTRDSTNRLMFIERIEKYALFKNPQNYLLGRKETCEMADRNKEALLEECFGGSTISVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQL-DHVNVYLGQ-DYRSKYKAPTDYCMVLK-HPQIQKKSQYIKYLCCDDVRMLHQWVNGIRIAKYGKQLYVNYQEAMRRT 599          
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Match: wu:fj59g11 (wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202])

HSP 1 Score: 109.768 bits (273), Expect = 4.615e-24
Identity = 69/256 (26.95%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ VVR   SD+++K +++++  TV  V+  L++K+    SL  ++VE +  L+MER FE+HE L++ + +W    +N + F +R + Y LF+N + YL    E   +   N +A ++  F   +    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L D   +Y     +  ++ APT +    K +  +  KS  +   C  D   + +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  326 VKKLVVRVHLSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSLDWSLVEIITELQMERIFEDHENLVENLLNWTRDSTNRLMFIERIEKYALFKNPQNYLLGRKETCEMADRNKEALLEECFGGSTISVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQL-DHVNVYLGQ-DYRSKYKAPTDYCMVLK-HPQIQKKSQYIKYLCCDDVRMLHQWVNGIRIAKYGKQLYVNYQEAMRRT 578          
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Match: wu:fj59g11 (wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202])

HSP 1 Score: 109.768 bits (273), Expect = 4.940e-24
Identity = 69/256 (26.95%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ VVR   SD+++K +++++  TV  V+  L++K+    SL  ++VE +  L+MER FE+HE L++ + +W    +N + F +R + Y LF+N + YL    E   +   N +A ++  F   +    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L D   +Y     +  ++ APT +    K +  +  KS  +   C  D   + +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  301 VKKLVVRVHLSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSLDWSLVEIITELQMERIFEDHENLVENLLNWTRDSTNRLMFIERIEKYALFKNPQNYLLGRKETCEMADRNKEALLEECFGGSTISVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQL-DHVNVYLGQ-DYRSKYKAPTDYCMVLK-HPQIQKKSQYIKYLCCDDVRMLHQWVNGIRIAKYGKQLYVNYQEAMRRT 553          
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Match: nr1d2 (nuclear receptor subfamily 1 group D member 2 [Source:Xenbase;Acc:XB-GENE-478410])

HSP 1 Score: 108.997 bits (271), Expect = 4.527e-24
Identity = 68/255 (26.67%), Postives = 127/255 (49.80%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N + +    +  S++  D           + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + LR+ KY  Q+  NYQ+   R+
Sbjct:  312 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKYALFKNPQNYLLGRKETSEMADRNKEVLLEECFCGSSVTDD----------GKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQ--DYRSKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGLRIAKYGKQLYTNYQEALKRT 553          
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Match: nr1d2 (nuclear receptor subfamily 1 group D member 2 [Source:Xenbase;Acc:XB-GENE-478410])

HSP 1 Score: 108.227 bits (269), Expect = 1.568e-23
Identity = 68/255 (26.67%), Postives = 127/255 (49.80%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N + +    +  S++  D           + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + LR+ KY  Q+  NYQ+   R+
Sbjct:  295 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKYALFKNPQNYLLGRKETSEMADRNKEVLLEECFCGSSVTDD----------GKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQ--DYRSKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGLRIAKYGKQLYTNYQEALKRT 536          
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Match: nr1d2 (nuclear receptor subfamily 1 group D member 2 [Source:Xenbase;Acc:XB-GENE-478410])

HSP 1 Score: 108.227 bits (269), Expect = 1.983e-23
Identity = 68/255 (26.67%), Postives = 127/255 (49.80%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N + +    +  S++  D           + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + LR+ KY  Q+  NYQ+   R+
Sbjct:  311 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKYALFKNPQNYLLGRKETSEMADRNKEVLLEECFCGSSVTDD----------GKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQ--DYRSKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGLRIAKYGKQLYTNYQEALKRT 552          
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Match: nr1d2 (nuclear receptor subfamily 1 group D member 2 [Source:Xenbase;Acc:XB-GENE-478410])

HSP 1 Score: 107.842 bits (268), Expect = 2.568e-23
Identity = 68/255 (26.67%), Postives = 127/255 (49.80%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N + +    +  S++  D           + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + LR+ KY  Q+  NYQ+   R+
Sbjct:  270 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLMFVERIEKYALFKNPQNYLLGRKETSEMADRNKEVLLEECFCGSSVTDD----------GKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYYGQ--DYRSKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGLRIAKYGKQLYTNYQEALKRT 511          
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Match: apbb1ip (Fc receptor-like protein 4 [Source:Xenbase;Acc:XB-GENE-5960290])

HSP 1 Score: 102.449 bits (254), Expect = 2.159e-22
Identity = 71/293 (24.23%), Postives = 143/293 (48.81%), Query Frame = 2
Query:  992 ESSKEMKTFPSTDAISERPDPMKQT-----VVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQ-YLGE--NYPLGAMN----VDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYT 1834
            ++ +E+++   TD I      MK+      +V+   +D +TK L++++   V  V+  L EK     S++ ++ E +P L++ERFFE+HE +++ ++ W     N I F Q+ + Y +F+N +  Y+    +  +  MN    V  ++  F   S +  + +  +Y+K+  + +WK+++ LL  +GI  + K K+K  +     ++  +    Y T   +  ++ APT   F  K +  +  +S  +   C  D   + +W + +R+ KY   +  NY+    R    S+  T
Sbjct:  122 KTQEELESKAKTDKIKLALSKMKEAKVKKRIVKIHMTDGSTKTLMVDELQAVRDVLDNLFEKTHCDCSIEWSLFEVIPELQIERFFEDHENVVELLSDWTRDSENTINFLQKNEKYAVFKNPQNFYMARKGSADVKDMNEKNKVSLLEQSFCGASVIVPELEAALYLKEDGKKSWKKRYFLLRASGIYYVPKGKTKTSRDLACFVQFDNVNVYYGTQ--YKLKYKAPTDHCFVLK-HPQIQKESQYIKYLCCEDPWVLHQWVTGIRIAKYGKVLYENYKAAVQRGGLASHWST 411          
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Match: Raph1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:MGI Symbol;Acc:MGI:1924550])

HSP 1 Score: 113.62 bits (283), Expect = 1.646e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT    A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  321 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDCCLALK-HPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRT 573          
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Match: Raph1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:MGI Symbol;Acc:MGI:1924550])

HSP 1 Score: 113.235 bits (282), Expect = 1.745e-25
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT    A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  321 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDCCLALK-HPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRT 573          
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Match: Raph1 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:MGI Symbol;Acc:MGI:1924550])

HSP 1 Score: 111.309 bits (277), Expect = 1.570e-24
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT    A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  269 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQD--YRNKYKAPTDCCLALK-HPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRT 521          
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Match: Grb7 (growth factor receptor bound protein 7 [Source:MGI Symbol;Acc:MGI:102683])

HSP 1 Score: 96.2857 bits (238), Expect = 2.862e-20
Identity = 72/275 (26.18%), Postives = 121/275 (44.00%), Query Frame = 2
Query: 1049 DPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYP-----------LGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENT----WKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNL 1828
            D  +  VV+ +S D   +++ +    T   V ++L+++   +      +VE  P L +ER  E+HE +++   +WP    +   F +    Y LF++    L   +P            G  + D I+N     S    + Q ++ ++     +    WKR FC L  +G+    K  SK  + H   +   ++  +Y  T G  K +  PT FGF  KP  + +     + +FC+ DE S   W +  RL KY  Q+  NYQQ Q R +  S L
Sbjct:   96 DSSRLCVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDESWGLVESHPYLALERGLEDHEFVVEVQEAWPVGGDSRFIFRKNFAKYELFKSPPHTL---FPEKMVSSCLDAQTGISHEDLIQNFLNAGSFP--EIQGFLQLRGSGRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPR-HLQYVADVNESNVYVVTQG-RKLYGMPTDFGFCVKPNKLRNGHKG-LHIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLRLSYL 362          
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Match: Grb14 (growth factor receptor bound protein 14 [Source:MGI Symbol;Acc:MGI:1355324])

HSP 1 Score: 95.9005 bits (237), Expect = 3.374e-20
Identity = 68/263 (25.86%), Postives = 125/263 (47.53%), Query Frame = 2
Query: 1043 RPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYP--LGAMNVD----AIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ-MQGRS 1810
            R +  K+ V++ +S D+T++AL +   +T   V ++L+ KN ++      + E +  + +ER  E+HE+  + ++ W     N ++  +    Y  F+N   +  E+       MN D     I  +F + S+   +   +++ K+  + +WK+ +  L  +G+    K  SK  + H  +        +Y +  G  K+  APTP+GF  KP     P+  ++ M CA +E S   W + +RL K   Q+  NY    QGRS
Sbjct:   99 RANSRKKQVIKVYSEDETSRALEVPSDITARDVCQLLILKNHYVDDNSWTLFEHLSHIGLERTVEDHELPTEVLSHWGVEEDNKLYLRKNYAKYEFFKNPMYFFPEHMVSFAAEMNGDRSPTQILQVFLS-SSTYPEIHGFLHAKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPR-HLQLFSEFSTSHVYMSLAG-KKKHGAPTPYGFCLKPNKAGGPR--DLKMLCAEEEQSRTCWVTAIRLLKDGMQLYQNYMHPYQGRS 356          
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ICW4|GRB14_BOVIN (Growth factor receptor-bound protein 14 OS=Bos taurus OX=9913 GN=GRB14 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 8.041e-24
Identity = 72/263 (27.38%), Postives = 131/263 (49.81%), Query Frame = 2
Query: 1058 KQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPL------GAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ-MQGRSIYCSN 1825
            K+ V++ +S D+T++AL +   +T   V ++L+ KN +I      + E +P + +ER  E+HE++++ +++W     N ++F +    Y  F+N   +  E+         G ++   I  +F + S+   +   +++ K+  + +WK+ + LL  +G+    K  SK  + H           +Y +  G  K+  APT +GF FKP     P+  ++ M CA +E S   W + +RL KY  Q+  NY    QGRS Y S 
Sbjct:  106 KKQVIKVYSEDETSRALEVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHVGLERTIEDHELVIEVLSNWGMEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLS-SSTYPEIHGFLHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPR-HLQFFSEFGNSDIYVSLAG-KKKHGAPTNYGFCFKPNKAGGPR--DLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGYSSQ 363          
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Match: sp|Q70E73|RAPH1_HUMAN (Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 3.321e-23
Identity = 69/256 (26.95%), Postives = 131/256 (51.17%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD ++K +++++  TV  V+  LM+K+    SL  ++VE V  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +  ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  268 VKKLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETVSELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQ--DYRNKYKAPTDYCLVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNYQEALKRT 520          
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14449|GRB14_HUMAN (Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.117e-22
Identity = 69/258 (26.74%), Postives = 128/258 (49.61%), Query Frame = 2
Query: 1058 KQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPL------GAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ-MQGRS 1810
            K+ V++ +S D+T++AL +   +T   V ++L+ KN +I      + E +P + +ER  E+HE++++ +++W     N ++F +    Y  F+N   +  E+         G ++   I  +F + S+   +   +++ K+  + +WK+ +  L  +G+    K  SK  + H           +Y +  G  K+  APT +GF FKP     P+  ++ M CA +E S   W + +RL KY  Q+  NY    QGRS
Sbjct:  106 KKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLS-SSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPR-HLQFFSEFGNSDIYVSLAG-KKKHGAPTNYGFCFKPNKAGGPR--DLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRS 358          
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Match: sp|P34400|MIG10_CAEEL (Abnormal cell migration protein 10 OS=Caenorhabditis elegans OX=6239 GN=mig-10 PE=1 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 2.338e-22
Identity = 65/254 (25.59%), Postives = 118/254 (46.46%), Query Frame = 2
Query: 1070 VRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDA------------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQ 1795
            V+FF  D     L+I++  TV   +K L EKN         IVE+ P L ++R +E+HE +++ +  W     N ++F +R D Y      + YL        M + +            +   F+    +  + + ++Y+K     +WK+ + +L  +G+    K K    K    +M L     +YT   GW K++ +PTP+  + K  ++   +S  +   CA DE++ K+W   LR+ K   ++L NY++
Sbjct:  325 VKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLRPSGLYYAPKSKKPTTKDLTCLMNLHSNQ-VYTGI-GWEKKYKSPTPWCISIKLTALQMKRSQFIKYICAEDEMTFKKWLVALRIAKNGAELLENYER 576          
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZL23|AB1IP_CHICK (Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Gallus gallus OX=9031 GN=APBB1IP PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.134e-20
Identity = 65/255 (25.49%), Postives = 129/255 (50.59%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL----GENYPLGAMNVDAIKNL----FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTK-EWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQ 1792
            +K+ VV+    D +TK+L++++      V+  L EK     S+   + E  P L++ERFFE+HE +++ ++ W     N + F ++++ Y LF+N + +     G+N     MN  + + L    F   S +  + +  +Y+K+  + +WKR++ LL  +GI  + K K+K  +     ++ ++    Y   G   K ++ APT   F  K +  +  +S  +   C  D  ++ +W + +R+ KY   + +NY+
Sbjct:  174 IKKLVVKVHMYDNSTKSLMVDERQVTRDVLDNLFEKTHCDCSVDWCLYEVYPELQIERFFEDHENVVEVLSDWTRDSENKVLFLEKKEKYALFKNPQNFYLANKGKNES-KEMNDKSKEALLEESFCGASVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLMCFIQFENMNVYY---GSQHKVKYKAPTDHCFVLK-HPQIQKESQYIKYLCCDDRATLHQWVTGIRIAKYGKTLYDNYK 423          
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Match: A0A504Y9S1 (Ras-associated and pleckstrin domains-containing protein 1 OS=Fasciola gigantica OX=46835 GN=FGIG_00161 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 9.269e-68
Identity = 132/309 (42.72%), Postives = 186/309 (60.19%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENY--PLGAMNVDAIKNLFYTL-SAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQK-KKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTL--SLSPAVYSKLSSINTYNSRCSLPTASLGESKTNL 1963
            MK+ VVR F  D+TTKA++I + MT   V  +++EKNF  PS + A+VEKVP+LK+ER FEEHE + DC+ SWP+   NMIFFE+RED +GL E+   +LGE +       + +A++ +   +  A   +++DY+YI+KP E TW R+ C+L  +G+ T +K +K         ++ L     LYTTTGGWT+   APTP GFAFKPYS  DP ST V  FCA+DE +++ W S LR+ KY  Q+  +YQ    R      +      +N  L  SLS  +Y K SS++  N+  S P  S  ES  +L
Sbjct:    1 MKKLVVRIFRPDRTTKAILIEENMTAGEVASMMIEKNFLQPSTRLAVVEKVPALKIERVFEEHEKVADCILSWPTRSQNMIFFEEREDHFGLIESPSVWLGEEFVNKYRYASAEAMQMMLNNIEQAGFPEWRDYLYIRKPGEKTWSRRLCVLRSSGLYTSKKNRKILNPTDLIRILVLDSHLQLYTTTGGWTR-MRAPTPHGFAFKPYSAQDPASTHVFCFCATDEKALRNWVSRLRIAKYGRQLFLDYQSACTRVQRQVAVRHGSVGMNFGLNGSLSAGIYRK-SSLDILNT-SSNPNLSTAESTKSL 306          
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Match: A0A4E0S0T1 (Ras associated and pleckstrin y OS=Fasciola hepatica OX=6192 GN=D915_003360 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.337e-64
Identity = 134/317 (42.27%), Postives = 184/317 (58.04%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQH-----------DYQDYIYIKKPSENTWKRKFCLLNHNGITTIQK-KKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTL--SLSPAVYSKLSSINTYNSRCSLPTASLGESKTNL 1963
            MK+ VVR F  D+TTKA++I + MT   V  +++EKNF  PS + A+VEKVP+LK+ER FEEHE + DC+ SWP+   NMIFFE+RED +GL E+   +LGE +          K  + +  AMQ            +++DY+YI+KP E TW R+ C+L  +G+ T +K +K         ++ L     LYTTTGGWT+   APTP GFAFKPYS  DP ST V  FCA+DE +++ W S LR+ KY  Q+  +YQ    R      L      +N  L  SLS  +Y K SS++  N+  S P  +  ES  +L
Sbjct:  561 MKKLVVRIFRPDRTTKAILIEENMTAGEVASMMIEKNFLQPSTRLAVVEKVPALKIERVFEEHEKVADCILSWPTRSQNMIFFEEREDHFGLIESPSVWLGEEF--------VNKYRYASAEAMQMMLNNIEQAGFPEWRDYLYIRKPGEKTWSRRLCVLRSSGLYTSKKNRKILNPTDLIRILVLDSHLQLYTTTGGWTR-MRAPTPHGFAFKPYSAQDPASTHVFCFCATDEKALRNWVSRLRIAKYGRQLFLDYQSACTRVQRQVALRHGSVGMNFGLNGSLSAGIYRK-SSLDILNT-SSNPNLTTAESTKSL 866          
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Match: A0A4S2LI61 (Ras-associating domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007419 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 3.477e-63
Identity = 121/292 (41.44%), Postives = 173/292 (59.25%), Query Frame = 2
Query: 1058 KQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAM--NVDAIKNLFYTL-SAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQK-KKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTLSLSPAVYSKLSSINTYNSRC 1921
            K+ VVR F  DKTTKA++I + M    V  +L+EKNF  PS   A+VEKVP+LK+E  FEEHE + +C+ SWP+   NMIFFE+R+D +G  E+ K +LGE +       + DA++ +   +  A   +++DY+YI+KP E TW R+ C+L  +G+ T +K KK+        ++ L   + LYTTTGGWT+   APTP GFAFKPYS  DP ST V  FCA+DE +++ W   LR+ K+  Q+  +YQ    R             I R L+++  V + L  +N   S C
Sbjct:  361 KKLVVRIFRPDKTTKAIMIEERMNAGEVASMLIEKNFLKPSTSLAVVEKVPALKIEHVFEEHENVAECILSWPTGSQNMIFFEERKDHFGFIESPKFWLGEEFAEVHRYNSADAVQMMLNNIDQAGFPEWRDYLYIRKPGEKTWSRRLCVLRSSGLYTSKKNKKTLASTDLIRILVLDSHFQLYTTTGGWTR-LRAPTPHGFAFKPYSAQDPASTHVFCFCATDEKALRHWVCRLRIAKFGRQLFVDYQNAVAR-------------IQRQLAMTYGVPTGLHGMNGSLSAC 638          
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Match: A0A183KGV9 (Ras-associating domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS14261 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.587e-60
Identity = 108/251 (43.03%), Postives = 152/251 (60.56%), Query Frame = 2
Query: 1061 QTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQH-----------DYQDYIYIKKPSENTWKRKFCLLNHNGITTIQK-KKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQI 1777
            Q VVR F  D+TTKA++I   MT   V  +++EKNF  PS+  A+VEKVP+LK+ER FEEH+I+ DC+ SWP+   NMIFFE+R D +GL E+   ++GE            K  F++  A+Q            +++DY++I+KP + +W R+ C+L  +G+ T  K KKS        ++ L     LYTTTGGW++   APTP GFAFKPYS  DP ST V  FCA+DE +++ W S LR+ K    +
Sbjct:   15 QLVVRVFRPDRTTKAILIEHQMTAGEVATMMIEKNFLQPSVHLALVEKVPALKIERVFEEHDIVSDCILSWPTKSQNMIFFEERPDHFGLVESPDYWIGEE--------TTTKQAFHSAEAIQTMLNNIDTSGFPEWRDYLFIRKPGDKSWSRRLCVLRSSGLYTSNKNKKSFSSTDLIRILVLDGPLKLYTTTGGWSRM-RAPTPHGFAFKPYSAQDPSSTHVFCFCATDEKALRHWVSRLRVAKVSGLV 256          
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Match: A0A5K4FAD1 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.273e-60
Identity = 112/259 (43.24%), Postives = 157/259 (60.62%), Query Frame = 2
Query: 1067 VVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQH-----------DYQDYIYIKKPSENTWKRKFCLLNHNGITTIQK-KKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGR 1807
            VVR F  D+TTKA++I   MT   V  +++EKNF  PS+  A+VEKVP+LK+ER FEEH+I+ DC+ SWP+   NMIFFE+R D +GL E+   ++GE            K  F++  A+Q            +++DY++I+KP + +W R+ C+L  +G+ T  K KKS        ++ L     LYTTTGGW++   APTP GFAFKPYS  DP ST V  FCA+DE +++ W S LR+ KY  Q+L +Y     R
Sbjct:  592 VVRVFRPDRTTKAILIEHQMTAGEVATMMIEKNFLQPSVHLALVEKVPALKIERVFEEHDIVSDCILSWPTKSQNMIFFEERPDHFGLIESPDYWIGEE--------TTTKQAFHSAEAIQTMLNNIDTSGFPEWRDYLFIRKPGDKSWSRRLCVLRSSGLYTSNKNKKSFSSTDLIRILVLDGPLKLYTTTGGWSR-MRAPTPHGFAFKPYSAQDPSSTHVFCFCATDEKALRHWVSRLRVAKYGRQLLTDYHMALSR 841          
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Match: wu:fj59g11 (Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 [Source:NCBI gene;Acc:103043657])

HSP 1 Score: 110.923 bits (276), Expect = 5.900e-25
Identity = 69/256 (26.95%), Postives = 136/256 (53.12%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  TV  V+  L++K+    SL  ++VE +  L+MER FE+HE L++ + +W    +N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K+  + +WK+++ LL  +GI  + K K K  +     ++L D   +Y     +  ++ APT +    K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  280 VKKLVIRVHLSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSLDWSLVEMISELQMERIFEDHENLVENLLNWTRDSTNRLMFIERIEKYALFKNPQNYLLGRKETCEMTDRNKEALLEECFCGSSISVPEMEGVLWLKEDGKKSWKKRYFLLRASGIYYVPKGKPKASRDLVCFLQL-DHVNVYLGQ-DYRSKYKAPTDYCMVLK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGVRIAKYGKQLYVNYQEAMKRT 532          
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1-like [Source:NCBI gene;Acc:103040117])

HSP 1 Score: 112.464 bits (280), Expect = 6.776e-25
Identity = 68/256 (26.56%), Postives = 134/256 (52.34%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  +V  V+  L++K+    S   A+VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+ +NYQ+   R+
Sbjct:  366 VKKLVIRVHMSDESSKTMMVDERQSVRQVLDSLLDKSHCGYSPDWALVETITELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKDDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYSNYQEAMKRT 618          
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1-like [Source:NCBI gene;Acc:103040117])

HSP 1 Score: 112.079 bits (279), Expect = 7.533e-25
Identity = 68/256 (26.56%), Postives = 134/256 (52.34%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  +V  V+  L++K+    S   A+VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+ +NYQ+   R+
Sbjct:  341 VKKLVIRVHMSDESSKTMMVDERQSVRQVLDSLLDKSHCGYSPDWALVETITELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKDDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYSNYQEAMKRT 593          
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1-like [Source:NCBI gene;Acc:103040117])

HSP 1 Score: 112.079 bits (279), Expect = 7.993e-25
Identity = 68/256 (26.56%), Postives = 134/256 (52.34%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  +V  V+  L++K+    S   A+VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+ +NYQ+   R+
Sbjct:  337 VKKLVIRVHMSDESSKTMMVDERQSVRQVLDSLLDKSHCGYSPDWALVETITELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKDDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYSNYQEAMKRT 589          
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1-like [Source:NCBI gene;Acc:103040117])

HSP 1 Score: 112.079 bits (279), Expect = 8.425e-25
Identity = 68/256 (26.56%), Postives = 134/256 (52.34%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  +V  V+  L++K+    S   A+VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+ +NYQ+   R+
Sbjct:  307 VKKLVIRVHMSDESSKTMMVDERQSVRQVLDSLLDKSHCGYSPDWALVETITELQMERIFEDHENLVENLLNWTRDSQNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKDDGKKSWKKRYFLLRASGIYFVPKGKAKASRDLVCFLQLDHVNVYYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYSNYQEAMKRT 559          
BLAST of Ras-associating domain-containing protein vs. Ensembl Sea Lamprey
Match: apbb1ip (amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein [Source:NCBI gene;Acc:393607])

HSP 1 Score: 104.375 bits (259), Expect = 1.025e-23
Identity = 69/264 (26.14%), Postives = 129/264 (48.86%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKN---------LFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKD---KYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +++ V+R    DK++K L++ +  +V  V+  L EK     S    +VE  P L MERF+E+HE L+  + +W     N + F +R +   LF+N + YL     LG      +K+          F   S    + +  +++K+  + +WKR++ LL  +GI  + K K+K L+     ++ ++    YCL      +  ++ APT   FA K +  +  KS  +   C  D  S+ +W + +R+ KY   + +N+++   ++
Sbjct:   28 VRKLVIRIGLVDKSSKNLMVEEQQSVREVMDNLREKTHSTNSPDWCLVETNPDLDMERFYEDHENLVQNLVTWTRDTQNGLTFVERREKNALFKNPQNYL-----LGNKEAKDVKDRDKESLLEECFCGTSVAVPELEGELFLKEDGKKSWKRRYFLLRASGIYFVPKGKTKTLRDLTCFIQFENLNVYYCL-----DYKNKYKAPTDCCFALK-HPQIQKKSQYIKYLCCDDARSLHQWVTGIRIAKYGKYLYDNFKEASRKA 280          
BLAST of Ras-associating domain-containing protein vs. Ensembl Sea Lamprey
Match: wu:fj59g11 (wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202])

HSP 1 Score: 87.8113 bits (216), Expect = 4.708e-18
Identity = 55/200 (27.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query: 1223 ERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            ERFFE+ E L++ + +W     NM+ F  R++ Y +F+N + YL    E   +   N +A ++  F   +    + +  +Y+K+  + +WK+++ LL  +GI  + K K+K L+     ++  D   +Y      TK + APT + FA K +  +  KS  +   C  D   +++W + +R+ KY   + +NYQ    R+
Sbjct:    1 ERFFEDSENLVENLLNWTRDSPNMLMFVARKEKYAIFKNPQNYLLGTNETSEMADRNKEALLEECFCGSTVTVPELEGVLYLKEDGKKSWKKRYFLLRASGIYYVPKGKTKTLRDLSCFIQF-DHVSVYYGQDFRTK-YKAPTEYCFALK-HPQIQKKSQYIKYLCCDDASGLQQWVTGIRVAKYGRTMYDNYQDALKRA 197          
BLAST of Ras-associating domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010696.1 (pep scaffold:Pmarinus_7.0:GL476867:99659:102986:1 gene:ENSPMAG00000009687.1 transcript:ENSPMAT00000010696.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.812e-9
Identity = 27/107 (25.23%), Postives = 56/107 (52.34%), Query Frame = 2
Query: 1034 ISERPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL 1354
            +  RP P+   V++ FS D T++AL +    T   V ++L+++  ++     +++E + S+ +ER  E+HE ++    SW S   + ++F +    Y  F+   Q+ 
Sbjct:    1 LPSRP-PLLVQVIKVFSEDGTSRALEVPTDATARDVAQMLVQRRHFVDDNNWSLIESLVSVSIERLLEDHEEVMQVQASWGSDADSRLYFRKNYAKYEFFKTPLQFF 106          
BLAST of Ras-associating domain-containing protein vs. Ensembl Nematostella
Match: EDO35745 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKL3])

HSP 1 Score: 112.464 bits (280), Expect = 6.558e-27
Identity = 76/260 (29.23%), Postives = 129/260 (49.62%), Query Frame = 2
Query: 1043 RPDPMKQTVVRFFS-SDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQY-LGENYPLGAMNV-----DAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQ 1801
            R   +K+ VV+ ++  D T+K + I+ T T   V K +M KN   P     +VE++P L +ER  E+HE ++D V+SWP   +N I    + + Y LF+N + Y L  +   GA  +     D +   ++  SAM+    D +   K  + +WK+ +  L  +GI    K K+K  +    +++  +   +Y     + K++ APT + F  K     + +S  +  FCA D  +  RW   ++L KY  Q+L NY + Q
Sbjct:   20 RAARVKKLVVKVYNDEDPTSKTIAIDQTWTSWEVCKKMMRKNDAEPDPNWVLVERLPELCIERSLEDHESVVDVVSSWPWENNNRIVINNKREKYALFKNPQNYLLSSDTSAGAAQLAEKSKDILLQEYFNESAMRLPELDGVLYLKEGKKSWKKHYFALRASGIYYTPKGKTKSSRDLVCLIKF-EFVNIYYGNASFKKKFKAPTDYCFILKHPEYHEVESKAIKYFCAEDVKTFNRWVVCIKLAKYGYQLLENYSETQ 278          
BLAST of Ras-associating domain-containing protein vs. Ensembl Nematostella
Match: EDO27048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAC3])

HSP 1 Score: 55.8398 bits (133), Expect = 4.566e-9
Identity = 35/132 (26.52%), Postives = 63/132 (47.73%), Query Frame = 2
Query: 1406 FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQ 1801
            ++  SAM+    D +   K  + +WK+ +  L  +GI    K K+K  +    +++  +   +Y     + K++ APT + F  K     + +S  +  FCA D  +  RW   ++L KY  Q+L NY + Q
Sbjct:    2 YFNESAMRLPELDGVLYLKEGKKSWKKHYFALRASGIYYTPKGKTKSSRDLVCLIKF-EFVNIYYGNASFKKKFKAPTDYCFILKHPEYHEVESKAIKYFCAEDVKTFNRWVVCIKLAKYGYQLLENYSETQ 132          
BLAST of Ras-associating domain-containing protein vs. Ensembl Nematostella
Match: EDO42246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S295])

HSP 1 Score: 48.521 bits (114), Expect = 8.816e-6
Identity = 51/194 (26.29%), Postives = 81/194 (41.75%), Query Frame = 2
Query: 1112 INDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLG---------ENYPLGAMNVDAIKNLFYTL---SAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAF 1657
            + D   VE V  + M +  ++  L   + E V  L +ER  E+HE ++D  NS     ++ + F +    Y  F N  +Y           E+  +      A K L   L        +  D ++IK  ++ +W +KF +L  +G+ T  K KSK  K   +  +  D   LYT      K   APT F F+ 
Sbjct:  241 VTDLGIVECVTDLYMGE--YVTDL--GVGECVTDLGIERNLEDHEKVIDVYNSLAG--NSKLLFRKDPTKYDFFTNTAKYADTKLFEDGNTEDKAVSEKARKAKKILLMNLLSKCTRVPEISDVLHIKDYTKKSWTKKFIILRGSGLYTSHKGKSKAFKDLQSFAQF-DGNNLYTMLNA-NKSHKAPTNFAFSL 426          
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1 [Source:NCBI gene;Acc:101163063])

HSP 1 Score: 112.079 bits (279), Expect = 8.755e-25
Identity = 68/256 (26.56%), Postives = 133/256 (51.95%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  TV  V+  L++K+    S   ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  306 VKKLVIRVHMSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSPDWSLVETITELQMERIFEDHENLVENLLNWTRDSHNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVNYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWINGIRIAKYGKQLYVNYQEAMKRT 558          
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Match: raph1b (ras-associated and pleckstrin homology domains-containing protein 1 [Source:NCBI gene;Acc:101163063])

HSP 1 Score: 111.694 bits (278), Expect = 9.755e-25
Identity = 68/256 (26.56%), Postives = 133/256 (51.95%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYL---GENYPLGAMNVDA-IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +K+ V+R   SD+++K +++++  TV  V+  L++K+    S   ++VE +  L+MER FE+HE L++ + +W     N + F +R + Y LF+N + YL    E   +   N +A ++  F   S    + +  +++K   + +WK+++ LL  +GI  + K K+K  +     ++L      Y     +  ++ APT +  A K +  +  KS  +   C  D  ++ +W + +R+ KY  Q+  NYQ+   R+
Sbjct:  306 VKKLVIRVHMSDESSKTMMVDERQTVRQVLDSLLDKSHCGYSPDWSLVETITELQMERIFEDHENLVENLLNWTRDSHNKLMFIERIEKYALFKNPQNYLLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVNYGQD--YRSKYKAPTDYCLALK-HPQIQKKSQYIKYLCCDDVRTLHQWINGIRIAKYGKQLYVNYQEAMKRT 558          
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Match: APBB1IP (amyloid beta A4 precursor protein-binding family B member 1-interacting protein-like [Source:NCBI gene;Acc:101163456])

HSP 1 Score: 95.9005 bits (237), Expect = 1.591e-20
Identity = 64/259 (24.71%), Postives = 127/259 (49.03%), Query Frame = 2
Query: 1055 MKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQ-YLGENYPLGAMNVDA------IKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRS 1810
            +++ +V+   SD ++K L+++    V  V+  L EK     S++ ++ E  P L++ER  E+HE+ ++ ++ W     N I F  R   Y +F + +  ++ +    G  +V+       IK  F   S +  + +  +Y+K+  +  WK ++ LL  +G+  + K K+K        +   +K  +YT +  + +++ APT F F  K +  +   S  +   C  DE S+  W +++R+ KY   +  NYQ+   R+
Sbjct:  120 VRKLIVKVLMSDGSSKTLMVDGRQMVREVLDKLFEKTHCDQSIEWSLCEANPELQIERDLEDHELFVELLSDWIRHSENKIHFILRPQKYVMFTDPQLFFMWKKNKSGQTDVNKQTKDLLIKEHFGGTSVIVPNLEGKMYLKEDGKKVWKHQYFLLRASGLYYVPKGKTKSSSDLACFIRF-EKVNVYTAS-NYREKFKAPTSFCFVLK-HPCIQKDSPYIKFLCCEDEKSLLLWVTSIRIAKYGPVLHQNYQEAVKRA 375          
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Match: apbb1ip (amyloid beta precursor protein binding family B member 1 interacting protein [Source:NCBI gene;Acc:101170882])

HSP 1 Score: 88.9669 bits (219), Expect = 6.449e-18
Identity = 62/257 (24.12%), Postives = 125/257 (48.64%), Query Frame = 2
Query: 1088 DKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNL------------FYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCS 1822
            D ++K L++++  TV  V+  L EK     ++  ++ E    L++ER FE+HE L++ +++W     N + F++R + Y +F+N      +N+ L   +  A+K +            F   S +  D +  +++++  + +WK++   L  +GI  + K K+K  +     ++  D   +Y      TK + APT F F  K +  +  +S  +   C  D  +M  W + +R+ KY + +  N+Q  Q +++  S
Sbjct:  177 DGSSKTLMVDERQTVREVLDNLFEKTHCDCNVDWSLCETSHELQLERTFEDHENLVEPLSAWTRDSENQVLFQERGEKYEVFKNP-----QNFYLWKKDKKALKEIKDKDKEILIKENFCGSSIIVPDLESVLHLREDGKKSWKQRLFQLRASGIYYVPKGKTKSSRDLVCFVQF-DNVNVYYGKDFKTK-YKAPTDFCFVLK-HPQIQKESQYIKYLCCDDAWTMNLWVTAIRIAKYGSLLYENFQTAQKKAVVNS 425          
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Match: grb7 (growth factor receptor-bound protein 7 [Source:NCBI gene;Acc:101166170])

HSP 1 Score: 87.0409 bits (214), Expect = 1.859e-17
Identity = 63/256 (24.61%), Postives = 116/256 (45.31%), Query Frame = 2
Query: 1046 PDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGE-------NYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQ 1792
            P+  ++ +++ +  D   K++ ++   T   V  +L+ +         A+ E  P+L +ER  E+HE++L+   +W       + F +    Y  F N   +  E       +   G  + + I+NL    S    + Q ++++K+PS   WK+ +  L  +G+ +  K  SK  + H   +   D   +YT      K + APT F F  KP S    +  ++ + CA +E +   W S  RL K+  Q+ +NYQ
Sbjct:   93 PESSQKHLIKVYGEDNNCKSVWVSRRATAREVCHLLVHQAHCSDQESWALFEHHPALALERCLEDHEVVLEVQAAWSLKGDTRLTFCKNYAKYEFFRNPTLFFPESMISDSADVSKGMTSSELIQNLLR--SGTCPEIQGFLHMKEPSRKAWKKVYFFLRRSGLYSSTKGSSKEPR-HLQCVADLDNLNVYTVVNS-RKLYGAPTDFSFCIKP-SRNPTRVQDLKVLCAENEQTRTCWTSAFRLFKHGKQLQSNYQ 343          
BLAST of Ras-associating domain-containing protein vs. Planmine SMEST
Match: SMESG000002146.1 (SMESG000002146.1)

HSP 1 Score: 1060.44 bits (2741), Expect = 0.000e+0
Identity = 564/565 (99.82%), Postives = 564/565 (99.82%), Query Frame = 2
Query:  284 MENLSDLDDCINTLEQLQLTLDFETSTVKRNPKIYSISDPFEHSLQNINNNRIDLLLSNENNRLNQTSYDSHLPDITKSSAVCKGEPNIINGEQNEIFQSNSDNNDFKSLLTRRAKLTSNMSNDNELFSVPECDVTDFXXXXXXINIDSDNYLKSYGTYKSQKQQSPVNSNQPAIGSTTASLSIRKHSTNSLKLSPKTLLDPFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEKESSKEMKTFPSTDAISERPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTLSLSPAVYSKLSSINTYNSRCSLPTASLGESKTNLNKFKF 1978
            MENLSDLDDCINTLEQLQLTLDFETSTVKRNPKIYSISDPFEHSLQNINNNRIDLLLSNENNR NQTSYDSHLPDITKSSAVCKGEPNIINGEQNEIFQSNSDNNDFKSLLTRRAKLTSNMSNDNELFSVPECDVTDFPPPPPPINIDSDNYLKSYGTYKSQKQQSPVNSNQPAIGSTTASLSIRKHSTNSLKLSPKTLLDPFFSQQNNSNNNNNSNAAVSSANSSQSNLSSSIEKESSKEMKTFPSTDAISERPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTLSLSPAVYSKLSSINTYNSRCSLPTASLGESKTNLNKFKF
Sbjct:    1 MENLSDLDDCINTLEQLQLTLDFETSTVKRNPKIYSISDPFEHSLQNINNNRIDLLLSNENNRSNQTSYDSHLPDITKSSAVCKGEPNIINGEQNEIFQSNSDNNDFKSLLTRRAKLTSNMSNDNELFSVPECDVTDFPPPPPPINIDSDNYLKSYGTYKSQKQQSPVNSNQPAIGSTTASLSIRKHSTNSLKLSPKTLLDPFFSQQNNSNNNNNSNAAVSSANSSQSNLSSSIEKESSKEMKTFPSTDAISERPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQQMQGRSIYCSNLYTSDHQINRTLSLSPAVYSKLSSINTYNSRCSLPTASLGESKTNLNKFKF 565          
BLAST of Ras-associating domain-containing protein vs. Planmine SMEST
Match: SMESG000058735.1 (SMESG000058735.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.075e-35
Identity = 77/239 (32.22%), Postives = 126/239 (52.72%), Query Frame = 2
Query: 1079 FSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSLKSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCS-NMIFFEQREDIYGLFENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWKRKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNAPTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILNNYQ 1792
            +  ++T K ++I++T T   + ++L  +N+ +P +K ++VEK   LK+ER FE+ E  +  + S+P   + +M+FFE RED YGLF +  ++LG N+         I  +F         Y+ +++ +K    TWKR  C+L ++GI   +K           ++ L     LYTT GGW+ +  APTP+GF  K Y   +PK   +  FCA  E S++ W S  R+      +  NYQ
Sbjct:  216 YQPNRTMKTILIDETTTAGEICQLLTARNYLMPCIKFSLVEKTSHLKIERIFEDDETPVLYLLSYPDGGNKSMVFFEDREDKYGLFTDPGKWLGSNFAENEKERYYINEIFDGPFPQLPRYKSHLFYRKLHRKTWKRSLCVLRNSGIYAYKKSNKNDFTDLQLIISLHPSLHLYTTIGGWS-QCKAPTPYGFCLKTYGEQNPKY--IAYFCAPSEASLRYWSSMFRIALKGKTLFVNYQ 451          
The following BLAST results are available for this feature:
BLAST of Ras-associating domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAPH16.212e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
RAPH16.801e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
RAPH16.907e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
RAPH17.198e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
RAPH17.342e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-101.255e-2325.59Abnormal cell migration protein 10 [Source:UniPro... [more]
mig-101.255e-2325.59Abnormal cell migration protein 10 [Source:UniPro... [more]
mig-101.255e-2325.59Abnormal cell migration protein 10 [Source:UniPro... [more]
mig-101.325e-2325.59Abnormal cell migration protein 10 [Source:UniPro... [more]
mig-101.325e-2325.59Abnormal cell migration protein 10 [Source:UniPro... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pico4.349e-3029.18gene:FBgn0261811 transcript:FBtr0303995[more]
pico4.476e-3029.18gene:FBgn0261811 transcript:FBtr0074805[more]
pico4.476e-3029.18gene:FBgn0261811 transcript:FBtr0303996[more]
pico4.831e-3029.18gene:FBgn0261811 transcript:FBtr0074804[more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raph1b1.768e-2627.34Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
raph1b5.435e-2626.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
wu:fj59g117.604e-2526.95wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202][more]
wu:fj59g114.615e-2426.95wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202][more]
wu:fj59g114.940e-2426.95wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202][more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr1d24.527e-2426.67nuclear receptor subfamily 1 group D member 2 [Sou... [more]
nr1d21.568e-2326.67nuclear receptor subfamily 1 group D member 2 [Sou... [more]
nr1d21.983e-2326.67nuclear receptor subfamily 1 group D member 2 [Sou... [more]
nr1d22.568e-2326.67nuclear receptor subfamily 1 group D member 2 [Sou... [more]
apbb1ip2.159e-2224.23Fc receptor-like protein 4 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Raph11.646e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
Raph11.745e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
Raph11.570e-2426.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
Grb72.862e-2026.18growth factor receptor bound protein 7 [Source:MGI... [more]
Grb143.374e-2025.86growth factor receptor bound protein 14 [Source:MG... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ICW4|GRB14_BOVIN8.041e-2427.38Growth factor receptor-bound protein 14 OS=Bos tau... [more]
sp|Q70E73|RAPH1_HUMAN3.321e-2326.95Ras-associated and pleckstrin homology domains-con... [more]
sp|Q14449|GRB14_HUMAN2.117e-2226.74Growth factor receptor-bound protein 14 OS=Homo sa... [more]
sp|P34400|MIG10_CAEEL2.338e-2225.59Abnormal cell migration protein 10 OS=Caenorhabdit... [more]
sp|Q5ZL23|AB1IP_CHICK1.134e-2025.49Amyloid beta A4 precursor protein-binding family B... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Y9S19.269e-6842.72Ras-associated and pleckstrin domains-containing p... [more]
A0A4E0S0T12.337e-6442.27Ras associated and pleckstrin y OS=Fasciola hepati... [more]
A0A4S2LI613.477e-6341.44Ras-associating domain-containing protein OS=Opist... [more]
A0A183KGV91.587e-6043.03Ras-associating domain-containing protein OS=Schis... [more]
A0A5K4FAD13.273e-6043.24Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wu:fj59g115.900e-2526.95Ras association (RalGDS/AF-6) and pleckstrin homol... [more]
raph1b6.776e-2526.56ras-associated and pleckstrin homology domains-con... [more]
raph1b7.533e-2526.56ras-associated and pleckstrin homology domains-con... [more]
raph1b7.993e-2526.56ras-associated and pleckstrin homology domains-con... [more]
raph1b8.425e-2526.56ras-associated and pleckstrin homology domains-con... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
apbb1ip1.025e-2326.14amyloid beta (A4) precursor protein-binding, famil... [more]
wu:fj59g114.708e-1827.50wu:fj59g11 [Source:ZFIN;Acc:ZDB-GENE-030131-8202][more]
ENSPMAT00000010696.13.812e-925.23pep scaffold:Pmarinus_7.0:GL476867:99659:102986:1 ... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO357456.558e-2729.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270484.566e-926.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422468.816e-626.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raph1b8.755e-2526.56ras-associated and pleckstrin homology domains-con... [more]
raph1b9.755e-2526.56ras-associated and pleckstrin homology domains-con... [more]
APBB1IP1.591e-2024.71amyloid beta A4 precursor protein-binding family B... [more]
apbb1ip6.449e-1824.12amyloid beta precursor protein binding family B me... [more]
grb71.859e-1724.61growth factor receptor-bound protein 7 [Source:NCB... [more]
back to top
BLAST of Ras-associating domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000002146.10.000e+099.82SMESG000002146.1[more]
SMESG000058735.11.075e-3532.22SMESG000058735.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034775 ID=SMED30034775|Name=Ras-associating domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2250bp
CACGATCGAGAATCTGATAAGCGGATTGGTTGCACACATGCACAATGTTA
TCCATCACGGCCCGACTACACCAACACACGACTGGCTAACATACATCTGT
ATCAGTAATGCAGATCAATTGAAACTTTATTTAATCAATTTATTTATTAT
TTTTTATACAACGTCTGAAAGTCGAAAATTAATACACAGCCATATTGAAT
TTTAAAATACCAGCTATTCGATTACAGGATTAATTTTCTAATTACTTCCT
AATTTTCACCTATGAAATTATTTCTTTGCTAAAATGGAAAACTTATCAGA
TTTGGATGATTGTATTAATACTTTGGAACAATTGCAATTAACTCTCGATT
TCGAAACGTCAACGGTGAAACGCAACCCGAAAATATATTCGATATCTGAT
CCATTCGAGCACAGCTTACAGAATATCAACAACAATCGCATAGATTTATT
ACTATCAAATGAGAATAATAGGTTGAATCAAACAAGTTATGATAGTCATT
TACCAGACATTACCAAATCATCAGCAGTTTGCAAAGGCGAACCAAACATT
ATAAATGGGGAACAAAATGAAATATTTCAATCAAATTCAGATAACAACGA
TTTCAAATCTTTATTAACTCGTCGTGCTAAACTAACATCAAACATGTCAA
ATGATAATGAACTGTTCTCAGTTCCTGAATGTGACGTAACAGATTTCCCG
CCGCCCCCTCCGCCAATCAACATCGACAGCGACAATTACCTGAAATCTTA
TGGCACCTATAAATCACAAAAACAACAATCTCCTGTTAATTCCAATCAAC
CAGCCATCGGGAGTACCACAGCAAGTCTGTCAATTCGTAAACATTCAACT
AATTCTCTGAAACTCTCCCCGAAGACTTTATTAGATCCATTTTTTTCCCA
ACAGAATAATAGTAACAATAATAATAATAGCAATGCTGCTGTCAGTTCTG
CCAACTCAAGCCAGTCAAATCTATCATCATCTATCGAAAAGGAATCATCG
AAGGAAATGAAAACATTCCCAAGTACAGATGCGATATCTGAAAGGCCAGA
TCCAATGAAGCAAACGGTCGTTCGGTTTTTCAGTTCCGACAAAACAACAA
AAGCGCTAATAATCAATGATACAATGACAGTGGAGTCAGTGATAAAGGTG
CTCATGGAGAAAAACTTTTGGATACCATCATTAAAGTCGGCTATTGTTGA
AAAAGTTCCCAGTTTAAAGATGGAACGGTTTTTTGAAGAGCACGAAATTC
TGTTAGACTGCGTCAATAGCTGGCCGTCAACTTGCAGCAATATGATTTTT
TTTGAACAGAGGGAAGATATTTATGGCCTATTTGAAAATGCCAAACAATA
TCTGGGAGAAAATTATCCTCTTGGTGCCATGAACGTCGACGCTATTAAGA
ACCTGTTCTACACGCTGTCAGCGATGCAGCACGATTACCAAGACTATATC
TATATAAAGAAGCCCTCAGAAAATACCTGGAAACGGAAATTCTGCCTACT
CAATCACAACGGCATCACAACGATTCAGAAAAAGAAATCTAAAGGACTTA
AAAGTCATTGCAATGTCATGGAGCTTAAGGACAAATACTGTCTATATACC
ACTACAGGTGGATGGACGAAAGAATGGAATGCTCCCACTCCTTTTGGTTT
TGCATTCAAGCCATATTCTATAGTGGATCCGAAGTCTACTGAAGTGATAA
TGTTCTGTGCCAGTGACGAGGTCTCAATGAAACGTTGGTGTAGTAACTTG
CGACTGTGCAAGTACAAAAACCAGATCCTGAACAACTACCAGCAAATGCA
AGGCAGATCCATTTATTGCAGCAACCTCTACACGTCGGATCACCAGATCA
ACCGTACATTATCTCTATCTCCAGCTGTCTACAGTAAGCTCTCAAGTATC
AACACTTACAATTCCCGGTGCTCGCTGCCGACTGCCAGTCTTGGAGAATC
AAAAACAAATTTAAATAAATTCAAATTTTAATGTATTTTGATTTGAATGT
TGTCTATAGCGATGGAATGGCAGCAGCGATTTCGAGTGATCTATGAGAAT
TATTTATTGAGATATTTATAGAGTGATTCGATTCAATAGTATTGTTATTG
TATTGTGCCTTGCAACTTAACTTTTGAATGTCTGTCAGTATTGGCACTGG
AGGCGATGGAATCGAGGACAATCGGTTCCACAACAGATTTGTAATTTGTA
AATTGTTGATGTTCTTAATTATTCGAAATCATTAGCATTTTAAAGGGGAG
back to top

protein sequence of SMED30034775-orf-1

>SMED30034775-orf-1 ID=SMED30034775-orf-1|Name=SMED30034775-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=566bp
MENLSDLDDCINTLEQLQLTLDFETSTVKRNPKIYSISDPFEHSLQNINN
NRIDLLLSNENNRLNQTSYDSHLPDITKSSAVCKGEPNIINGEQNEIFQS
NSDNNDFKSLLTRRAKLTSNMSNDNELFSVPECDVTDFPPPPPPINIDSD
NYLKSYGTYKSQKQQSPVNSNQPAIGSTTASLSIRKHSTNSLKLSPKTLL
DPFFSQQNNSNNNNNSNAAVSSANSSQSNLSSSIEKESSKEMKTFPSTDA
ISERPDPMKQTVVRFFSSDKTTKALIINDTMTVESVIKVLMEKNFWIPSL
KSAIVEKVPSLKMERFFEEHEILLDCVNSWPSTCSNMIFFEQREDIYGLF
ENAKQYLGENYPLGAMNVDAIKNLFYTLSAMQHDYQDYIYIKKPSENTWK
RKFCLLNHNGITTIQKKKSKGLKSHCNVMELKDKYCLYTTTGGWTKEWNA
PTPFGFAFKPYSIVDPKSTEVIMFCASDEVSMKRWCSNLRLCKYKNQILN
NYQQMQGRSIYCSNLYTSDHQINRTLSLSPAVYSKLSSINTYNSRCSLPT
ASLGESKTNLNKFKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039664GRB/APBB1IP
IPR011993PH-like_dom_sf
IPR000159RA_dom
IPR001849PH_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000159Ras-associating (RA) domainSMARTSM00314RA_5coord: 259..345
e-value: 8.2E-4
score: 28.7
IPR000159Ras-associating (RA) domainPROSITEPS50200RAcoord: 259..345
score: 12.928
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 257..347
e-value: 2.5E-25
score: 90.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..253
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..235
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 159..182
NoneNo IPR availableCDDcd01787RA_MRLcoord: 262..344
e-value: 8.61989E-20
score: 82.0792
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 383..493
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 349..509
e-value: 9.1E-30
score: 106.0
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 386..493
e-value: 1.8E-8
score: 34.9
IPR039664GRB/APBB1IPPANTHERPTHR11243GROWTH FACTOR RECEPTOR-BOUND PROTEINcoord: 101..530
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 255..350