Fibrillar collagen NC1 domain-containing protein

Overview
NameFibrillar collagen NC1 domain-containing protein
Smed IDSMED30034772
Length (bp)3193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibrillar collagen NC1 domain-containing protein (SMED30034772) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30034772) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibrillar collagen NC1 domain-containing protein (SMED30034772) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30034772) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034772

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034772h1SMcG0016673 tr5_2051mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30034772h1SMcG0016673 tr5_2051mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30034772h1SMcG0016673 Contig36825uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034772h1SMcG0016673 Contig36825newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30034772h1SMcG0016673 dd_Smed_v4_9565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034772h1SMcG0016673 dd_Smed_v4_9565_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30034772h1SMcG0016673 dd_9565dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
body wall musculatureSMED30034772h1SMcG0016673 dd_Smed_v4_9565_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034772h1SMcG0016673 dd_Smed_v4_9565_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034772h1SMcG0016673 dd_Smed_v4_9565_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL21A1 (collagen type XXI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:17025])

HSP 1 Score: 162.155 bits (409), Expect = 6.715e-40
Identity = 175/529 (33.08%), Postives = 234/529 (44.23%), Query Frame = 3
Query:  654 FKVPKLET----GWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIK--------SNSNEMEKCVID---KCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGP 2165
            F  P+++T    GW++I + +    + L I+ Q+IE   N+ L  +     +LI G     K   K    Q +++          +N    C I    KCL   S                 +T A  +   G+ G  G KG PG  G+                   G+PG+               G  G PGY+G  G  G+ G+PG+                           QG RG  G  G PG  G  G  G PG  G+ G  G+ G+ G KG+ G+PG    KG KG             N G  G PG AG PG +G  G+ G  G  G +G  G  G+ G  G+ G+ G PG  G+ G KGEIG PG++G KGA G+PG+          G PG +G  G  G+ G+PG SGL+G PG  G  G  G +G        LPGI+G KG+    G+ GEKG +G KGENG  GIPG+ GI+G  G KG     G+ G  G IG+ G  G++G+ GP GP
Sbjct:  336 FANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIE---NKPLHPV---LGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETACEIPGFVKCLNGPS--------------DVGSTPAPCICPPGKPGLQGPKGDPGLPGN------------------PGYPGQ--------------PGQDGKPGYQGIAGTPGVPGSPGI---------------------------QGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGE----------KGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMG--------LPGIQGKKGDK---GNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGP 764          

HSP 2 Score: 110.153 bits (274), Expect = 9.137e-24
Identity = 95/250 (38.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG------------ESGLRGTPGPEGDEGLH------------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +GP+GDPGL G PG  G  G  G+ G  GI+G  G  G  G  G  GL          G KGE G+ G+KG +G  G PG+ G PG +GE+GA G  G PG             +G  G PGP G+ G H                  G  G DG RG   PGI G  G  GL+G  GE G  G +G+ G PG+PG +G  G  G  G       G  G+ G  G +G+ G  G +G  G  G  G+ GY
Sbjct:  453 QGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVPGSPGIQGARGL---------PGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGE--PGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTP-----GSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGY 686          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL21A1 (collagen type XXI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:17025])

HSP 1 Score: 155.992 bits (393), Expect = 5.165e-38
Identity = 174/527 (33.02%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  654 FKVPKLET----GWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIK--------SNSNEMEKCVIDK-CLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGP 2165
            F  P+++T    GW++I + +    + L I+ Q+IE   N+ L  +     +LI G     K   K    Q +++          +N    C I   CL   S                 +T A  +   G+ G  G KG PG  G+                   G+PG+               G  G PGY+G  G  G+ G+PG+                           QG RG  G  G PG  G  G  G PG  G+ G  G+ G+ G KG+ G+PG    KG KG             N G  G PG AG PG +G  G+ G  G  G +G  G  G+ G  G+ G+ G PG  G+ G KGEIG PG++G KGA G+PG+          G PG +G  G  G+ G+PG SGL+G PG  G  G  G +G        LPGI+G KG+    G+ GEKG +G KGENG  GIPG+ GI+G  G KG     G+ G  G IG+ G  G++G+ GP GP
Sbjct:  336 FANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIE---NKPLHPV---LGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETACEIPGFCLNGPS--------------DVGSTPAPCICPPGKPGLQGPKGDPGLPGN------------------PGYPGQ--------------PGQDGKPGYQGIAGTPGVPGSPGI---------------------------QGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGE----------KGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMG--------LPGIQGKKGDK---GNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGP 762          

HSP 2 Score: 106.301 bits (264), Expect = 1.375e-22
Identity = 95/250 (38.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG------------ESGLRGTPGPEGDEGLH------------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +GP+GDPGL G PG  G  G  G+ G  GI+G  G  G  G  G  GL          G KGE G+ G+KG +G  G PG+ G PG +GE+GA G  G PG             +G  G PGP G+ G H                  G  G DG RG   PGI G  G  GL+G  GE G  G +G+ G PG+PG +G  G  G  G       G  G+ G  G +G+ G  G +G  G  G  G+ GY
Sbjct:  451 QGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVPGSPGIQGARGL---------PGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGE--PGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTP-----GSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGY 684          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL24A1 (collagen type XXIV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:20821])

HSP 1 Score: 156.762 bits (395), Expect = 5.949e-38
Identity = 244/800 (30.50%), Postives = 341/800 (42.62%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG---EIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV----------------------KGEKGLMGISGEKGDIGKSG---KLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDGPRGTA----------------LPGIKGVKGEMGLIGDI---------GEKGDRGPKGENGNPGIPGEVGI------------KGEIGDKGL-SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQL--SNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEA-VWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTK--MLLSTNKPDMLPIVDY---------RIKYFNDNGKCML 3155
            G +G  G +G PGAKGD+G  G  G  GE G  G  G PGE G++G    G  GV G +G+PG  GEKG  G+ G  G LG +G  G  G +G  G  G++G  G++G++G++G   E+G  G  GKIG SG  G +G +G  G++G  GP G  G PG                       RG QG PG +G+PG  G  G                       +GE+G  G  G KG +G  G     G+ G  GEPG  G QGLKGE G  G KG KGA G  G  G PG QG +G  G+ G  G  G+ G PG   P G +GL G  G  G  G A                 PGI+G KGE GL G           G +GD+GP G+ G  G PGE G+            KG  GD G+  + G  G  G  GNTGP G EGI GP G  G  GE G  G  G +G  G+ G  G  G PG   Q    +  N A + L  SN +  + +  N E  +I+ ++     ++ +  +L S+ +    R +    P   C+D+ L    ++ +   W+DPN G   D+ +  C    +    +T  P ++  +  +  G +                                     Q+NFL + S  A   +   C  +  +             T+ QT          G  L  G+   + +I+      ++    +L D+CK +  G++ K   L  T +P+ LP+++          R  Y + +  C L
Sbjct: 1014 GTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGK--DGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGY----------------------RGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQ----MDINAAIQALIESNTALQMESYQNTEVTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDN----PARICKDL-LNCEQKVSDGKYWIDPNLGCPSDAIEVFCN---FSAGGQTCLPPVSVTKLEFGVGKV-------------------------------------QMNFLHLLSSEATHIITIHCLNTPRW-------------TSTQT---------SGPGLPIGFKGWNGQIFKV---NTLLEPKVLSDDCKIQD-GSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL 1714          

HSP 2 Score: 133.65 bits (335), Expect = 7.481e-31
Identity = 163/409 (39.85%), Postives = 204/409 (49.88%), Query Frame = 3
Query: 1011 KGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE------GLHGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            KGT G +G  GA G++G +G PG+KG  G+ G  G  GE G +G    +   G  G+ G  GM G  GEKG  G  G  G  G  G  G  G  G  G  G  G  G  G RG  G  G  G  G  G  G  G+QGI+G KG  G  G +G  G  GK    G                 RG QG PGL G+PG  G+ G+ GE GL G+   +GD+G  G++G +G  G  G+ G+QG  G  G  G  G+ G  G PG+ GEPG  GE G  G  GL G  G RG PG +G++      G+ GP+G  G  G   P GI G+ G+ G  G  G+KG  GP GE G+ G PG++G  G  G +G    +G +G  G  G  G  G  G +G  GP GL G  G+ GY
Sbjct:  803 KGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPG----------------ERGFQGKPGLQGLPGSTGDRGLPGEPGLRGL---QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGY 1192          

HSP 3 Score: 121.709 bits (304), Expect = 3.919e-27
Identity = 145/436 (33.26%), Postives = 187/436 (42.89%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSG------KLGKDGLIGEPG---------------KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG---------LIGLPGESGLRGTPGP---------------------------------EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G RG PG +G  G+         KG+ G    Q +PG KG++G +G+ G PG+                           QG++G  G  GLPG+         PG+QGI GF GN+G  G  G  G  G                      N GP+G  G  G PGE G +G +GE+G+ GI G+KG  G+ G        G  GL G PG                +G  G  G  G PG  G  G KGLPGI+G+ G+QG  G +G          +GLPG  G+RG  GP                                 EG +GL   +G+        PG+KG +GE G IG  GE G RG  G+ G  G PG  G+KGE+GD+G    +   G +G  G +G TG  G +G RG  GP+G  GE G
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGM---------------------------QGDKGLKGHPGLPGL---------PGEQGIPGFAGNIGSPGYPGRQGLAGPEG-------------------NPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGL---LGNR--GPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKG 888          

HSP 4 Score: 108.227 bits (269), Expect = 5.849e-23
Identity = 165/466 (35.41%), Postives = 214/466 (45.92%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLA------------------GIPGENGNIGVKGEKG---------LMGISGEKGDIGKSGKLG------KDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPG---IEGEPGDQGEIGAMGLIGLPGESGLR---------------------GTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGE---------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G +G+PG KG  G  G PG+ G+ G  G RG PG        ++G+ G +G QG PG  G++G  G+ G+PGL+G  G  G  G+               +G+ G +G IG  GI G +G SG  G  GIKG KG  G +G  G  G PG     G+ G  G +G         GP G  G                    GIPG+NG  G KG  G         L G  GE+G IG  G+LG      + G  GEPG  G++G  G+ G  G+ G  G  GLPG   + G  G++GE G+ G +G  GE G+                      G  GP G +G  G  G  GP G     GI+G KGE          GLIG  G  G+RG +G+ G  G+PG  G +G  G+ GL  + G +G  G +G  GP G EG  G +G  G  G+VG  G
Sbjct:  600 GRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPG--------IRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---------------RGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRG-------KSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAG 1035          

HSP 5 Score: 107.071 bits (266), Expect = 1.310e-22
Identity = 126/331 (38.07%), Postives = 152/331 (45.92%), Query Frame = 3
Query: 1374 KIGTSGKPGKQGIKGFKGNVGKSGPKGNSG-TPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK------GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEK---GTKGAKGLPGIEGE---------PGDQGEIGAMGLIGLPG---------ESGLRGTPGPE---GDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-------------LSVIGKIGKYGTIGNTGPKG------------LEGIRGPRGPIGLVGEVGKVG 2198
            K G  G PG  G  G  G  G  GPKG+ G +PG+                      +G QG  GL G PG  G+ G+KG  GL G+ GE+      G+IG  G  G+ GL G  G  G +G +G IG PGE    G +G +G+PGI G+         PGD G+ G  GL G PG           GLRG+ GP    G  G+ GP+G  G +G  LPGIKG KGE G  G++GE G  G KG  G PG PG  G  G  G  G                 G IG  G  G  GPKG            L+G +G  GPIG  GE+G  G
Sbjct:  511 KRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPG-----------------EKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKG--LPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRG 822          

HSP 6 Score: 101.679 bits (252), Expect = 5.211e-21
Identity = 122/332 (36.75%), Postives = 150/332 (45.18%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGD----------IXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM 1964
            RG +G  G  G PG KG+          +G  G  G+ G  GD G RG PG  G KG V V G  G  G QG PG  G++G  G+ G  G  G                       G++G  G  G+ G+PG+ G +G  G  G  G  G  GN GK GP G  G PG     G  G  G+ G  G     +G  G PG  GI G  G  G+ G+ G+ G  G +G  G  G  G  GL G+PG+ G+QGL G  G PG KG                +G+ G +G+ G  G  G RG  GP G EG+ GP G  GPRG      KG +GE 
Sbjct: 1172 RGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEG---------------------NKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGV----KGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGP---------------EGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGE-----KGFRGET 1458          

HSP 7 Score: 90.1225 bits (222), Expect = 1.865e-17
Identity = 112/278 (40.29%), Postives = 140/278 (50.36%), Query Frame = 3
Query: 1560 P------------------GLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGE--PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGP------------IGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGI------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
                               G  GIPG +GN G+    GL G  G KGD G S         G+  PG+ G QGL G +G PG +G KG KG PG+ G PG+QG  G  G IG PG  G +G  GPEG+ G  G             +G +G RG  +PGI+G KG  G  G  G+ GDRGP G +G+PG+      PG  G++G +G  G   IG  G  G +G +G KGL GI+G +G  G  GE+G+ GY          G+KG  GLPG PG RG
Sbjct:  494 TGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGL---PGLPGPKGPKGDPGFS--------PGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERG--IPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVG--PIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGY---------PGDKGAVGLPGPPGMRG 747          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL21A1 (collagen type XXI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:17025])

HSP 1 Score: 154.836 bits (390), Expect = 1.240e-37
Identity = 174/530 (32.83%), Postives = 234/530 (44.15%), Query Frame = 3
Query:  654 FKVPKLET----GWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIK--------SNSNEMEKCVID----KCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGP 2165
            F  P+++T    GW++I + +    + L I+ Q+IE   N+ L  +     +LI G     K   K    Q +++          +N    C I     +CL   S                 +T A  +   G+ G  G KG PG  G+                   G+PG+               G  G PGY+G  G  G+ G+PG+                           QG RG  G  G PG  G  G  G PG  G+ G  G+ G+ G KG+ G+PG    KG KG             N G  G PG AG PG +G  G+ G  G  G +G  G  G+ G  G+ G+ G PG  G+ G KGEIG PG++G KGA G+PG+          G PG +G  G  G+ G+PG SGL+G PG  G  G  G +G        LPGI+G KG+    G+ GEKG +G KGENG  GIPG+ GI+G  G KG     G+ G  G IG+ G  G++G+ GP GP
Sbjct:  336 FANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIE---NKPLHPV---LGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETACEIPGFNGECLNGPS--------------DVGSTPAPCICPPGKPGLQGPKGDPGLPGN------------------PGYPGQ--------------PGQDGKPGYQGIAGTPGVPGSPGI---------------------------QGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGE----------KGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMG--------LPGIQGKKGDK---GNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGP 765          

HSP 2 Score: 105.531 bits (262), Expect = 2.446e-22
Identity = 95/250 (38.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG------------ESGLRGTPGPEGDEGLH------------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +GP+GDPGL G PG  G  G  G+ G  GI+G  G  G  G  G  GL          G KGE G+ G+KG +G  G PG+ G PG +GE+GA G  G PG             +G  G PGP G+ G H                  G  G DG RG   PGI G  G  GL+G  GE G  G +G+ G PG+PG +G  G  G  G       G  G+ G  G +G+ G  G +G  G  G  G+ GY
Sbjct:  454 QGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVPGSPGIQGARGL---------PGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGE--PGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTP-----GSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGY 687          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 139.043 bits (349), Expect = 2.517e-32
Identity = 130/394 (32.99%), Postives = 170/394 (43.15%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEA-GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG------------------LIGEPG------------------KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGD 2069
            +RG++G +GS G  G  G+                G+RG+PG+ G  G        G QG QG PG +G KG+ G  G  G +G                     EIG  G  GE G+ GLPG  G+ G  G+ G +G +G KG  G  G +G+ G PG+ + +     +           + GP G PG  G+PG  G  G  G  G  G  G KG+ G  G+ G +G                  LIGE G                  + G  G KGE G+PG KG  G +G  G  G+ G  G +G+ G  G  GE G  G PGP+G+ G  G  G  GP+G     I+G +G  G  G +G+KGD         PG PG  G KG  GD
Sbjct: 2039 QRGDRGPIGSIGPKGIPGED---------------GYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGEVG---------------------EIGLDGLDGEDGDKGLPGSSGEKGNPGRRGDKGPRGEKGERGDVGIRGDPGNPGQDSQERGPKGETG---------DLGPMGVPGRDGVPGGPGETGKNGGFGRRGPPGAKGNKGGPGQPGFEGEQGTRGAQGPAGPAGPPGLIGEQGISGPRGSGGAAGAPGERGRTGPLGRKGEPGEPGPKGGIGNRGPRGETGDDGRDG-VGSEGRRGKKGERGFPGYPGPKGNPGEPGLNGTTGPKG-----IRGRRGNSGPPGIVGQKGD---------PGYPGPAGPKGNRGD 2372          

HSP 2 Score: 135.961 bits (341), Expect = 1.919e-31
Identity = 121/363 (33.33%), Postives = 155/363 (42.70%), Query Frame = 3
Query: 1320 RQGNRGEMGEIGLPGILGKIGTSGKPGK------------QGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQ-------PGEKGTKGAKGLPGIEGEPGDQGEIG------------AMGLIGLPGESGLRGTPGPE---------------GDEGLH------------------GPIGDDGPRGTALP----GIKGVKGEMGLIG--DIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++G+RG +G IG  GI G+ G  G PG              G +GF+G  G+ G KG+ G PG+                      +G  G+ GL G+ GE+G      +KGL G SGEKG+ G+ G  G  G  GE G +GI+G  G  GQ        GE G  G  G+PG +G PG  GE G            A G  G PG+ G  G  G                 G++G+                   GP+G  G  G   P    G +G +GE G  G   +G +G RG KGE G PG PG  G  GE G  G +  G  G  G  GN+GP G+ G +G  G  G  G  G  G
Sbjct: 2039 QRGDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGE----------------------KGEVGEIGLDGLDGEDG------DKGLPGSSGEKGNPGRRGDKGPRGEKGERGDVGIRGDPGNPGQDSQERGPKGETGDLGPMGVPGRDGVPGGPGETGKNGGFGRRGPPGAKGNKGGPGQPGFEGEQGTRGAQGPAGPAGPPGLIGEQGISGPRGSGGAAGAPGERGRTGPLGRKGEPGEPGPKGGIGNRGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGNPGEPGLNGTT--GPKGIRGRRGNSGPPGIVGQKGDPGYPGPAGPKGNRG 2371          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 133.65 bits (335), Expect = 6.495e-32
Identity = 180/433 (41.57%), Postives = 215/433 (49.65%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            GT G  G PG KGD                G +G  G+ G  GV VKG+ G    QG PG KG+ G+ G    PG  G  G+ GKKG KG++G+KGEKG  G++G++GE GE G  G  G  G  G+ G  G  G KG+ G  G KG  GTPG                      ++G  G  G  G PG  G+ G KGEKG  G  G+KG  G        G  G+ G+ G  G KG  G PG KG KGA G  G +G PG +G+ G  GL G  G+ G  GTPG +GD+G  G  G  G  GT  PG KG KGE GL G  G+KG  G KG NG PG  G+ G KG  G KG        G  G+ G  G  G KG +G  G +G  G  G  G  G +GT G  G+ G  G KG  G PGQ+G    K L
Sbjct:   80 GTNGKDGTPGDKGDT---------------GDKGDKGDTGAPGVGVKGDPGA---QGPPGEKGKDGDKGA---PGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKG-------------------DKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTP------GSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGT--PGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGL 464          

HSP 2 Score: 128.257 bits (321), Expect = 3.966e-30
Identity = 179/432 (41.44%), Postives = 208/432 (48.15%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG---------LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGL---PGIEGEPGDQGEIGAMGLIGLP---------------GESGLRGTPGPEGDEGLHGPIGDDGPRGT-------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GEKG  G KG PGAKG  G+ G  G KG  G+ G +G PG+ G KG     E G +GS G PG KG+KG  G  GNPG           G  G  G KG KG++G KG  G  G +G+ G+ GE G  G  G  G +G PG    KG KG  G  G KG  GTPG    KG              +  +G  G PG  G  GE G  G KG+KG  G  G KGD G  G  G  G  G PG  G +G KG  G  G+KG  GAKG    PG +G+ G++G  GA G  G P               G+ G  GTPG +GD+G  G  G  G  GT          G KG  G  G  GD GEKG  GPKG+ G  G PG  G KGE G       G  G  GT G+ G KG +G+ GP+G  G  G  G  G
Sbjct:  121 GEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKG-----EKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPG---SKGDKGEKGADGAKGADGTPGSKGDKGA-------------DGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKG-----ADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKG 526          

HSP 3 Score: 117.472 bits (293), Expect = 9.806e-27
Identity = 156/391 (39.90%), Postives = 187/391 (47.83%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRG 2153
             EK L  G KG  G+ G PGAKGD G+KG  G KG  G  G +G  GE G+ G    KG  G +G+ G PG KG+KG  G  G  G  G                          G +G+ GE GL G  G  G  G PG    KG KG  G  G KG  GTPG    KG              +  +G  G PG  G  GE G  G KG+KG  G  G KGD G+ G  G  G  G PG    +G KG+ G  G KG KGA G PG +G+ G++G+IG  G  G  GE G  G PG +G +G  G  GD G +G    G  G  G+ G  G  G+KGD+G KG+ G P      G KG+ GDKG    G+ G+ G  G  G KG +G  G
Sbjct:  301 GEKGL-DGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTP------------------------GAKGDKGEKGLDGPKGDKGADGTPG---AKGDKGEKGADGAKGADGTPGSKGDKGA-------------DGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPG---SKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQP------GQKGDKGDKGQD--GQPGQKGQDGQPGQKGQDGQPG 639          

HSP 4 Score: 91.6633 bits (226), Expect = 1.169e-18
Identity = 99/258 (38.37%), Postives = 120/258 (46.51%), Query Frame = 3
Query: 1572 GIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G+PG NG  G  G+KG  G  G+KGD G  G             +G++G  G  G PGEKG  G KG PG                 GE G++G  G  G  G  GE G  G+PG +GD+G  G  G+ GP+G    G  G KG  G  G  G+KG  G KG +GNPG  G+ G KGE G  G    G  G  GT G+ G KG +G  G +G  G  G  G  G +            G KG  G PGQ+G    K L
Sbjct:   77 GVPGTNGKDGTPGDKGDTGDKGDKGDTGAPG-------------VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDK--GADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDG--AKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGAD------------GAKGADGTPGQKGDKGEKGL 305          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 126.716 bits (317), Expect = 6.417e-30
Identity = 163/402 (40.55%), Postives = 197/402 (49.00%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GT G  G PG KGD                G +G  G+ G  GV VKG+ G QG    PG KG+ G+ G    PG  G  G+ GKKG KG++G+KGEKG  G++G++GE GE G         ++G PG +G KG KG  G  GPKG+ G  G                   S  ++G  G  G  G PG  G+ G KGEKG  G  G+KG  G        G  G+ G+ G  G KG  G PG KG KGA G  G +G PG +G+ G  GL G  G+ G  GTPG +GD+G  G  G  G  GT          G KG  G  G  GD GEKG  GPKG+ G  G PG  G KGE G       G  G  GT G+ G KG +G+ GP+G  G  G  G  G
Sbjct:   80 GTNGKDGTPGDKGDT---------------GDKGDKGDTGAPGVGVKGDPGAQG---PPGEKGKDGDKGA---PGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEKG---------SNGSPGSKGDKGEKGADGNPGPKGDKGADGAKG----------ADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTP------GSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKG-----ADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKG 430          

HSP 2 Score: 123.25 bits (308), Expect = 6.646e-29
Identity = 154/387 (39.79%), Postives = 188/387 (48.58%), Query Frame = 3
Query: 1002 RGEKGTVGSKG---HPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRG 2153
            +G+KG+ G+KG   +PG+KGD G+KG  G  G KGD G  G PG  G KG   KG  G +G+ G PG KG+KG  G  G  G  G                            +G+ GE GL G  G  G  G PG    KG KG  G  G KG  GTPG    KG              +  +G  G PG  G  GE G  G KG+KG  G  G KGD G+ G  G  G  G PG    +G KG+ G  G KG KGA G PG +G+ G++G+IG  G  G  GE G  G PG +G +G  G  GD G +G    G  G  G+ G  G  G+KGD+G KG+ G P      G KG+ GDKG    G+ G+ G  G  G KG +G  G
Sbjct:  213 KGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGE--KGADGAKGADGTPGSKGDKGADGAKGADGTPG---------------------------QKGDKGEKGLDGPKGDKGADGTPG---AKGDKGEKGADGAKGADGTPGSKGDKGA-------------DGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPG---SKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKGDKGDKGQGEKGQDGQPGQKGQDGQPGQKGDKGEKGDIGQP------GQKGDKGDKGQD--GQPGQKGQDGQPGQKGQDGQPG 543          

HSP 3 Score: 103.99 bits (258), Expect = 1.290e-22
Identity = 121/300 (40.33%), Postives = 146/300 (48.67%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G++G+ G+ G PG+    G  G PG QG  G KG  G      + G PG    KG  G KG KG  G+           G  G PG+ G+ G KGEKG  G  G KGD G+ G  G  G  G+ G  G +G  G  G  G+KG+ GAKG  G  G  GD G+ G  G  G  G+ G  GTPG +GD+G  G  G  G  GT          G KG  G  G  GD GEKG  GPKG+ G  G PG  G KGE G       G  G  GT G+ G KG +G +G  G  G  G+ G+ G +
Sbjct:   95 GDKGDKGDTGAPGV----GVKGDPGAQGPPGEKGKDG------DKGAPGAKGSKGDDGKKGDKGSSGEK----------GEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKG-----ADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLD 369          

HSP 4 Score: 98.9821 bits (245), Expect = 4.736e-21
Identity = 128/344 (37.21%), Postives = 151/344 (43.90%), Query Frame = 3
Query: 1353 GLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKG---------------------EKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGE------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G+PG  GK GT G          KG+ G  G KG++G PG                        G +GDPG  G PGE G  G KG                     EKG  G  G+KGD G+ G+    G  G PG  G +G KG  G PG KG KGA G  G +G PG +G+ G+ G  G  G  G +G  G +G++G  G  GD G  GT  PG KG KGE       G  G  G KGD+G  G  G  G PG+ G KGE   KGL    G  G  GT G  G KG +G  G +G  G  G  G  G +            G KG  G PGQ+G    K L
Sbjct:   77 GVPGTNGKDGTPG---------DKGDTGDKGDKGDTGAPG-----------------------VGVKGDPGAQGPPGEKGKDGDKGAPGAKGSKGDDGKKGDKGSSGEKGEKGSPGQKGDKGEKGEK---GSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGT--PGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGE---KGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGAD------------GAKGADGTPGQKGDKGEKGL 368          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 109.383 bits (272), Expect = 7.416e-24
Identity = 165/469 (35.18%), Postives = 208/469 (44.35%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXX------XXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGN---PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG--KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVK------------------------------------GEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP------GESGLRGTPGPEGDEGLHGPIGDD----GPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKG-----EIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGP--RGPIGLVGEVGKVGY 2201
            +RG  G  G  GHPGA G  G +G PG  G      + GD+G +G  G+ G+ G    G  G+QG  G+PG KGE+G  G  G    PG+ G AG                       G  G+ G  G PG+ G  G  G    G++G+KG  G  G  G  GNSG PG    KG                + GP G PG  G+ G  G +GV+                                    G  G  G+ GEKG  G  G  G  GL G PG  G++G KG++G  G++G +G  G+PG  GE G QGE G  G  G P      GE G  G PG EGD G  GP+G+     GP G    G  GV+G  GL G  G  G  GP+G  G PG PG+ GI G     E GD+G        G+ G  G  G+ G  G +G+ G   +GP GL G+ G+ G+
Sbjct:   47 ERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGS--PGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGP---------------------PGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKG----------------DPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQ--GFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGF 474          

HSP 2 Score: 103.605 bits (257), Expect = 5.419e-22
Identity = 153/416 (36.78%), Postives = 178/416 (42.79%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGE-MGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAG---IPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE----------------IGQPGEKGTKGAKGLPGIEGEP---GDQGEIGAMGLIGLPGESGLR-----------------------GTPGPEGDEGLHGPIGDDG-PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            D G RG  G++G+ G    KG  G QG  G PGY G KG  G  G PG  GF G+ G                   +G  GE  GE G  G  G  G  G  G  G  G  G VG  GP G  G PG+  I G+ G             +RG  G PG AG   +PGE G+ G  GE GL G    +G  G  G+ G+DG  G PG IG  G  GE                 G PGE+G  G  G PG+ GEP   G QGE+G  G+ G  GE GL                        G PGP GD G  G  G DG P    LPG  G  GE G+ G  G  G  G +GE+G  GI G+ G  G  G +G    G  G  G  G  G  G++G  G  G  G  G  G+ GY
Sbjct:  301 DAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGP------------------EGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKG--------DRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD-IQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQD--GGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGY 687          

HSP 3 Score: 95.1301 bits (235), Expect = 1.714e-19
Identity = 146/428 (34.11%), Postives = 182/428 (42.52%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGK-----------------------IGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE G  GS G PG  G          +G +G+ G+ G PGENG+ G+        +KGE G+ G  G PG  G+ G  G  G PG  G             NG  G +G  G+ G RGE G+ G PG+ G+                        G  G+ G+ G  G  G  G  G  G  G+PG+  + G+ G  G  G+           G PG  G+PG +G  G  G  G  G+ G +G  G  G  G+DG  G PG  G  G  GE G PG  G +G  G  G  G PG  G  G  G  G PG  GL G PG  G EGL GP+                   M +    G+ G+ G  GE G PG+PG+ G+ G  G  G       G  GT G  GP GL G+ G  G  G  G  G+ G
Sbjct:  883 GEDGFPGSPGQPGYPGQ---------QGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPG------------ENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGL----------PGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPM------------------AMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYP-----GAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTG 1256          

HSP 4 Score: 93.5893 bits (231), Expect = 6.280e-19
Identity = 140/378 (37.04%), Postives = 183/378 (48.41%), Query Frame = 3
Query: 1113 GFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG---------LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNP------GIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G PG+ G++G    GE G  GS G PGY G++G  G  G PG+ G  G  G +G  G  G KGE G  G+ G  G  G++G PG    +G  G PG+ G  G +G  G+ G +G SG PG+  + G  G  G  G  G       P  D  + G PG+ G  G  G  GL G  G  G+ G  G+ G  G         L G PG+ G+ GL G+ G     G  GA G+PG+EG PG +G+ G  G  G PG  G  G PG   + GL G           +PG +G  G+ G  G  G+ G +GP+G++G P      G+PG  G +G  G   ++V    G+ G  G  G KG  G+ G     GL G  GK GY
Sbjct:  871 GIPGQPGLEGEC--GEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPG---DVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQD--IYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGH---DGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPG---ERGLPG-----------VPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDN---GLSGPPGKAGY 1221          

HSP 5 Score: 85.8853 bits (211), Expect = 1.198e-16
Identity = 139/406 (34.24%), Postives = 175/406 (43.10%), Query Frame = 3
Query: 1113 GFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG---VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIG---IQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLI------------------GLPGESGLRGTPGPE--GDEGLHGPIGDDGPRG-------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G+PG NG  G A      G  G  G  G PGY GE G  G  G PG                           + G+RGE G +G+ G  G+ GT G  G+ G  G+ G  G  G  G  G PG    +G  G             + G  G PG +GIPGE+G +G   ++GE G  G+ G +G+ G+ G  G DG+ G PG+ G   + GL G  GQPG  G  G  G PG  G+PG+ G +   G                    GLPG +G RG  G    G+ GL G  GD G  G             T +PG+KG  G  GL             G  GN GIPG+ G++GE G+ G     G+ G  G  G  G KG  GI G  G  GL G+ G+ G
Sbjct:  575 GYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPG---------------------------QPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPG-------------SPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGL------------PGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPG 928          

HSP 6 Score: 85.1149 bits (209), Expect = 2.026e-16
Identity = 182/522 (34.87%), Postives = 230/522 (44.06%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG---------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGD-----PGLAGIPGE------------------NGNIGVKGEKGLMGISGEKGD------IGKSGKLGKDGLIGEPGKIGI---QGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGE---------IGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-------LPG-----------------------IKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV------------GIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            K+G  GT G++G  G  G                 G  G PG+NG+ G    G  G QG  G PG  G  G +GI G  GL+GF G RG+ G  G  G +GE GE G +G           G  G  GLPG  G+ G  G+ G+ G  G++G  G+ G     G PG +   G  G  G  G  G   +N  RG  GD     PGL+G PG+                   G  G+KGE GL G+ G +G+       G  G+ G+DG  G PG+ G    QG +GE G PG  G  G  GL G +G+PG +GE          G+ G +G PG+ G  G PG  GD G  G  G  G RG +       LPG                       I G  G+ G  G  G  G  G  G NG PG PG+             G+ G  G++GL  + GK G  G  G  G  G+EG+       GL G+ G+ GY G  G  G  G  G++GLPGVPGQ+G
Sbjct:  636 KKGRDGTPGTRGQDGGPGYS---------------GEAGAPGQNGMDGY--PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGV------PGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQG 1134          

HSP 7 Score: 84.7297 bits (208), Expect = 2.772e-16
Identity = 134/379 (35.36%), Postives = 166/379 (43.80%), Query Frame = 3
Query: 1185 MPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG------------------------------------LIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGL-VGEVGKVG 2198
             PG KGE+GN G GG PG  G  G  G +G  G  G  G +G+ G  G++G  G+ GLP      G+ G PG QG+ G  G  G+ G  G +GT G                           G PGLAG PG++G  G  G  GL G  GE    G     G+ G+ GE G+ G+ GL G  G PG KG KG  G  G+ G PG  G  G MG                                    L G  G +G++G  G +G  G  G +G DGP     PG  G+KG+ G +GD G++G RG        G+PG  G KG  G++GL       G  G  G  G  G  G EG  GP GP+G   GE G  G
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLP------GSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGF-------------------------PGMPGLAGPPGQSGQNGNPGRPGLSGPPGE----GGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGP-----PGYPGLKGQKGDLGDAGQRGKRGKD------GVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHG 373          

HSP 8 Score: 83.9593 bits (206), Expect = 5.192e-16
Identity = 135/373 (36.19%), Postives = 161/373 (43.16%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGD------IXXXXXXXXXXXXXDIGFRGFPGENGIKG-------VAVKGEAGVQGSQGMPGYK-----------------------GEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNR---GEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQG-----LKGEIGQPGEKGTKGAKGLPGIEGE------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMG 1967
            + G  G  G  G PG KG+       G  G  G+ G  GD+G+ G PGENG  G         ++GE+G  G  G+PG                         G  G  G  G PGL G  G  G  G  G+ GQ G  G  G  G     G  GE GLPG+ GK G  G PG  G+ G +G  G  G  G  G PG                   SN   G +G PG+ G  G +G+ G  G  G  GI G +GD G  G+ G DGL G PG+ G+ G     ++   GQPGE G  G KG PG+ G+      PG  G  GA G  G PG  GL G PG  GD+G  G  G  G     LPG  G  G  G
Sbjct:  914 ENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPG-------------APGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTG--NPGLPGTPGYPGSPG 1271          

HSP 9 Score: 51.9878 bits (123), Expect = 2.835e-6
Identity = 51/125 (40.80%), Postives = 64/125 (51.20%), Query Frame = 3
Query: 1836 LPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
             PG  G RG PG  G+ G  G  G DGP G    PG+ G +G+ G +G  G +GDRG  G  G+PG+ G  G+ G  G++G+    G  G  G  G  GP G  G  G  G  GL G  G+ G N
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVN 165          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: emb-9 (Collagen alpha-1(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17139])

HSP 1 Score: 107.457 bits (267), Expect = 3.903e-23
Identity = 165/469 (35.18%), Postives = 208/469 (44.35%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXX------XXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGN---PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG--KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVK------------------------------------GEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP------GESGLRGTPGPEGDEGLHGPIGDD----GPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKG-----EIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGP--RGPIGLVGEVGKVGY 2201
            +RG  G  G  GHPGA G  G +G PG  G      + GD+G +G  G+ G+ G    G  G+QG  G+PG KGE+G  G  G    PG+ G AG                       G  G+ G  G PG+ G  G  G    G++G+KG  G  G  G  GNSG PG    KG                + GP G PG  G+ G  G +GV+                                    G  G  G+ GEKG  G  G  G  GL G PG  G++G KG++G  G++G +G  G+PG  GE G QGE G  G  G P      GE G  G PG EGD G  GP+G+     GP G    G  GV+G  GL G  G  G  GP+G  G PG PG+ GI G     E GD+G        G+ G  G  G+ G  G +G+ G   +GP GL G+ G+ G+
Sbjct:   47 ERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGS--PGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGP---------------------PGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKG----------------DPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQ--GFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGF 474          

HSP 2 Score: 97.0561 bits (240), Expect = 4.856e-20
Identity = 150/439 (34.17%), Postives = 179/439 (40.77%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIX-XXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIK--------------GFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE------------------GLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGD---RGPKGENGN---PGIPGEV------------------GIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLE 2141
            +GE+G  G  G PGA+G  G    L       G  G  G PG  G +G   + G  G  G  G PG  GE+G  G+ G PGL G                          G RG+ GE+G  GI G     G+PG  G                GF G VG  GP G++G  G                    +   G  G PG  G PGE G  G  G  G  G  GE G +G  GK G+DG  G  G+ G  G  GE G PG+ G  G  G PG +G PG  G+ G  G  G+PGE GL G PG  G+                   GL G  G  G  GT  LPG+ G  G+ G +G+ GE G    RG  GE GN   PG PG+V                  G+ GE GD G S  G  G  G  G+ G  GL+
Sbjct:  699 KGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHG------------------------EPGMRGQQGEVGFNGIDGDC---GEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPG----------------PDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLD 1094          

HSP 3 Score: 92.8189 bits (229), Expect = 9.517e-19
Identity = 146/428 (34.11%), Postives = 182/428 (42.52%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGK-----------------------IGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE G  GS G PG  G          +G +G+ G+ G PGENG+ G+        +KGE G+ G  G PG  G+ G  G  G PG  G             NG  G +G  G+ G RGE G+ G PG+ G+                        G  G+ G+ G  G  G  G  G  G  G+PG+  + G+ G  G  G+           G PG  G+PG +G  G  G  G  G+ G +G  G  G  G+DG  G PG  G  G  GE G PG  G +G  G  G  G PG  G  G  G  G PG  GL G PG  G EGL GP+                   M +    G+ G+ G  GE G PG+PG+ G+ G  G  G       G  GT G  GP GL G+ G  G  G  G  G+ G
Sbjct: 1140 GEDGFPGSPGQPGYPGQ---------QGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPG------------ENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGL----------PGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPM------------------AMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYP-----GAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTG 1513          

HSP 4 Score: 91.2781 bits (225), Expect = 2.699e-18
Identity = 140/378 (37.04%), Postives = 183/378 (48.41%), Query Frame = 3
Query: 1113 GFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG---------LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNP------GIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G PG+ G++G    GE G  GS G PGY G++G  G  G PG+ G  G  G +G  G  G KGE G  G+ G  G  G++G PG    +G  G PG+ G  G +G  G+ G +G SG PG+  + G  G  G  G  G       P  D  + G PG+ G  G  G  GL G  G  G+ G  G+ G  G         L G PG+ G+ GL G+ G     G  GA G+PG+EG PG +G+ G  G  G PG  G  G PG   + GL G           +PG +G  G+ G  G  G+ G +GP+G++G P      G+PG  G +G  G   ++V    G+ G  G  G KG  G+ G     GL G  GK GY
Sbjct: 1128 GIPGQPGLEGEC--GEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPG---DVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQD--IYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGH---DGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPG---ERGLPG-----------VPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDN---GLSGPPGKAGY 1478          

HSP 5 Score: 83.5741 bits (205), Expect = 7.297e-16
Identity = 139/406 (34.24%), Postives = 175/406 (43.10%), Query Frame = 3
Query: 1113 GFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG---VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIG---IQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLI------------------GLPGESGLRGTPGPE--GDEGLHGPIGDDGPRG-------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G+PG NG  G A      G  G  G  G PGY GE G  G  G PG                           + G+RGE G +G+ G  G+ GT G  G+ G  G+ G  G  G  G  G PG    +G  G             + G  G PG +GIPGE+G +G   ++GE G  G+ G +G+ G+ G  G DG+ G PG+ G   + GL G  GQPG  G  G  G PG  G+PG+ G +   G                    GLPG +G RG  G    G+ GL G  GD G  G             T +PG+KG  G  GL             G  GN GIPG+ G++GE G+ G     G+ G  G  G  G KG  GI G  G  GL G+ G+ G
Sbjct:  832 GYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPG---------------------------QPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPG-------------SPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGL------------PGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPG 1185          

HSP 6 Score: 82.8037 bits (203), Expect = 1.354e-15
Identity = 135/379 (35.62%), Postives = 165/379 (43.54%), Query Frame = 3
Query: 1185 MPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG------------------------------------LIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGL-VGEVGKVG 2198
             PG KGE+GN G GG PG  G  G  G +G  G  G  G +G+ G  G++G  G+ GLP      G+ G PG QG+ G  G       KG  G PG                    N   G  G PGLAG PG++G  G  G  GL G  GE    G     G+ G+ GE G+ G+ GL G  G PG KG KG  G  G+ G PG  G  G MG                                    L G  G +G++G  G +G  G  G +G DGP     PG  G+KG+ G +GD G++G RG        G+PG  G KG  G++GL       G  G  G  G  G  G EG  GP GP+G   GE G  G
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLP------GSPGHPGLQGLDGLPGL------KGEEGIPG-------------------CNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGE----GGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGP-----PGYPGLKGQKGDLGDAGQRGKRGKD------GVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHG 373          

HSP 7 Score: 82.4185 bits (202), Expect = 1.401e-15
Identity = 142/409 (34.72%), Postives = 171/409 (41.81%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGV-AVKGEAG-----VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG----------VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEP---GDQGEIGAMGLIGLPGESGLR-----------------------GTPGPEGDEGLHGPIGDDG-PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G  G PG  GI G   +KGEAG     ++   G+PG KG+ G  G+ G PG  G  G  G  G  G  G +GE G  G  G RG  G +G+PG+ G  G S  PG+ G  G+KG  G  G                                        L G+PG  G  G          V G+ G+ G+ G  GD       G DGL G PG +G  G  G    PGE+G  G  G PG+ GEP   G QGE+G  G+ G  GE GL                        G PGP GD G  G  G DG P    LPG  G  GE G+ G  G  G  G +GE+G  GI G+ G  G  G +G    G  G  G  G  G  G++G  G  G  G  G  G+ GY
Sbjct:  588 GLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDS-FPGQPGTPGYKGERGADG----------------------------------------LPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGD------RGADGLPGLPGPVGPDGYPGT---PGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQD--GGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGY 944          

HSP 8 Score: 82.4185 bits (202), Expect = 1.499e-15
Identity = 182/522 (34.87%), Postives = 230/522 (44.06%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG---------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGD-----PGLAGIPGE------------------NGNIGVKGEKGLMGISGEKGD------IGKSGKLGKDGLIGEPGKIGI---QGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGE---------IGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-------LPG-----------------------IKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV------------GIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            K+G  GT G++G  G  G                 G  G PG+NG+ G    G  G QG  G PG  G  G +GI G  GL+GF G RG+ G  G  G +GE GE G +G           G  G  GLPG  G+ G  G+ G+ G  G++G  G+ G     G PG +   G  G  G  G  G   +N  RG  GD     PGL+G PG+                   G  G+KGE GL G+ G +G+       G  G+ G+DG  G PG+ G    QG +GE G PG  G  G  GL G +G+PG +GE          G+ G +G PG+ G  G PG  GD G  G  G  G RG +       LPG                       I G  G+ G  G  G  G  G  G NG PG PG+             G+ G  G++GL  + GK G  G  G  G  G+EG+       GL G+ G+ GY G  G  G  G  G++GLPGVPGQ+G
Sbjct:  893 KKGRDGTPGTRGQDGGPGYS---------------GEAGAPGQNGMDGY--PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGV------PGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQG 1391          

HSP 9 Score: 79.7221 bits (195), Expect = 9.903e-15
Identity = 133/376 (35.37%), Postives = 160/376 (42.55%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGD------IXXXXXXXXXXXXXDIGFRGFPGENGIKG-------VAVKGEAGVQGSQGM-----------------------------PGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQG-----LKGEIGQPGEKGTKGAKGLPGIEGE------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMG 1967
            + G  G  G  G PG KG+       G  G  G+ G  GD+G+ G PGENG  G         ++GE+G  G  G+                             PG  G+ G  G+ G PG  G  G  G  G  G  G  G  GE G  G  GE    GLPG+ GK G  G PG  G+ G +G  G  G  G  G PG                   SN   G +G PG+ G  G +G+ G  G  G  GI G +GD G  G+ G DGL G PG+ G+ G     ++   GQPGE G  G KG PG+ G+      PG  G  GA G  G PG  GL G PG  GD+G  G  G  G     LPG  G  G  G
Sbjct: 1171 ENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGER---GLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPG-------------APGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTG--NPGLPGTPGYPGSPG 1528          

HSP 10 Score: 73.559 bits (179), Expect = 7.421e-13
Identity = 159/476 (33.40%), Postives = 201/476 (42.23%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGF----AXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGK---IGTSGKPGKQGIKGF-----KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKG----DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKG------AKGLPGIEGEPG---------------DQGEIGAMGLIGLPGESG---------LRGTPGPEGDEGLHG--------PIGDDGPRG-TALPGIKGVKGE---------------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG---PIGLVGEV-GKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            D G RG  G++G+ G    KG  G QG  G PGY G KG  G  G PG  GF              G  G  G +G  G QG +G  G  GLPG +G    +G  G PG+ GI G      KG+ G+ G  G +G PG +  +        +      ++    QG PGL G  G +G  G+ G+ G  G SGEKG     + K G  G  GL GEPG  G  G+ G  G PG  G +G        G+PG  G+PG               D G+ G  G  G PG +G         L G PG  G +G  G        P G  G +G   LPG+ G  G                 GL G+ G  G  G +G  G+ GIP   G++G  GD      G  G  G  G  G  GL G +GPRG   P+ +V +V G+ G +               G+PG+PG RG   L  L
Sbjct:  301 DAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPG-LPGEPGDCGYPGEDGLPGYDI----QGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIP---GLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVD---------------GMPGLPGDRGADGLPGL 753          

HSP 11 Score: 50.8322 bits (120), Expect = 6.308e-6
Identity = 51/125 (40.80%), Postives = 64/125 (51.20%), Query Frame = 3
Query: 1836 LPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
             PG  G RG PG  G+ G  G  G DGP G    PG+ G +G+ G +G  G +GDRG  G  G+PG+ G  G+ G  G++G+    G  G  G  G  GP G  G  G  G  GL G  G+ G N
Sbjct:   41 CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVN 165          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Match: let-2 (Collagen alpha-2(IV) chain [Source:UniProtKB/Swiss-Prot;Acc:P17140])

HSP 1 Score: 106.686 bits (265), Expect = 5.623e-23
Identity = 187/511 (36.59%), Postives = 233/511 (45.60%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGE---------------NGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHG----------PIGDDGPRGTALPGIKGVKGEMG------------LIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-------------------LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXX-----------------------XXXXXLPGVPGQRGTFILKNL 2300
            G  G  GS G PG KGD G  GLPG  G +   G RGFPG  G+KG       G+ G  G PGY GEKG+ G+ G PG  G  G  G+ G+ G              G +GE G  GLPG+ G  G  G PG+ G  G  G  G  G KGN+G PG    KG  G  G  G+    N  +G  G PG+ G PG                +G  G+KG++G  G+ GEKG+ G + + G+ G  G PG+ G++G +G  G PG  G KG  GLPG  G+PG  GE    GL G+PG++G +G PG  G +GL G          P  D  P    LPG+ G KG++G            L G  G  G RG KG+ G PGIPG+ G+ G  G KG                       G  G  G+ G  G  GL GI G +G  G  G+ G+ G  G  GE G  G                        +G  G PG+PGQ+G   L  L
Sbjct:  821 GVPGQPGSPGFPGLKGDAGLPGLPGTPGLE---GQRGFPGAPGLKG-----GDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGV------------PGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGL----NGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGE---KGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGL 1303          

HSP 2 Score: 80.4925 bits (197), Expect = 6.430e-15
Identity = 155/454 (34.14%), Postives = 198/454 (43.61%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGN---VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIG---------------EPGK-----------IGIQGLKGEIGQPGEKGTKGAKGLPG---------IEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG----PRGTALPGIKGVKGEMGLIG------------------DIGEKGDRGP-----------------------------KGENGNPGIPGEVGIKGEIGDKGL 2078
            A    + G+KG  G  G PG +G  G  GL          G  GF GE G+ G    G+ G +G  G+PG  G +G  G  G  GL GF G +G+ G  G +G  G  G  G  G +G++G+ G PG+ G  G  G+PG  GI+G KG     G  G +G  G PG+    G  G  G  G+ G+           G  G PG  G+ G  G+ GL GI G KGD G  G+ G++GL G               +PG+            G+QG  G  G PG+KG  G  GLPG         + G PG +G++GA G+ G  GE GL G PG +G  G+ G  G+ G    P     PGI G+KGE GL G                    GEKGD G                               GE G PG+PG  G++GE G  GL
Sbjct: 1027 AGPAARDGQKGDAGLPGQPGLRGPQGPSGL---------PGVPGFKGETGLPGYGQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFA-------GTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGL 1464          

HSP 3 Score: 67.781 bits (164), Expect = 4.530e-11
Identity = 93/251 (37.05%), Postives = 109/251 (43.43%), Query Frame = 3
Query: 1353 GLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPG---ENGNIGVKGEKG-----LMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG-------------PRGTALPGIKGVKGE-MGLIGDIGEKGDRGPKGENGNPGIPG 2039
            G PG+ G  G  G PG +G  G++G  G+S P    G PGK                          G PGL G PG   ENG  GV+G  G     L G  G++G  G +G  G+DG+ G PG  G +G +G        GTKG KGLPG  G+PG Q            G+ GL G PGP GD       GDDG             P     PG+ G KGE   L    G  G  G KGENG PG PG
Sbjct:  429 GAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIP----GLPGK-------------------------DGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQ------------GDRGLPGMPGPVGD------AGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPG 632          

HSP 4 Score: 67.0106 bits (162), Expect = 8.053e-11
Identity = 129/338 (38.17%), Postives = 164/338 (48.52%), Query Frame = 3
Query: 1338 EMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENG-----NIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG------PRGTALPGIKGVKGEMGLIGDIGEKGDRG-P-----KGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            E G+ GLPG+      SGKPG+ G+ G  GN G++G  G  G PG    KG  G  G  G              PGL G+PGE       N    G+ GL G+ G KG+ G  G+ G+   +G+PG  G+ G+KG+       G  G  GLPG  G PGD+G  G  GL G+PG  G  G P   G  GL+G  G+ G      P     PG+KG  G  GL G  G +G RG P     KG +G PG+ G+ G  GE GD GL  +   G+ G+ G  G  GL G+ G +G  GL G  G  G  G  G  G+ G  G  G PG PG +G   +  +
Sbjct:  654 EKGDAGLPGL------SGKPGQDGLPGLPGNKGEAG-YGQPGQPGFPGAKGDGGLPGLPGT-------------PGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGE---VGQPGFPGLPGMKGD------SGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNP---GLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLPGV--PGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGV 957          

HSP 5 Score: 65.855 bits (159), Expect = 1.681e-10
Identity = 169/486 (34.77%), Postives = 204/486 (41.98%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG--LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG------KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGD--PGLAGI----------PGENGNIGVKGEKGLMGISG---------------------EKGDIGK---SGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAK------------GLPGIEGEPGDQGEI-----GAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM------------------GLIGDIGEKGDRGPKGENGNPGIPG--------EVGIKGEIGDKGLSVI----GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGT 2282
            + G+RG PG++ I G+   G+ G  G  G PG KGE G  G+ G PG  L G  G  G++G  G              G  G  G  GLPG  G  G  G       PG +G KG  G  G+ GP+G+ G PG     G  G  G  G  G+      P  D  PGL G           PG  G  G+KGE G  G  G                     EKGD G    SGK G+DGL G PG  G  G     GQPG+ G  GAK            GL G+ GEP  + ++     G  GL GLPG  G  G PG  G+ G  G            PG+ G+KG+                   G  G  G  G  GPKG+ GNPG+PG         VG+ G+ G  G   +    G  G  GT G  G +G  G  G +G  GL G  G+ GY          GEKGD GLPGVPG+ G+
Sbjct:  448 EPGYRGTPGQS-IPGL--PGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQRGAPGP------------NGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAG----YGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPG-----------FPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGY---------PGEKGDAGLPGVPGREGS 894          

HSP 6 Score: 51.9878 bits (123), Expect = 2.710e-6
Identity = 125/381 (32.81%), Postives = 154/381 (40.42%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGN--------RGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGN---SGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGE-----------------------------------IGAMGLIGLPGESGLRGTPG------------------PEGDEGLHGPIGDDGPRG----TALPGIKGV 1952
            G  G  G+PG KG+ G  G PG  G  G+ GF G PG  G+KG       G  G  G+PG  G KG++G  G PG  G  G  G+KG+ G  G  G+ G+              +G+ G  GLPG  G+ G SG PG  G+KG  G  G  G KG+   +G PGK                         +G+ GL G+PG +G  G+ G KG               ++G  GL G+PG  GI GLKGE G PG  G KG  G PG  G PG  GE                                    G  GL GLPG  GLRG  G                    G++G  G  G  G +G       PG+ G 
Sbjct: 1174 GDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKG-----SPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGFPGAKGDLGANGIPGK-------------------------RGEDGLPGVPGRDGQPGIPGLKG---------------EVGGAGLPGQPGFPGIPGLKGEGGLPGFPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQ 1509          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333541)

HSP 1 Score: 126.331 bits (316), Expect = 6.701e-29
Identity = 170/420 (40.48%), Postives = 203/420 (48.33%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGT--------------SGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK---------LGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G VG+KG+PG  GD G++G PG  G  G+ G  G  G  G +GV   G+  +QG  G PG  G KG  G  G PG  G AG  G KGVKG             QG  G +G+ GLPG  G+ G               +G+    G KG KG VG  G  G +G  G +   G +G  G          N G QG PG  GIPG  G IG  GE+G +G +G +GDIG  G           G DG  G PG  G+ G KGE G PG  G  GAKG+    G  GD GE G  G IG PG  G +G           GP+GD  P   AL G+ G KGE+G  G  G  G  G KG+ G+ G+PG+ G  GE G KGL   G  G+ G  G  G  G  G +GP+GP G  G VG  G N
Sbjct:  763 GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVP--GQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKG------------EQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLG----------NAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQ---------RGPVGDSQP---ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLG--GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN 1144          

HSP 2 Score: 122.479 bits (306), Expect = 9.921e-28
Identity = 163/453 (35.98%), Postives = 212/453 (46.80%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV-------KGEAGVQGSQGMPGYKGEKGNTGIGGN--PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLM-------------------------------GISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEG--------------EPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG  G  G KG  G  G  G  G  G  G KG+ G  GFPG  G KGVA         GE+G+ G  G PG  G KG  G  G+  P L G AG +G+ G  G NG  G  G  G++G+RG  G+ G PG  G  G  G PG+ GI G KG  G  GP+G                             +GPQG+ G+ G+ G NG IG +G +GL+                               G +G++G  G+ G+ G  G IG  G  G +G +G+IG  G+ G  GA+GL G +G              E GD+G  G  G  G PG  G +G PGP G+ G +G IG  GP+    PG +G  G  G  G  G  G  GPKGE G      ++G +GE G+ G +++G+ G  G IG  G  G +G +G +G  GL G+ G+VG
Sbjct:  968 RGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGP----------------------------KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELG------DMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVG 1386          

HSP 3 Score: 119.783 bits (299), Expect = 7.063e-27
Identity = 166/472 (35.17%), Postives = 213/472 (45.13%), Query Frame = 3
Query: 1113 GFPGENGIKG------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGN-------------------------PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSG------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV----NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIG---KSGKLGKDGLIGEPGK------------IGIQGLKGEIGQPGEKGTKGAKGLPGI------EGEPGDQGEIGAMGL---------IGLPGESGLRGT-----PGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGE---NGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFIL 2291
            G PG  G+ G      V  KGE G+ G  G+ GY+G++G  G+ G+                         PG  G+ G RG  G KG  G        G +G RG+ G+ G PG  G  G  G  G +G++G +GN G++G      P G  G PGK+   G  G     G   +  +    + G +GD G  G  G +G+ G KGE+G  G  G+ GD G   + G+ G+DG  G PG+             G  G+KGE G  G+ G KG KG P         GEPG+ G  G  G+         IGL GE G RG      PGP G +G  GP GD G +G   PG+ G  GE GL G IG KG RG  G+    G  G PG  GIKG  GD     +G  G+YG  G  GPKG++G +GP G +G  G                        LPG  GQRG F++
Sbjct:  435 GLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA--PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGD-----VGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG------------------------LPGNKGQRGDFLV 875          

HSP 4 Score: 119.013 bits (297), Expect = 1.454e-26
Identity = 166/445 (37.30%), Postives = 203/445 (45.62%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG-----KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKG-------------------------------TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP------EGDEGLHGPIGDDGPRGT---ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G+ G  G PG  G+IGE+G  G  G +GDIG RG  GE G KG++   G  G  G+ G+PG KGE GN G  G PG  G A   G KG                 G  G  G IG PG  G  G  G     +P   G+ G KG VG  GP   +G PG+  +KG                 RG +G PG  G PGE G  G+ G  G  GI+G KG  G  G  G  G  GE G +G+ G  G+IG  G +G                                +G  G  G++GE G+QG++G +G IG PG  G RG  G       +G EGL G  GD GPRG     LP  KG +G  GL G  G  G  G KG    PG PGE G  G IG +G  + G  G  G +G  G  G  G  G  GP G +G++G+ G
Sbjct:  932 QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGD---------------DGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGP---NGLPGRHGLKG----------------QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGA---PGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQG 1339          

HSP 5 Score: 103.99 bits (258), Expect = 4.682e-22
Identity = 172/480 (35.83%), Postives = 218/480 (45.42%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKG---NTGIGGNPGLLGFAXXXXXX-----XXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI---------------PGENGNIG------VKGEKGLMGISGE-----------------------KGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----SVIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G  G+PG +G +G + + G  GVQG QG PG  G KG     GI G PG +G AG  GK        KG  G  G+ G  G  G+ GE G  G  G  G+ G +G+ G  G  G++G  G+ G  G  G PG+ A        G  G  G     RG  GD G  G+               PGE+G  G       KGE+G +G+ GE                        GD G+ G  G  G  GEPG  G  G KG+ G PG+   +G  G  G  GI+G PGD G  G  GL G PG  G++G  GP+G  G  G  G+ G RG                   A  G KG KGE+G +G  G+ G +G  G +G  G+ G  G++G  G  G+     +IG+IG+ G IG  G +G  G RGP    GP GL G+ G  GY G  G  G  GE G+ G PG PG +G      +
Sbjct:  543 GDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKG-ERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGI 1021          

HSP 6 Score: 96.6709 bits (239), Expect = 9.361e-20
Identity = 134/369 (36.31%), Postives = 174/369 (47.15%), Query Frame = 3
Query: 1107 FRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG-----EIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG--LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            +RGF G+ G++G    +G+ G  G  G PG KGE+G+ G  G    LGF            +G +G KG  G QG RG  G     E G  G+ G  G +G+PG  G KG  G  G++GP G  G  G                        GPQGD G  G PG NG        GL+G  GE GD+G+ G+ G+ G  ++G  G IG  G +GE G  G KG +G  GL      PG  G +GA G  G  G++G  G    +G +GL GP G         PG+      M   GD GE G  G +GE G+ G PG +G +G+ G      +G  G  G +G TG  G +G RG +G +GL G  G
Sbjct: 1186 YRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ---LGF------------DGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPP-----------------GPQGDVGFPGAPGHNG------RHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGL------PGKNGRVGAPGPRGPTGDAGWGGI---DGMDGLVGPKGQ--------PGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG-----AVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG 1493          

HSP 7 Score: 87.8113 bits (216), Expect = 4.460e-17
Identity = 124/315 (39.37%), Postives = 154/315 (48.89%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG--EKGTKGAKG------LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEG--------LHGPIGDDGPRGTALPGI-------KGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G IG+PG+ G  G  G PG+ G  G KG+VG+ G +G  G  G +                      GP+G+ G  GI G++G  G  G +G+ G  G  G  G SG  G++G+ G PGK G QG  GE G+ G   KGTKG +G        G  G  GD+G  G  G  GL GE G  G PGP+GD G        L GP G  G  G +L G+       KG KG +GL GD   +G +GP GE G  G  G  G +GEIG  G    GK GK G  G  G KG++G  G  G  GL G  G+ G
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDI----------------------GPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGD---EGPQGPTGEQGAVGRNGLPGARGEIGGPGER--GKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERG 331          

HSP 8 Score: 81.6481 bits (200), Expect = 3.288e-15
Identity = 167/464 (35.99%), Postives = 220/464 (47.41%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGE---AGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXX-----------XXXXRQGNRGEMGEIGLPGILGKI---GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG--LAGI-------PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDG----------PRGTALPGIKGVKGEMGLIGDIGEKGDRGP-----KGENGN---------------PGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG--KVGYN 2204
            + G  G +G  G  G  GDIG  G  G  GEKGD+G  G  GE G +G +  KGE    G+ G  G PG  G +G  G  G PG+ G +G  G+ GV+G  G+ G++              G +GNRGE G+ G  G  G     G+ G  G  G+ G KG+ G  GPKG++G   ++    I                 G +G+PG  L+G+        G  G +G++G++G  G +GE+G +G++G  G  G IG PG+ G  G  GE G+ G+KG KGA G  G +G  G  GE G  G  G+PG  G  G PG   P   + L GPIG  G          P     PG +G  G  G  GD G  G RGP     +GE G+                G+PG  G+ GE    G +V+G  G+ G  G     GLEG RG RG +GL G+ G    GYN
Sbjct:   46 RMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPP--------------GAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE---PGQNVVGPKGEPGLNGQP---GLEGYRGDRGEVGLPGDKGLPGEGYN 489          

HSP 9 Score: 77.411 bits (189), Expect = 7.093e-14
Identity = 109/277 (39.35%), Postives = 140/277 (50.54%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM---------GLIGDIGEKGDRGPK---GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNT------------GPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            +G  G PG  G+PG  G  G  G  G  G  GEKGD+G+ G+ G+ G  G+ G  G  G  G +G+ GE GT G +G+ G +G PG QG  GA      PG++G+RG PG  G +G  G  G+    G    G KG +GE          G  GD G KGD G     GE G+PG+PG  G  G + +   S+IG  G  G  G++            G KG  G++G  GP G  GE G VG NG  G  GEIG  G++G PG  G+ G F  K +
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGA------PGQNGVRGPPGKPGQQGPPGEAGE---GGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGM 311          

HSP 10 Score: 63.929 bits (154), Expect = 9.847e-10
Identity = 173/529 (32.70%), Postives = 218/529 (41.21%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFA--------XXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKS--GPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--NRGPQGDPG------LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK------LGKDGLIGEPGK------IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------------QGEIGAMGLIGLPGESGLRGTPGPE--------------------------GDEGLHGPIGDD--GPRG-------TALPGIKGVKGEMGLIGDIGEKGD-------------------RGPKGENGNPGIPGEVGIKGE------IGDKG-------LSVIGKIGKYGTIGNTGPKGLEGIRGP---------RGPIGLVGEVGKVG 2198
            A  L ++G+ G  G +G  G +GDIG KG  G  G  G  G  G PG  GI G    G  G+QG  G PG  G +G  G    PG  G           ++G KG +G  GQ G  G  G  G+RG  G+ G  G+ G+ G  G PG +G  G    +  S  GP G  G PG      +K     KG +G   +  + GPQG  G        G+PG  G IG  GE+G  G  GE G  G  G        G DGL G PG+       G+ G++G  G PG       K LPG  G  GD                  +G IG  G  G PG +G RG PG                            G  GLHG  G +  GP+G         L G +G +GE+GL GD G  G+                    G  G NG  G+PGE G++G+       G +G           G  G  G IG TGP+G++G++G           GP G+ GE GKVG
Sbjct:   71 AGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGC--DGRPGMQGPSGAPGQNGVRGPPG---KPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVG 594          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0079036)

HSP 1 Score: 126.331 bits (316), Expect = 6.701e-29
Identity = 170/420 (40.48%), Postives = 203/420 (48.33%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGT--------------SGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK---------LGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G VG+KG+PG  GD G++G PG  G  G+ G  G  G  G +GV   G+  +QG  G PG  G KG  G  G PG  G AG  G KGVKG             QG  G +G+ GLPG  G+ G               +G+    G KG KG VG  G  G +G  G +   G +G  G          N G QG PG  GIPG  G IG  GE+G +G +G +GDIG  G           G DG  G PG  G+ G KGE G PG  G  GAKG+    G  GD GE G  G IG PG  G +G           GP+GD  P   AL G+ G KGE+G  G  G  G  G KG+ G+ G+PG+ G  GE G KGL   G  G+ G  G  G  G  G +GP+GP G  G VG  G N
Sbjct:  763 GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVP--GQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKG------------EQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLG----------NAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQ---------RGPVGDSQP---ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLG--GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN 1144          

HSP 2 Score: 122.479 bits (306), Expect = 9.921e-28
Identity = 163/453 (35.98%), Postives = 212/453 (46.80%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV-------KGEAGVQGSQGMPGYKGEKGNTGIGGN--PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLM-------------------------------GISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEG--------------EPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG  G  G KG  G  G  G  G  G  G KG+ G  GFPG  G KGVA         GE+G+ G  G PG  G KG  G  G+  P L G AG +G+ G  G NG  G  G  G++G+RG  G+ G PG  G  G  G PG+ GI G KG  G  GP+G                             +GPQG+ G+ G+ G NG IG +G +GL+                               G +G++G  G+ G+ G  G IG  G  G +G +G+IG  G+ G  GA+GL G +G              E GD+G  G  G  G PG  G +G PGP G+ G +G IG  GP+    PG +G  G  G  G  G  G  GPKGE G      ++G +GE G+ G +++G+ G  G IG  G  G +G +G +G  GL G+ G+VG
Sbjct:  968 RGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGP----------------------------KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELG------DMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVG 1386          

HSP 3 Score: 119.783 bits (299), Expect = 7.063e-27
Identity = 166/472 (35.17%), Postives = 213/472 (45.13%), Query Frame = 3
Query: 1113 GFPGENGIKG------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGN-------------------------PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSG------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV----NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIG---KSGKLGKDGLIGEPGK------------IGIQGLKGEIGQPGEKGTKGAKGLPGI------EGEPGDQGEIGAMGL---------IGLPGESGLRGT-----PGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGE---NGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFIL 2291
            G PG  G+ G      V  KGE G+ G  G+ GY+G++G  G+ G+                         PG  G+ G RG  G KG  G        G +G RG+ G+ G PG  G  G  G  G +G++G +GN G++G      P G  G PGK+   G  G     G   +  +    + G +GD G  G  G +G+ G KGE+G  G  G+ GD G   + G+ G+DG  G PG+             G  G+KGE G  G+ G KG KG P         GEPG+ G  G  G+         IGL GE G RG      PGP G +G  GP GD G +G   PG+ G  GE GL G IG KG RG  G+    G  G PG  GIKG  GD     +G  G+YG  G  GPKG++G +GP G +G  G                        LPG  GQRG F++
Sbjct:  435 GLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA--PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGD-----VGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG------------------------LPGNKGQRGDFLV 875          

HSP 4 Score: 119.013 bits (297), Expect = 1.454e-26
Identity = 166/445 (37.30%), Postives = 203/445 (45.62%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG-----KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKG-------------------------------TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP------EGDEGLHGPIGDDGPRGT---ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G+ G  G PG  G+IGE+G  G  G +GDIG RG  GE G KG++   G  G  G+ G+PG KGE GN G  G PG  G A   G KG                 G  G  G IG PG  G  G  G     +P   G+ G KG VG  GP   +G PG+  +KG                 RG +G PG  G PGE G  G+ G  G  GI+G KG  G  G  G  G  GE G +G+ G  G+IG  G +G                                +G  G  G++GE G+QG++G +G IG PG  G RG  G       +G EGL G  GD GPRG     LP  KG +G  GL G  G  G  G KG    PG PGE G  G IG +G  + G  G  G +G  G  G  G  G  GP G +G++G+ G
Sbjct:  932 QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGD---------------DGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGP---NGLPGRHGLKG----------------QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGA---PGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQG 1339          

HSP 5 Score: 103.99 bits (258), Expect = 4.682e-22
Identity = 172/480 (35.83%), Postives = 218/480 (45.42%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKG---NTGIGGNPGLLGFAXXXXXX-----XXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI---------------PGENGNIG------VKGEKGLMGISGE-----------------------KGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----SVIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G  G+PG +G +G + + G  GVQG QG PG  G KG     GI G PG +G AG  GK        KG  G  G+ G  G  G+ GE G  G  G  G+ G +G+ G  G  G++G  G+ G  G  G PG+ A        G  G  G     RG  GD G  G+               PGE+G  G       KGE+G +G+ GE                        GD G+ G  G  G  GEPG  G  G KG+ G PG+   +G  G  G  GI+G PGD G  G  GL G PG  G++G  GP+G  G  G  G+ G RG                   A  G KG KGE+G +G  G+ G +G  G +G  G+ G  G++G  G  G+     +IG+IG+ G IG  G +G  G RGP    GP GL G+ G  GY G  G  G  GE G+ G PG PG +G      +
Sbjct:  543 GDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKG-ERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGI 1021          

HSP 6 Score: 96.6709 bits (239), Expect = 9.361e-20
Identity = 134/369 (36.31%), Postives = 174/369 (47.15%), Query Frame = 3
Query: 1107 FRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG-----EIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG--LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            +RGF G+ G++G    +G+ G  G  G PG KGE+G+ G  G    LGF            +G +G KG  G QG RG  G     E G  G+ G  G +G+PG  G KG  G  G++GP G  G  G                        GPQGD G  G PG NG        GL+G  GE GD+G+ G+ G+ G  ++G  G IG  G +GE G  G KG +G  GL      PG  G +GA G  G  G++G  G    +G +GL GP G         PG+      M   GD GE G  G +GE G+ G PG +G +G+ G      +G  G  G +G TG  G +G RG +G +GL G  G
Sbjct: 1186 YRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ---LGF------------DGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPP-----------------GPQGDVGFPGAPGHNG------RHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGL------PGKNGRVGAPGPRGPTGDAGWGGI---DGMDGLVGPKGQ--------PGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG-----AVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG 1493          

HSP 7 Score: 87.8113 bits (216), Expect = 4.460e-17
Identity = 124/315 (39.37%), Postives = 154/315 (48.89%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG--EKGTKGAKG------LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEG--------LHGPIGDDGPRGTALPGI-------KGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G IG+PG+ G  G  G PG+ G  G KG+VG+ G +G  G  G +                      GP+G+ G  GI G++G  G  G +G+ G  G  G  G SG  G++G+ G PGK G QG  GE G+ G   KGTKG +G        G  G  GD+G  G  G  GL GE G  G PGP+GD G        L GP G  G  G +L G+       KG KG +GL GD   +G +GP GE G  G  G  G +GEIG  G    GK GK G  G  G KG++G  G  G  GL G  G+ G
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDI----------------------GPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGD---EGPQGPTGEQGAVGRNGLPGARGEIGGPGER--GKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERG 331          

HSP 8 Score: 81.6481 bits (200), Expect = 3.288e-15
Identity = 167/464 (35.99%), Postives = 220/464 (47.41%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGE---AGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXX-----------XXXXRQGNRGEMGEIGLPGILGKI---GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG--LAGI-------PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDG----------PRGTALPGIKGVKGEMGLIGDIGEKGDRGP-----KGENGN---------------PGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG--KVGYN 2204
            + G  G +G  G  G  GDIG  G  G  GEKGD+G  G  GE G +G +  KGE    G+ G  G PG  G +G  G  G PG+ G +G  G+ GV+G  G+ G++              G +GNRGE G+ G  G  G     G+ G  G  G+ G KG+ G  GPKG++G   ++    I                 G +G+PG  L+G+        G  G +G++G++G  G +GE+G +G++G  G  G IG PG+ G  G  GE G+ G+KG KGA G  G +G  G  GE G  G  G+PG  G  G PG   P   + L GPIG  G          P     PG +G  G  G  GD G  G RGP     +GE G+                G+PG  G+ GE    G +V+G  G+ G  G     GLEG RG RG +GL G+ G    GYN
Sbjct:   46 RMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPP--------------GAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE---PGQNVVGPKGEPGLNGQP---GLEGYRGDRGEVGLPGDKGLPGEGYN 489          

HSP 9 Score: 77.411 bits (189), Expect = 7.093e-14
Identity = 109/277 (39.35%), Postives = 140/277 (50.54%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM---------GLIGDIGEKGDRGPK---GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNT------------GPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            +G  G PG  G+PG  G  G  G  G  G  GEKGD+G+ G+ G+ G  G+ G  G  G  G +G+ GE GT G +G+ G +G PG QG  GA      PG++G+RG PG  G +G  G  G+    G    G KG +GE          G  GD G KGD G     GE G+PG+PG  G  G + +   S+IG  G  G  G++            G KG  G++G  GP G  GE G VG NG  G  GEIG  G++G PG  G+ G F  K +
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGA------PGQNGVRGPPGKPGQQGPPGEAGE---GGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGM 311          

HSP 10 Score: 63.929 bits (154), Expect = 9.847e-10
Identity = 173/529 (32.70%), Postives = 218/529 (41.21%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFA--------XXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKS--GPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--NRGPQGDPG------LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK------LGKDGLIGEPGK------IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------------QGEIGAMGLIGLPGESGLRGTPGPE--------------------------GDEGLHGPIGDD--GPRG-------TALPGIKGVKGEMGLIGDIGEKGD-------------------RGPKGENGNPGIPGEVGIKGE------IGDKG-------LSVIGKIGKYGTIGNTGPKGLEGIRGP---------RGPIGLVGEVGKVG 2198
            A  L ++G+ G  G +G  G +GDIG KG  G  G  G  G  G PG  GI G    G  G+QG  G PG  G +G  G    PG  G           ++G KG +G  GQ G  G  G  G+RG  G+ G  G+ G+ G  G PG +G  G    +  S  GP G  G PG      +K     KG +G   +  + GPQG  G        G+PG  G IG  GE+G  G  GE G  G  G        G DGL G PG+       G+ G++G  G PG       K LPG  G  GD                  +G IG  G  G PG +G RG PG                            G  GLHG  G +  GP+G         L G +G +GE+GL GD G  G+                    G  G NG  G+PGE G++G+       G +G           G  G  G IG TGP+G++G++G           GP G+ GE GKVG
Sbjct:   71 AGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGC--DGRPGMQGPSGAPGQNGVRGPPG---KPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVG 594          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: vkg (gene:FBgn0016075 transcript:FBtr0333540)

HSP 1 Score: 126.331 bits (316), Expect = 6.701e-29
Identity = 170/420 (40.48%), Postives = 203/420 (48.33%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGT--------------SGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK---------LGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G VG+KG+PG  GD G++G PG  G  G+ G  G  G  G +GV   G+  +QG  G PG  G KG  G  G PG  G AG  G KGVKG             QG  G +G+ GLPG  G+ G               +G+    G KG KG VG  G  G +G  G +   G +G  G          N G QG PG  GIPG  G IG  GE+G +G +G +GDIG  G           G DG  G PG  G+ G KGE G PG  G  GAKG+    G  GD GE G  G IG PG  G +G           GP+GD  P   AL G+ G KGE+G  G  G  G  G KG+ G+ G+PG+ G  GE G KGL   G  G+ G  G  G  G  G +GP+GP G  G VG  G N
Sbjct:  763 GPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVP--GQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKG------------EQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLG----------NAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQ---------RGPVGDSQP---ALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLG--GYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN 1144          

HSP 2 Score: 122.479 bits (306), Expect = 9.921e-28
Identity = 163/453 (35.98%), Postives = 212/453 (46.80%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV-------KGEAGVQGSQGMPGYKGEKGNTGIGGN--PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLM-------------------------------GISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEG--------------EPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG  G  G KG  G  G  G  G  G  G KG+ G  GFPG  G KGVA         GE+G+ G  G PG  G KG  G  G+  P L G AG +G+ G  G NG  G  G  G++G+RG  G+ G PG  G  G  G PG+ GI G KG  G  GP+G                             +GPQG+ G+ G+ G NG IG +G +GL+                               G +G++G  G+ G+ G  G IG  G  G +G +G+IG  G+ G  GA+GL G +G              E GD+G  G  G  G PG  G +G PGP G+ G +G IG  GP+    PG +G  G  G  G  G  G  GPKGE G      ++G +GE G+ G +++G+ G  G IG  G  G +G +G +G  GL G+ G+VG
Sbjct:  968 RGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGP----------------------------KGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELG------DMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVG 1386          

HSP 3 Score: 119.783 bits (299), Expect = 7.063e-27
Identity = 166/472 (35.17%), Postives = 213/472 (45.13%), Query Frame = 3
Query: 1113 GFPGENGIKG------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGN-------------------------PGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSG------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV----NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIG---KSGKLGKDGLIGEPGK------------IGIQGLKGEIGQPGEKGTKGAKGLPGI------EGEPGDQGEIGAMGL---------IGLPGESGLRGT-----PGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGE---NGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFIL 2291
            G PG  G+ G      V  KGE G+ G  G+ GY+G++G  G+ G+                         PG  G+ G RG  G KG  G        G +G RG+ G+ G PG  G  G  G  G +G++G +GN G++G      P G  G PGK+   G  G     G   +  +    + G +GD G  G  G +G+ G KGE+G  G  G+ GD G   + G+ G+DG  G PG+             G  G+KGE G  G+ G KG KG P         GEPG+ G  G  G+         IGL GE G RG      PGP G +G  GP GD G +G   PG+ G  GE GL G IG KG RG  G+    G  G PG  GIKG  GD     +G  G+YG  G  GPKG++G +GP G +G  G                        LPG  GQRG F++
Sbjct:  435 GLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGA--PGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGD-----VGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTG------------------------LPGNKGQRGDFLV 875          

HSP 4 Score: 119.013 bits (297), Expect = 1.454e-26
Identity = 166/445 (37.30%), Postives = 203/445 (45.62%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG-----KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKG-------------------------------TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP------EGDEGLHGPIGDDGPRGT---ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G+ G  G PG  G+IGE+G  G  G +GDIG RG  GE G KG++   G  G  G+ G+PG KGE GN G  G PG  G A   G KG                 G  G  G IG PG  G  G  G     +P   G+ G KG VG  GP   +G PG+  +KG                 RG +G PG  G PGE G  G+ G  G  GI+G KG  G  G  G  G  GE G +G+ G  G+IG  G +G                                +G  G  G++GE G+QG++G +G IG PG  G RG  G       +G EGL G  GD GPRG     LP  KG +G  GL G  G  G  G KG    PG PGE G  G IG +G  + G  G  G +G  G  G  G  G  GP G +G++G+ G
Sbjct:  932 QGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGD---------------DGESGLTGPIGYPGAPGAKGQRGPVGDSQPALDGVAGRKGEVGSPGP---NGLPGRHGLKG----------------QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGA---PGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQG 1339          

HSP 5 Score: 103.99 bits (258), Expect = 4.682e-22
Identity = 172/480 (35.83%), Postives = 218/480 (45.42%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKG---NTGIGGNPGLLGFAXXXXXX-----XXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI---------------PGENGNIG------VKGEKGLMGISGE-----------------------KGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----SVIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G  G+PG +G +G + + G  GVQG QG PG  G KG     GI G PG +G AG  GK        KG  G  G+ G  G  G+ GE G  G  G  G+ G +G+ G  G  G++G  G+ G  G  G PG+ A        G  G  G     RG  GD G  G+               PGE+G  G       KGE+G +G+ GE                        GD G+ G  G  G  GEPG  G  G KG+ G PG+   +G  G  G  GI+G PGD G  G  GL G PG  G++G  GP+G  G  G  G+ G RG                   A  G KG KGE+G +G  G+ G +G  G +G  G+ G  G++G  G  G+     +IG+IG+ G IG  G +G  G RGP    GP GL G+ G  GY G  G  G  GE G+ G PG PG +G      +
Sbjct:  543 GDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKG-ERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGI 1021          

HSP 6 Score: 96.6709 bits (239), Expect = 9.361e-20
Identity = 134/369 (36.31%), Postives = 174/369 (47.15%), Query Frame = 3
Query: 1107 FRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG-----EIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG--LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            +RGF G+ G++G    +G+ G  G  G PG KGE+G+ G  G    LGF            +G +G KG  G QG RG  G     E G  G+ G  G +G+PG  G KG  G  G++GP G  G  G                        GPQGD G  G PG NG        GL+G  GE GD+G+ G+ G+ G  ++G  G IG  G +GE G  G KG +G  GL      PG  G +GA G  G  G++G  G    +G +GL GP G         PG+      M   GD GE G  G +GE G+ G PG +G +G+ G      +G  G  G +G TG  G +G RG +G +GL G  G
Sbjct: 1186 YRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQ---LGF------------DGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPP-----------------GPQGDVGFPGAPGHNG------RHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGL------PGKNGRVGAPGPRGPTGDAGWGGI---DGMDGLVGPKGQ--------PGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG-----AVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG 1493          

HSP 7 Score: 87.8113 bits (216), Expect = 4.460e-17
Identity = 124/315 (39.37%), Postives = 154/315 (48.89%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG--EKGTKGAKG------LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEG--------LHGPIGDDGPRGTALPGI-------KGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G IG+PG+ G  G  G PG+ G  G KG+VG+ G +G  G  G +                      GP+G+ G  GI G++G  G  G +G+ G  G  G  G SG  G++G+ G PGK G QG  GE G+ G   KGTKG +G        G  G  GD+G  G  G  GL GE G  G PGP+GD G        L GP G  G  G +L G+       KG KG +GL GD   +G +GP GE G  G  G  G +GEIG  G    GK GK G  G  G KG++G  G  G  GL G  G+ G
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDI----------------------GPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGD---EGPQGPTGEQGAVGRNGLPGARGEIGGPGER--GKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERG 331          

HSP 8 Score: 81.6481 bits (200), Expect = 3.288e-15
Identity = 167/464 (35.99%), Postives = 220/464 (47.41%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGE---AGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXX-----------XXXXRQGNRGEMGEIGLPGILGKI---GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG--LAGI-------PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDG----------PRGTALPGIKGVKGEMGLIGDIGEKGDRGP-----KGENGN---------------PGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG--KVGYN 2204
            + G  G +G  G  G  GDIG  G  G  GEKGD+G  G  GE G +G +  KGE    G+ G  G PG  G +G  G  G PG+ G +G  G+ GV+G  G+ G++              G +GNRGE G+ G  G  G     G+ G  G  G+ G KG+ G  GPKG++G   ++    I                 G +G+PG  L+G+        G  G +G++G++G  G +GE+G +G++G  G  G IG PG+ G  G  GE G+ G+KG KGA G  G +G  G  GE G  G  G+PG  G  G PG   P   + L GPIG  G          P     PG +G  G  G  GD G  G RGP     +GE G+                G+PG  G+ GE    G +V+G  G+ G  G     GLEG RG RG +GL G+ G    GYN
Sbjct:   46 RMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPP--------------GAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGE---PGQNVVGPKGEPGLNGQP---GLEGYRGDRGEVGLPGDKGLPGEGYN 489          

HSP 9 Score: 77.411 bits (189), Expect = 7.093e-14
Identity = 109/277 (39.35%), Postives = 140/277 (50.54%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM---------GLIGDIGEKGDRGPK---GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNT------------GPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            +G  G PG  G+PG  G  G  G  G  G  GEKGD+G+ G+ G+ G  G+ G  G  G  G +G+ GE GT G +G+ G +G PG QG  GA      PG++G+RG PG  G +G  G  G+    G    G KG +GE          G  GD G KGD G     GE G+PG+PG  G  G + +   S+IG  G  G  G++            G KG  G++G  GP G  GE G VG NG  G  GEIG  G++G PG  G+ G F  K +
Sbjct:   44 KGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGA------PGQNGVRGPPGKPGQQGPPGEAGE---GGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGM 311          

HSP 10 Score: 63.929 bits (154), Expect = 9.847e-10
Identity = 173/529 (32.70%), Postives = 218/529 (41.21%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFA--------XXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKS--GPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--NRGPQGDPG------LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK------LGKDGLIGEPGK------IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------------QGEIGAMGLIGLPGESGLRGTPGPE--------------------------GDEGLHGPIGDD--GPRG-------TALPGIKGVKGEMGLIGDIGEKGD-------------------RGPKGENGNPGIPGEVGIKGE------IGDKG-------LSVIGKIGKYGTIGNTGPKGLEGIRGP---------RGPIGLVGEVGKVG 2198
            A  L ++G+ G  G +G  G +GDIG KG  G  G  G  G  G PG  GI G    G  G+QG  G PG  G +G  G    PG  G           ++G KG +G  GQ G  G  G  G+RG  G+ G  G+ G+ G  G PG +G  G    +  S  GP G  G PG      +K     KG +G   +  + GPQG  G        G+PG  G IG  GE+G  G  GE G  G  G        G DGL G PG+       G+ G++G  G PG       K LPG  G  GD                  +G IG  G  G PG +G RG PG                            G  GLHG  G +  GP+G         L G +G +GE+GL GD G  G+                    G  G NG  G+PGE G++G+       G +G           G  G  G IG TGP+G++G++G           GP G+ GE GKVG
Sbjct:   71 AGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGC--DGRPGMQGPSGAPGQNGVRGPPG---KPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVG 594          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 122.865 bits (307), Expect = 9.262e-28
Identity = 171/438 (39.04%), Postives = 203/438 (46.35%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXD---IGFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG--LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSG----KLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPG------------DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIK--GVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  GT G KG  G KGD+G K    + G KGD    G  G PG++G +G          +G  G+ G  G PG KGE G TG+ G  G  G         ++   G KG  G  G +G +G  G  GLPGI         PG +G  GFKG  G SG  GN GTPG+                       G  G PG  + G PG +G  G KG+KG  G SGEKG+ G       K+   G  GEPG+ G+ G  GE G PGE+G  G KG  G +G PG            ++G  GA+G+ G PG+ GLRG PG  G           GPRG   PGI   G  G  GL G  GEKGDRGP G  G PG  G VG  G+ GD GL  +          G +G  G  G  GP G+ GI G RG  G  GE G  G
Sbjct:  549 GRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGI---------PGPKGEFGFKGEKGLSGAPGNDGTPGRAG-------------------RDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQP---------GPRGE--PGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPG 947          

HSP 2 Score: 116.316 bits (290), Expect = 7.632e-26
Identity = 178/441 (40.36%), Postives = 226/441 (51.25%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKG--DIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGT------SGKPGKQGIKGFKG-------------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS--GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG---------EKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGL---------IGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG+ G  G+ G PG KG   +   G  G  GEKGD G  G  G +GI G   KGE G+QG  G PG KG  G  GI G PG+          G+ G  G  G  G  G +G++GE G  GLPG+ G+ G       +G PG +G +G +G             + G  G +G +G  G+   +G+ G  G  G +G   + +GP G  GL GIPG  G+IG +GE G  G++  GEKG  G+ G+ G+ GLIG PG IG +GL G  G+PG           G+KG +GL G  G+PG  G  GA GL G  G  G +G  G  G EG  G  GD G +G + LPG+ G KG+ G          +G  GE+G  GPKG +G  G PG  G KGE G   L   G  G+ G  G  GPKG  G  G RG IG+ GE G+ G
Sbjct: 1075 RGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE--KGEQGLQGVWGQPGEKGSVGAPGIPGAPGM---------DGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGL-QGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGM--LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKG 1501          

HSP 3 Score: 113.62 bits (283), Expect = 5.250e-25
Identity = 196/506 (38.74%), Postives = 239/506 (47.23%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPG---AKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGE------------IGLPGILGKIGTSGKPGKQGIKGF---KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKG---EKGLMGIS--------GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEG---------------EPGDQGEIGAMGLIGLP---------GESGLRGTPGPEGDEGLHG----PI------GDDGPRG-TALPGIKGVKGEMGLIGD---IGEKGDRGPKGE------NGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGL---EGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            RG+ G  G  G PG    KGD+G  G           G  G PG  GI GV      KGE G  G  GMPG KG++G  G   N G  GFAG  G  G +G  G  G  G  G +G  G  G              GL GI G  G +G PG+QG+ G    KGN G  G  G  G PG  +                    +G +G+PG +G+ G+ G  G  G   EKGL G++        GEKGD G+SG  G+DG+ GE G+   QGL+G  GQPGEKG+ GA G+PG  G                PGD+G+ G  GL GLP         G  G  G PGP+G+ G+ G    P       GD G +G     G KG +GE GL G     G KGDRG +G       NG PG  G++G +GEIG  G+++ G+ G  G  G  G +GL    G+ G RG  GL GE G VG  G  G  G  GE+G  G PG PGQ G
Sbjct:  892 RGDAGLPGVSGRPGIVGEKGDVGPIG---------PAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG---NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDAS-------------------EKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGE---QGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDG 1363          

HSP 4 Score: 110.153 bits (274), Expect = 6.999e-24
Identity = 165/426 (38.73%), Postives = 200/426 (46.95%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG---------ESGLRGTPGP---EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLI---------------------------------GDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL-SVIGKIGKYGTIGNTGPKGLE 2141
            GEKG+VG+ G PGA G  G  G  G  G  G  G RG  GE G+ G+  +KGE G  G QG  G  G KG  GI G PGL   A     +G KG+ G++G  GE G QG RG  G  G+ G  G  G  G PG  G+ G  G  G  GP+G  G PG                    N  +G  G PGL G   E G  G+ GE GL+G+ G  G  G  G+ G  G  G+PG+ G  G  G  G  G +G KG +GL G EG+ GD+G+ G  G  GLPG           GL G  GP    G+ G  GP G DG  GT  PG+ G KGE G++                                 G+ GEKG+RG  GE GN G PG  G +GE G++G    IG IG+ G  G   P  L+
Sbjct: 1138 GEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP--ATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGR-----NGRQGLIGAPGLIG---ERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGT--PGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALD 1551          

HSP 5 Score: 108.227 bits (269), Expect = 2.631e-23
Identity = 158/429 (36.83%), Postives = 193/429 (44.99%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVAVKGEAGVQG---SQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPG--ILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGE------------KGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------------QGEIGAMGLIGLPGESGLRGTPGP------EGDEGLHGPIGDDGPRGTA----LPGIKG--VKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV----------GIKGEIGDKGL-------SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  G PG  G  G   KG AG+ G   ++G PG KGEKG  G+ G  G +G  G+ G  G +G                  + G+ GLPG  I G  G +G PG  G+KG KG  G    KGN+G PG   +        +           G +GD G  G PG+ G++G+KG+            KG  G SG  G  GK G  G  G  G PG+ G  G+ G+ G PGEKG  G  GLPG  GEPG                    G  GA G+ G  G  GL G PGP      +G++GL G  G+DG  G A     PGI G  +KGE G  G  G KGD+G  G +G  G PG            G KGE G  G+          G+ G  G  GNTGP+G  G+ GPRG  G  GE G  G
Sbjct:  422 GVDGLPGPQGYNGQ--KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEG------------------QKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGF---KGNAGAPGDSKLGRPGTPGAAGAP--------GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQG 819          

HSP 6 Score: 102.449 bits (254), Expect = 1.640e-21
Identity = 171/473 (36.15%), Postives = 217/473 (45.88%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK---------PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV------------------KGEKGLMGISGEKGDIGKSGKLGKDG------------LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR------GTPGPEGDEGL--------HGPIGDDGPRGTA----LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPG------------EVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            K+  +G KG  G  G PG  G+ G  G  G  G KG+ G +G PG  G +G+   +GE G QG+ G+PG  G+ G  GI G  G  G           G  G  G  G  G +G+RG  G IG PG  G +G  G           G+ GI G KG+VG  GP G +G PG   I G++G           +  +G  G PGL G+PG  G+ G                   +G  G+ G+SG KGD G +G  G DG            L+G  G  G+ G  G+ G  G  G KG +G PG++G PG  G+    G  G PG SGLR      GTPG  G++GL         GP G+ G +G +      GI G KGE GL G  G+ G++G  G  G PG PG             VG  G+ GDKG   +   G  G  G TGP GL+G  G  GP G  G  G+ G
Sbjct:  757 KMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPG-PRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR----------DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGL--SGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPG 1216          

HSP 7 Score: 102.064 bits (253), Expect = 1.770e-21
Identity = 120/304 (39.47%), Postives = 146/304 (48.03%), Query Frame = 3
Query: 1332 RGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDD--GPRGTALPGIKGVKGE-------------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +GEMG  G+ G  G  G  G PG  G +G KG  G  G  G +G PG                       +GP G+PG  GI G++G  G  G  GL G+SG  G  G +G+LG  G  GEP K      KGE G+PG +GT    GL G +G PG++GE          G+SG  G  GP G+ GL G  G    GP     PGIKG KGE             MG  GD+G+KG+ G  G  G PG  G+ G+ G+ G+KGL   G  G  G  GN GP G  G +G RG  GL G  G  G
Sbjct:  103 KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGV----------------------QGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGT---AGLAGPQGFPGEKGER---------GDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLP--GGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPG 370          

HSP 8 Score: 95.9005 bits (237), Expect = 1.407e-19
Identity = 178/543 (32.78%), Postives = 222/543 (40.88%), Query Frame = 3
Query:  984 AEKLLKRGEKG---------TVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIG----GNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGI------KGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGN----------------------------------------IGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGA------------------KGLPG--IEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE-----GLHGPIGDDGPRGTA-LPGIKGVKGEMGLIGDIGEK------GDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKV---------------GYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILK 2294
            A +L  +GEKG           G KG PG +G  G              G +GFPGE G +G +  G  G +G +G  G KGEKG +  G    G PG+ G  G                       G RG+MG+ G PG++G+ G  G  G  G+      KG  G  G  G +GN G PG                       +G +G+PGL G+PG  G                                         +G  G +GL G+ G  G  G +G+ G  GL G PG  G  G KGE G  G  G KG+                   GLPG  I+G  GD G  G  GL G  GE G +G  G  GD      G  G  G  G +G A  PG  G KG+MG+ GD+G K      G +G KG +G PGIPG+ G +G  G++G    G+ G  G  G TGP G +G  G  G  G  GE GK                GY G  G  G  G KG +GLPG+PG +G F  K
Sbjct:  190 AGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGL------------AGPQGFPGEKGERGDS--GPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTV--------MGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTG-------------------QKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYP--GERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFK 689          

HSP 9 Score: 92.0485 bits (227), Expect = 2.138e-18
Identity = 189/547 (34.55%), Postives = 232/547 (42.41%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSG-------------TPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGD------PGLAGI---PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEK----------------------------------------GTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE---GLHGPIGD--------------------------DGPRGTA----LPGIKGVKGEMGLIGDIGEKGDR--------------GPKGENGNPGIPGE---VGIKGEIGDKGLSV-IGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLA 2303
            G+KG  G  G  G +G               D G RG PG +G  GV  V+G AG  G+ G+ G  G  G  GI G  GL G  G RG  G  G+ G+KGE  +      +GE GE G  G  G  G  G PG++G +G  G  G  GP+G  G              PG   IKG KG   S      ++   GP+GD      PGL G    PG  G+ G+ G+KG  G+ G  GD G+ G  G  G  G+ G  G  GL G  G PG+K                                        G  G +GL G++G PG QG  G  G  GLPG  G  G PG +G++   GL+GP G                            G +G A     PG+KG KGE G  G+ G  GD               G KG+ G PG PG+   +GIKG++G K  S   G  G  GT G  G  G +G RGP G  G  GE G  G NG  G  GE GE G  GLPG  G+ G   L +L+
Sbjct:  116 GDKGQKGDPGPYGQRG---------------DKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS 647          

HSP 10 Score: 80.8777 bits (198), Expect = 6.347e-15
Identity = 138/360 (38.33%), Postives = 168/360 (46.67%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXX------XXXDIGFRGFPGENGIKGVAVKGEAGV---------QGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPG---KQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL------KGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGP 2006
            ++GE+G  G  G  GAKGD G +G PG  G       KGDIG RG   E G  GV +KGE G+         QG  G PG  GE+G  G+ G PGL+G  G  G                    G++GE G  G PG  G+ G  G PG     G +GFKG  G +G +G  G  G   +                   +GP G PGL G  G+ G  G+ G  G +G  GE+G  G  G+ G+DG  G PG+ G  G+      KGE GQPG  G KG  G PG  G  G QGE G  G  GL GE+G  G PGP+GD G               PG +G +G +GLIG  GE G   P
Sbjct: 1242 EQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRG---EIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPA------------------GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL-------------------QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRG--------------EPGERGYEGAIGLIGQKGEPGAPAP 1547          

HSP 11 Score: 67.0106 bits (162), Expect = 8.944e-11
Identity = 75/175 (42.86%), Postives = 94/175 (53.71%), Query Frame = 3
Query: 1695 PGKIGIQGLKGEIGQP---GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRG-PKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            PG +G  GLKGE+G P   G  G KG KG PG  G+ GD+GE G+ GL G  G  G++G  G  G  G++G  G DG  G   L G+ G+ G  G  G +G KG++G P  ENG+       G KGE G +G + + G  G  G  G  G  G  G +GPRG  GL GE G   Y
Sbjct:   94 PGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDY----AKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCY 264          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 122.865 bits (307), Expect = 9.262e-28
Identity = 171/438 (39.04%), Postives = 203/438 (46.35%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXD---IGFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG--LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSG----KLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPG------------DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIK--GVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  GT G KG  G KGD+G K    + G KGD    G  G PG++G +G          +G  G+ G  G PG KGE G TG+ G  G  G         ++   G KG  G  G +G +G  G  GLPGI         PG +G  GFKG  G SG  GN GTPG+                       G  G PG  + G PG +G  G KG+KG  G SGEKG+ G       K+   G  GEPG+ G+ G  GE G PGE+G  G KG  G +G PG            ++G  GA+G+ G PG+ GLRG PG  G           GPRG   PGI   G  G  GL G  GEKGDRGP G  G PG  G VG  G+ GD GL  +          G +G  G  G  GP G+ GI G RG  G  GE G  G
Sbjct:  549 GRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGI---------PGPKGEFGFKGEKGLSGAPGNDGTPGRAG-------------------RDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQP---------GPRGE--PGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPG 947          

HSP 2 Score: 116.316 bits (290), Expect = 7.632e-26
Identity = 178/441 (40.36%), Postives = 226/441 (51.25%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKG--DIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGT------SGKPGKQGIKGFKG-------------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS--GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG---------EKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGL---------IGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG+ G  G+ G PG KG   +   G  G  GEKGD G  G  G +GI G   KGE G+QG  G PG KG  G  GI G PG+          G+ G  G  G  G  G +G++GE G  GLPG+ G+ G       +G PG +G +G +G             + G  G +G +G  G+   +G+ G  G  G +G   + +GP G  GL GIPG  G+IG +GE G  G++  GEKG  G+ G+ G+ GLIG PG IG +GL G  G+PG           G+KG +GL G  G+PG  G  GA GL G  G  G +G  G  G EG  G  GD G +G + LPG+ G KG+ G          +G  GE+G  GPKG +G  G PG  G KGE G   L   G  G+ G  G  GPKG  G  G RG IG+ GE G+ G
Sbjct: 1075 RGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGE--KGEQGLQGVWGQPGEKGSVGAPGIPGAPGM---------DGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGL-QGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGM--LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKG 1501          

HSP 3 Score: 113.62 bits (283), Expect = 5.250e-25
Identity = 196/506 (38.74%), Postives = 239/506 (47.23%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPG---AKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGE------------IGLPGILGKIGTSGKPGKQGIKGF---KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKG---EKGLMGIS--------GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEG---------------EPGDQGEIGAMGLIGLP---------GESGLRGTPGPEGDEGLHG----PI------GDDGPRG-TALPGIKGVKGEMGLIGD---IGEKGDRGPKGE------NGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGL---EGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            RG+ G  G  G PG    KGD+G  G           G  G PG  GI GV      KGE G  G  GMPG KG++G  G   N G  GFAG  G  G +G  G  G  G  G +G  G  G              GL GI G  G +G PG+QG+ G    KGN G  G  G  G PG  +                    +G +G+PG +G+ G+ G  G  G   EKGL G++        GEKGD G+SG  G+DG+ GE G+   QGL+G  GQPGEKG+ GA G+PG  G                PGD+G+ G  GL GLP         G  G  G PGP+G+ G+ G    P       GD G +G     G KG +GE GL G     G KGDRG +G       NG PG  G++G +GEIG  G+++ G+ G  G  G  G +GL    G+ G RG  GL GE G VG  G  G  G  GE+G  G PG PGQ G
Sbjct:  892 RGDAGLPGVSGRPGIVGEKGDVGPIG---------PAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPG---NDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDAS-------------------EKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGE---QGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDG 1363          

HSP 4 Score: 110.153 bits (274), Expect = 6.999e-24
Identity = 165/426 (38.73%), Postives = 200/426 (46.95%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG---------ESGLRGTPGP---EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLI---------------------------------GDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL-SVIGKIGKYGTIGNTGPKGLE 2141
            GEKG+VG+ G PGA G  G  G  G  G  G  G RG  GE G+ G+  +KGE G  G QG  G  G KG  GI G PGL   A     +G KG+ G++G  GE G QG RG  G  G+ G  G  G  G PG  G+ G  G  G  GP+G  G PG                    N  +G  G PGL G   E G  G+ GE GL+G+ G  G  G  G+ G  G  G+PG+ G  G  G  G  G +G KG +GL G EG+ GD+G+ G  G  GLPG           GL G  GP    G+ G  GP G DG  GT  PG+ G KGE G++                                 G+ GEKG+RG  GE GN G PG  G +GE G++G    IG IG+ G  G   P  L+
Sbjct: 1138 GEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLP--ATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGR-----NGRQGLIGAPGLIG---ERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGT--PGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPAALD 1551          

HSP 5 Score: 108.227 bits (269), Expect = 2.631e-23
Identity = 158/429 (36.83%), Postives = 193/429 (44.99%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVAVKGEAGVQG---SQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPG--ILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGE------------KGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------------QGEIGAMGLIGLPGESGLRGTPGP------EGDEGLHGPIGDDGPRGTA----LPGIKG--VKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV----------GIKGEIGDKGL-------SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  G PG  G  G   KG AG+ G   ++G PG KGEKG  G+ G  G +G  G+ G  G +G                  + G+ GLPG  I G  G +G PG  G+KG KG  G    KGN+G PG   +        +           G +GD G  G PG+ G++G+KG+            KG  G SG  G  GK G  G  G  G PG+ G  G+ G+ G PGEKG  G  GLPG  GEPG                    G  GA G+ G  G  GL G PGP      +G++GL G  G+DG  G A     PGI G  +KGE G  G  G KGD+G  G +G  G PG            G KGE G  G+          G+ G  G  GNTGP+G  G+ GPRG  G  GE G  G
Sbjct:  422 GVDGLPGPQGYNGQ--KGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEG------------------QKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGF---KGNAGAPGDSKLGRPGTPGAAGAP--------GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQG 819          

HSP 6 Score: 102.449 bits (254), Expect = 1.640e-21
Identity = 171/473 (36.15%), Postives = 217/473 (45.88%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK---------PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV------------------KGEKGLMGISGEKGDIGKSGKLGKDG------------LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR------GTPGPEGDEGL--------HGPIGDDGPRGTA----LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPG------------EVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            K+  +G KG  G  G PG  G+ G  G  G  G KG+ G +G PG  G +G+   +GE G QG+ G+PG  G+ G  GI G  G  G           G  G  G  G  G +G+RG  G IG PG  G +G  G           G+ GI G KG+VG  GP G +G PG   I G++G           +  +G  G PGL G+PG  G+ G                   +G  G+ G+SG KGD G +G  G DG            L+G  G  G+ G  G+ G  G  G KG +G PG++G PG  G+    G  G PG SGLR      GTPG  G++GL         GP G+ G +G +      GI G KGE GL G  G+ G++G  G  G PG PG             VG  G+ GDKG   +   G  G  G TGP GL+G  G  GP G  G  G+ G
Sbjct:  757 KMPAKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPG-PRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR----------DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGL--SGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPG 1216          

HSP 7 Score: 102.064 bits (253), Expect = 1.770e-21
Identity = 120/304 (39.47%), Postives = 146/304 (48.03%), Query Frame = 3
Query: 1332 RGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDD--GPRGTALPGIKGVKGE-------------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +GEMG  G+ G  G  G  G PG  G +G KG  G  G  G +G PG                       +GP G+PG  GI G++G  G  G  GL G+SG  G  G +G+LG  G  GEP K      KGE G+PG +GT    GL G +G PG++GE          G+SG  G  GP G+ GL G  G    GP     PGIKG KGE             MG  GD+G+KG+ G  G  G PG  G+ G+ G+ G+KGL   G  G  G  GN GP G  G +G RG  GL G  G  G
Sbjct:  103 KGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGV----------------------QGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGT---AGLAGPQGFPGEKGER---------GDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLP--GGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPG 370          

HSP 8 Score: 95.9005 bits (237), Expect = 1.407e-19
Identity = 178/543 (32.78%), Postives = 222/543 (40.88%), Query Frame = 3
Query:  984 AEKLLKRGEKG---------TVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIG----GNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGI------KGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGN----------------------------------------IGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGA------------------KGLPG--IEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE-----GLHGPIGDDGPRGTA-LPGIKGVKGEMGLIGDIGEK------GDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKV---------------GYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILK 2294
            A +L  +GEKG           G KG PG +G  G              G +GFPGE G +G +  G  G +G +G  G KGEKG +  G    G PG+ G  G                       G RG+MG+ G PG++G+ G  G  G  G+      KG  G  G  G +GN G PG                       +G +G+PGL G+PG  G                                         +G  G +GL G+ G  G  G +G+ G  GL G PG  G  G KGE G  G  G KG+                   GLPG  I+G  GD G  G  GL G  GE G +G  G  GD      G  G  G  G +G A  PG  G KG+MG+ GD+G K      G +G KG +G PGIPG+ G +G  G++G    G+ G  G  G TGP G +G  G  G  G  GE GK                GY G  G  G  G KG +GLPG+PG +G F  K
Sbjct:  190 AGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGL------------AGPQGFPGEKGERGDS--GPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTV--------MGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTG-------------------QKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYP--GERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFK 689          

HSP 9 Score: 92.0485 bits (227), Expect = 2.138e-18
Identity = 189/547 (34.55%), Postives = 232/547 (42.41%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSG-------------TPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGD------PGLAGI---PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEK----------------------------------------GTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE---GLHGPIGD--------------------------DGPRGTA----LPGIKGVKGEMGLIGDIGEKGDR--------------GPKGENGNPGIPGE---VGIKGEIGDKGLSV-IGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLA 2303
            G+KG  G  G  G +G               D G RG PG +G  GV  V+G AG  G+ G+ G  G  G  GI G  GL G  G RG  G  G+ G+KGE  +      +GE GE G  G  G  G  G PG++G +G  G  G  GP+G  G              PG   IKG KG   S      ++   GP+GD      PGL G    PG  G+ G+ G+KG  G+ G  GD G+ G  G  G  G+ G  G  GL G  G PG+K                                        G  G +GL G++G PG QG  G  G  GLPG  G  G PG +G++   GL+GP G                            G +G A     PG+KG KGE G  G+ G  GD               G KG+ G PG PG+   +GIKG++G K  S   G  G  GT G  G  G +G RGP G  G  GE G  G NG  G  GE GE G  GLPG  G+ G   L +L+
Sbjct:  116 GDKGQKGDPGPYGQRG---------------DKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLS 647          

HSP 10 Score: 80.8777 bits (198), Expect = 6.347e-15
Identity = 138/360 (38.33%), Postives = 168/360 (46.67%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXX------XXXDIGFRGFPGENGIKGVAVKGEAGV---------QGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPG---KQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL------KGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGP 2006
            ++GE+G  G  G  GAKGD G +G PG  G       KGDIG RG   E G  GV +KGE G+         QG  G PG  GE+G  G+ G PGL+G  G  G                    G++GE G  G PG  G+ G  G PG     G +GFKG  G +G +G  G  G   +                   +GP G PGL G  G+ G  G+ G  G +G  GE+G  G  G+ G+DG  G PG+ G  G+      KGE GQPG  G KG  G PG  G  G QGE G  G  GL GE+G  G PGP+GD G               PG +G +G +GLIG  GE G   P
Sbjct: 1242 EQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRG---EIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPA------------------GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL-------------------QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRG--------------EPGERGYEGAIGLIGQKGEPGAPAP 1547          

HSP 11 Score: 67.0106 bits (162), Expect = 8.944e-11
Identity = 75/175 (42.86%), Postives = 94/175 (53.71%), Query Frame = 3
Query: 1695 PGKIGIQGLKGEIGQP---GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRG-PKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            PG +G  GLKGE+G P   G  G KG KG PG  G+ GD+GE G+ GL G  G  G++G  G  G  G++G  G DG  G   L G+ G+ G  G  G +G KG++G P  ENG+       G KGE G +G + + G  G  G  G  G  G  G +GPRG  GL GE G   Y
Sbjct:   94 PGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDY----AKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCY 264          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col6a3 (collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070501-8])

HSP 1 Score: 150.214 bits (378), Expect = 5.246e-36
Identity = 136/352 (38.64%), Postives = 164/352 (46.59%), Query Frame = 3
Query: 1164 GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG---------KPGKQGIKGFKGNVGKSGP---KGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK------GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKG---TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRG 2153
            G QG QG PG +G KG+ G                                   G +GE+GEIGL GI G+ GTSG          PG++G KG KG  G +G    +G+ GTPG+                   N  RGP+GDPG AG  GE G  G KG  G  G  G        G  G +G+ G DGL GEPG  G +G  G IG PG +G     G +G  G  G  G++G  GA+G  G PGE G +G  GP G     G  G+DG  G   PG KG KG+ G        G  GPKGE G+PG  G  G +G  G +G S V G  G+ G IG  GP GL+G RG
Sbjct: 2629 GTQGFQGCPGQRGVKGSRGY---------------------------------NGEKGEIGEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPGR------------------DNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPR---GEPGEDGRDGFGFPGPKGRKGDEGF------PGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKGDIGYPGPYGLKGPRG 2920          

HSP 2 Score: 115.546 bits (288), Expect = 2.388e-25
Identity = 112/340 (32.94%), Postives = 145/340 (42.65%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGI---------------------LGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP------GESGLRGTPGPEGDEGLHGPIGDDGPRG 1925
            +RG KG+   +G+ G KG+I            G+IG  G  GE G  G+A     +G  G +G +G  G  G+ G  GI G+PG  G                  +  + G +G+ G+ G  G PG+                      G+ G +G+PG  G+ G  G  G  GP G  G PG                       RG  G+PG  G  G+ G  G KG +G +G  GE G+ G  G  G  G  GEPG+ G  G     G PG KG KG +G PG  G  G+ G+ G  G  G        G SG+RG PG +GD G  GP G  GPRG
Sbjct: 2639 QRGVKGS---RGYNGEKGEI------------GEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPG-----------------RDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGV----------------------RGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEPGEDGRDGF----GFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKGDIGYPGPYGLKGPRG 2920          

HSP 3 Score: 115.161 bits (287), Expect = 3.466e-25
Identity = 118/355 (33.24%), Postives = 144/355 (40.56%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGK---PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG---VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG----EKGTKGAKGLPGIEGEPGDQGEI------------------GAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-------------------------------ALPGIKGVKGEMGLIGDIGEKGDRG-----PKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G RG+ G +G+PG  G+ G  G    PG +G  G +G  G +G +G  G PG+                      RG +G  G  G  GE G IG   + GE+G  GI+G  GD G  G+ G  G  G+ G  G  G++G+ G PG    ++G KG  G  G  GEPG  G                    G  G  G PG  GL G PG  G  G  GPIG  G RG                                  PG KGV G  G  G+ GE G  G     PKG  G+ G PG  G KGE GD G +           GN G +G  G+RG  G  G +G  G  G
Sbjct: 2587 GPRGDRGAVGVPGQKGQSGGQGSSGHPGDEGGPGERGPPGVNGTQGFQGCPGQ----------------------RGVKGSRGYNGEKGEIGEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPGRDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEPGEDGRDGFGFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPG-----PRGNNGQRGTSGVRGGPGQKGDIGYPGPYG 2914          

HSP 4 Score: 112.849 bits (281), Expect = 1.605e-24
Identity = 107/287 (37.28%), Postives = 134/287 (46.69%), Query Frame = 3
Query: 1533 NVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIE-------GEPGDQGEIGAMGLIG------------------LPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP-GIKGVKGE------------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            N  +G QG PG  G+ G  G  G KGE G +G+ G  G+ G SG  G  G  G PG+ G +G KG+ G  G+ G +G  G PG +       G+PGD G  G  G+ G                   PG++G  G PG    +GL G  G  G RG A P G  GV+GE             G  G+ G +G  G KGE G PG  G  G  G  G+      G+ G+ G  G  GPKG +G  G  G  G  GE G  G NG  G  G  G++G  G+ G PGQ+G
Sbjct: 2628 NGTQGFQGCPGQRGVKGSRGYNGEKGEIGEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPGRDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPG---SDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEP-----GEDGRDG-FGFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKG 2905          

HSP 5 Score: 108.612 bits (270), Expect = 2.978e-23
Identity = 101/315 (32.06%), Postives = 132/315 (41.90%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV----KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGI---------------------LGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGA------KGLPGIEGEPGDQGEIGAMGLIGLPGESGL 1856
            G++G  GS+G+ G KG+IG            +IG  G  GE G  G+A     +G  G +G +G  G  G+ G  GI G+PG  G                  +  + G +G+ G+ G  G PG+                      G+ G +G+PG  G+ G  G  G  GP G  G PG +  +         G Q      +G +G  G  G PGE G  GV G  G  G  GE G  G  G  G  G  G+ G  G  G KGE G PG  G  G       +G  G+ G PG +G+IG  G  GL G  GL
Sbjct: 2638 GQRGVKGSRGYNGEKGEIG------------EIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPG-----------------RDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPG-VRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEPGEDGRDG-FGFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKGDIGYPGPYGLKGPRGL 2921          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 145.206 bits (365), Expect = 1.336e-34
Identity = 187/650 (28.77%), Postives = 264/650 (40.62%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGT--PGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGE---SGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGV---PGQRGT--FILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVS-RMK--------TVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCV-RSSYEAGDLLTYLKPYDSETTW-------QSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLS--TNKPDMLPIVDYRIKYFNDNGKCM-LGANIYPACF 3182
            G  G +G  G  GI+G  G +G  GK G +G +G+VG +GP G +G   P  +A +     +            +G  G  G  G+PG  G+ G+ G  G +G  G  G  G  G  G  G IG PG  G QG  G  G PG  G  G  G  GI+G+ G+ G  G  G +G PG    SG  G PG  G+ G  GP G  GP G    PG  G +GE G+ G   EKGDRG KG  G+PG+ G  G  G  GD                 +GP G+ G  GPRGP G  G  GK G N               G+PG    PG RG    +                 +    +T    + + + D  S R K          L +      +   S   P  +C+D++L          W+DPN+G + D+ K  C   ++      I P    + R ++       Y    + + TW        +E   +   L P ++       +QL F+++ +  A Q + + C+ SI Y D  +   +L+ A   Q  +D                     + L   G S F  ++L D C     G ++K ++   TNKP  LPI+D  I   +  G     G +I P CF
Sbjct:  780 GAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAG---EKGDRGMKGLRGHPGLQGMPGPNGPSGD-----------------SGPAGIAGPSGPRGPAGPNGPAGKDGSN---------------GMPGAIGPPGHRGPAGHVGPAGPPGSPGLPGPPGPSGGGYDTS-GGYDEYRADQASLRAKDYEVDATIKSLNTQIENLLSPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCTMDAIKAFC---DFSTGQTCIHPHPESIPRKNW-------YRSSQEKKHTWFGETINSGTEFAYNDETLSPQSM------ATQLAFMRLLANQAVQNITYHCKNSIAYMDAENG--NLKKAVLLQGSND---------------------VELRAEGNSRFTFSVLEDGCSRHT-GQWSKTVIEYRTNKPSRLPILD--IAPLDIGGADQEFGLDIGPVCF 1351          

HSP 2 Score: 92.0485 bits (227), Expect = 3.091e-18
Identity = 121/328 (36.89%), Postives = 142/328 (43.29%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPG---LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFK---------------GNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGP---IGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGE 2015
             GF G PG  G  G A + G AG+ G  G  G +G +G+ G  G PG   ++G  G  G+KG  G  G  G  G  G QG  G  G  GLPG  G  G  G PG  G  G                 G  G +GP+G +G                             +G PG  G PG  G  G+KG++G  G  G  G +G  G  G  G +G PG  G  G  G  G  G  G +GA G  G  GE G  GE G  G+ GL G  GL+G PGP G  G  GP    G  GPRG A P G  G  G  G+ G IG  G RGP G 
Sbjct:  776 TGFPGAPGRVGPPGPAGIVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLGLAGEKGPPGEAGAPGAPGPAGPQGQLGSQGFNGLPGSRGDRGLPGIPGSVGEPGRVGPAGAPGARGPGGNIGMPGMTGPQGEAGR----------------------------EGSPGNDGPPGRPGAAGIKGDRGEPGSPGTAGPVGAPGPNGPSGAVGRPGNRGESGPSGPTGAVGPAGARGAPGPAGPRGEKGVAGEKGDRGMKGLRGHPGLQGMPGPNGPSGDSGPAGIAGPSGPRGPAGPNGPAGKDGSNGMPGAIGPPGHRGPAGH 1075          

HSP 3 Score: 84.7297 bits (208), Expect = 5.122e-16
Identity = 139/390 (35.64%), Postives = 163/390 (41.79%), Query Frame = 3
Query: 1113 GFPGENGIKGVAVK-GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGL---RGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGD------------------------IGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GFPG  G  G A K GE G  G  G+ G  G  GN G  G  GL G  G +G                   QG  G  G  GLPG  G +G +GKPG +GI G +G  G +G KG  G                          RGP G PG  G  GE G +G  G  G  G +G  G+ G +G  G  G  GE    G +GL+G  G+ G +G  G  G PG  G  GD+GE G+ G  G  G  G    RG  GP G  G  GP G DG       G +G KG  G  GD                         G +GD GP G  G PG PG VG  G  G     ++G  G  G  G  GP+G  G  GP GP G  G +G +G
Sbjct:  483 GFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKG------------------EQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPAGVKGERGN----------PGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGE---AGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADG-----QTGPRGEKGPAGGKGDAGPAGPAGPAGNTGPLGPSGPVGPPGARGDSGPTGLTGFPGAPGRVGPPGPAG-----IVGPAGLTGPAGKDGPRGPRGDVGPAGPPGENGMIGPLG 831          

HSP 4 Score: 81.2629 bits (199), Expect = 5.237e-15
Identity = 157/439 (35.76%), Postives = 193/439 (43.96%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKG------------------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE---GLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV---------------GIKGEIGD----------KGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVG 2180
            G+ G VG KG  G KG+ G  G  G  G  G+ G RG  GE G  G + ++G  G  G++G+PG  G  G  G+ G  G +G  G RG  G                 G  GE G +G  G+ G  G+SG PGK+G  G  G                  N+G  GPKG SG  GK                      +GP G  GL G PG +GN G  G  GL G  GEKG+ G SG  G  GL G  G +G  G  G+ G PG++G  G     G++GE G+ G  GA G  G  G  G  GTPGP+G++   G  GP G  GP+G A  G+ G +G  G  G  GEKG+ G +G  GN G  G                 G KGE G                 G+ G  G  G  GP G +G  GPRG  G  G
Sbjct:  336 GDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGD---------------AGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPG-------------------EKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPGDRGIPGDQGVSGPA---GVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGEPGAVGPAGAPGPQGAA--GMPGERGAAGTPGAKGEKGEAGYRGLEGNAGKDGARGAPGPSGPPGPAGANGDKGETGSFGPPGPAGPRGAPGERGESGPAGPSGFAGPPGADGQTGPRGEKGPAG 735          

HSP 5 Score: 78.5666 bits (192), Expect = 3.244e-14
Identity = 163/505 (32.28%), Postives = 203/505 (40.20%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXX---XXXXXXXXXXRQGNRGEMGEIGLP------------GILGKIGTSGKPG---------------------KQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN-----------RGPQGDPGLAGIP---GENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPG---------------------------------------KIGIQGLK---GEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRG------------PKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            ++GE G  G+KG  GA                   G  G PG+ G +G  + GE G  G  G  G +G  GNTG  G  G LG AG  G  G  G     G  G  G  G QG RGE G  G              GI G  G +G PG                       G +G  G+ G  G KG+SG  G+    G +G  G  G +G+               RGP+G  G  G+P   G +G +G+ G +G +G  G +G  G +G+ G+ GL+G  G                                        IG  G K   GE G+PGEKG  G  GL G  G  G+ G  G +GL G PGE G +G  G  G +GL GP G  G  G   PG +G+ G+ G+ G  G KG+RG            P G  G  G PG  G KGE         G +G  G  G  G  G+ G RG  G  G  GE G+ GY
Sbjct:  178 RKGEPGAAGAKGENGA------------------AGSNGTPGQRGGRG--LPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGK--PGDRGIPGDQGVSGPAGVKGERGNPGPAGAAGAQGPIGARGPSGTPGPDGNKGE--------PGAVGPAGAPGPQGAAGMPGERGAAGTPGAKGEKGEAGY 652          

HSP 6 Score: 70.8626 bits (172), Expect = 7.889e-12
Identity = 144/475 (30.32%), Postives = 175/475 (36.84%), Query Frame = 3
Query: 1155 GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGL---AGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGL------------IGEPGKIGIQGLKGEIGQPGE------------------KGTKGAKGLPGI------------------------EGEPGDQGEIGAMGLIGLPGES---------------GLRGTPGPEGDEGLHGPIGDDGPRGTA----LPGIKGVKGEMGLIGD---IGEKGDRGPKGENGNPGIPGEVGIKGEI------------------------------------------GDKGLSVIGKIGKYGTIGNTGPKGL------EGIRGPRGPIGLVGEVGKVG 2198
            G  G  GS G PG +G +G+ G  G PG  G           G  G  G  G+ G  GN G  G+ G  G+LG  G  G PG  G+ G KG+ G +G  G  G PG                    N   G  G PG     G+PGE G +G  G  G  G  G  G  G +G LG  G             +G  G  G  G +G+ G+PG                    G KGA GLPGI                         G  GD G +G  G  G+ GE                G RG+    G++G  GP+G  GPRG A    LPG+ G  G MG+ G    +G  G RGP G+ G  G  G VG +G                                            G KG S  G+ GK G  G  GP GL      +G  GP GP+GL G  G+ G
Sbjct:   87 GPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGA---------IGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAG-------------AKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGS---TGEQGPTGPLGLRGPRGAAGTRGLPGLAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPS--GEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKG 534          

HSP 7 Score: 70.8626 bits (172), Expect = 8.231e-12
Identity = 160/483 (33.13%), Postives = 201/483 (41.61%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNI------------GVKGEKGLMGISG------------EKGDIGKSGKLGKDGLIGEPGKIGIQG---LKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRG---------------PKGENG------------------NPGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGI---------RGPR---------GPIGLVGEVGKVG 2198
            +G +G  G  G PG  G IG +G PG  G+ G+ G  G PG+ G +GV   +G  G  G+ G+PG KG +G  GI G  G  G AG +G+ G  G+             G  G+ G  GLPG  G++G +G     G +G  GN G +GP G  G+    A             +       GP G  G  G PG NG +            G+ G KG  G+ G              G  G SG  G  GL G+PG +G++G   +KGE G  G +G  G  G  G  G  G+QG  G +GL G  G +G RG PG     G  GP+G  GPRG    PG +G  G+ G  G+ G  G RG               P G  G                  N G PG  G  GE G  G    +   G  G  G  GN GP G  G+         +GP          GP G VGE GK G
Sbjct:  101 QGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGENGAAGS------------NGTPGQRGGRGLPGERGRVGPAGP---AGARGADGNTGPAGPAGPLGS----AGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPG---LAGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAGLVGARGLPGSPGSSGPPGKEGPSGAAGQDGRTGPPGPTGPRGQPGNIGFPGPKGPSGEAGKPGEKGPVGPTGLRGSPGPDGNNGPAGPVGLAGAPGEKGEQGPSGAPGFQGLPGPAGPVGEAGKPG 561          

HSP 8 Score: 63.5438 bits (153), Expect = 1.295e-9
Identity = 88/223 (39.46%), Postives = 105/223 (47.09%), Query Frame = 3
Query: 1599 GVKGEKGLMGISGEKGDIGKSGKLGK--------------------DGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP------GESGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEV 2186
            G+KG KG  G  G KG  GK G+ G                     DG  G     G  GL G  G  G  G  GA+GL G  GEPG+ G+ GA+G  G P      GE G  G PG  GD G+ G  G  G  GT  LPG+KG +G  G+ G  GE G  G KGEN   G  G  G  G+ G +GL   G+ G+ G  G  G +G +G  GP GP G +G  
Sbjct:   25 GLKGPKGPRGERGPKGPDGKPGRPGLPGPAGPPGPPGLGGNFAAQYDGAKGPDPGPGPMGLMGPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGEN---GAAGSNGTPGQRGGRGLP--GERGRVGPAGPAGARGADGNTGPAGPAGPLGSA 242          

HSP 9 Score: 59.3066 bits (142), Expect = 3.049e-8
Identity = 134/426 (31.46%), Postives = 169/426 (39.67%), Query Frame = 3
Query: 1191 GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQ-----------GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKG------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGE---PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQG------------------EIGAMGLIGLPGESGLRGTPGPEG------------DEGLHGPIG---------------------------DDGPRG-TALPGIKGVKGEMGLIGD------------IGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +GE+G  G  G PG  G  G  G  G  G  G    + +  +            G RG  G  G PG  G  G +G+PG+ G  G  G        GK+G  GN+G PGK                     +RG  G  G  G PG  G  G+KG +G  GI G KG+ G +G  G++G  G    PG+ G +GL GE G+ G  G  GA+G  G  G  G  G                  E+G  G  G  G  G RG PGP G              G++G  G                             GPRG    PG  GVKG+ G+ G+             GE+G RG  GE G  G  G  G +G  G +GL  +   G+ G +G  GP+G  G  G RGP G  G  G+ G
Sbjct:   31 GPRGERGPKGPDGKPGRPGLPGPAGPPGPPGLGGNFAAQYDGAKGPDPGPGPMGLMGPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPG-------------------DRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGL--AGRSGPMGMPGPRGGVGAPGARGPPGDAGRAGEAG 435          

HSP 10 Score: 55.8398 bits (133), Expect = 3.492e-7
Identity = 122/382 (31.94%), Postives = 141/382 (36.91%), Query Frame = 3
Query: 1401 KQGIKGFKGNVGKSGPKG---------------NSGTPGK----MAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGK------IGIQGLKGEIGQPGEKGTKGAKGLPGIE---GEP---GDQGEIGAMGLIGLPGESGLRGTP------GPEGDEGLHGPIGDDGPRGTALP-------------------GIKGVKGEMGLIGDIGEKGD------------------RGPKGENGNPGI------------------------------PGEVGIKGEIGDKG----------LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            + G+KG KG  G+ GPKG                 G PG      A                    RGP G PG  G  G  G+ G  GE G  G  G +G  G  GK G+DG  G PGK      +G QG +G  G PG  G KG +G  GI+   GEP   G +GE GA G  G PG+ G RG P      GP G  G  G  G+ GP G A P                   G  G  G  G  G  GE G                    G KG  G PGI                              PG VG+KG+ G KG              G+ GK G+ G  GP G  G+RGPRG  G  G  G  G +
Sbjct:   23 QSGLKGPKGPRGERGPKGPDGKPGRPGLPGPAGPPGPPGLGGNFAAQYDGAKGPDPGPGPMGLMGPRGPSGSPGAPGAQGLQGHAGEPGEPGQAGAIGARGPPGPPGKNGEDGNNGRPGKPGDRGVLGAQGARGFPGTPGLPGMKGHRGYNGIDGRKGEPGAAGAKGENGAAGSNGTPGQRGGRGLPGERGRVGPAGPAGARGADGNTGPAGPAGPLGSAGPPGFPGAPGPKGELGPAGPTGPSGAQGQRGEPGPNGAVGPVGPPGNPGANGINGAKGAAGLPGIAGAPGFPGPRGGPGPQGPSGASGPRGLGGDPGPVGVKGDSGVKGEPGSAGPQGPPGPSGEEGKRGSTGEQGPTGPLGLRGPRGAAGTRGLPGLAGRS 404          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col27a1b (collagen, type XXVII, alpha 1b [Source:NCBI gene;Acc:560145])

HSP 1 Score: 139.813 bits (351), Expect = 5.136e-33
Identity = 154/431 (35.73%), Postives = 199/431 (46.17%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKG----DIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPG--------ILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTP---------GPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEM----------GLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G+KG  GS G PG +G     +           KG  G  G PG+NG++G  V GE G+ G+ GM G +G  G  G  G  GL G                         +G+ G  GE GL G          GKIG +G+ G  G  G +G  G  G KG  G PG                            DPG+ G  G +G  G KGE+G +G+ GE G+ G  G  G +G  G+PG IG++G +G+IG+ GE+G  G KG  G +G+ G+ G +G  G  G  G  G RGT          G  G+ GL G  G  GP+G+   PG KG KGE           G  GDIG  G+RG +GE G+PG PG  G++GE G +G    G  G  G  G  GPKG +G +GP+G     GE G  G
Sbjct:  519 QGDKGIQGSPGLPGVQGKPGPQVDFYVFVYYCFLKGFPGDIGPPGQNGVEGPKVCGEPGMTGNPGMLGERGPVGFVGPFGEMGLAG------------------------EKGHPGAPGERGLSGPAGAPVSHCYGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPG----------------------------DPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGVIGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAP--GVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRG 895          

HSP 2 Score: 137.502 bits (345), Expect = 2.542e-32
Identity = 154/413 (37.29%), Postives = 210/413 (50.85%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGN---TGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI------------PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G KG +G  G PG  G+ G  G  G KGE+GD+G  G  GE G+  +  KG  G  G  G+ G KG +G    TG  G PG  G  G++G+ G  G  G++G+ G IG +G+RG  G +G  G +G+ G  G  G +G +G +G++G  GPKG  G  G                   +  +RG  GDPG  G+            PG  GN G +G  G  G  G KG  GK+   G+ G  G PG +G+ G +G IG+ G +G  G  G  G +G  G  G++G  G +GLPG+ G +G  G  G  G+ G  G  G RG  +PG  G  G+ GL G +G  G +G +G  G PG  GE G  G        V+G  G  G  G+ GP G++G +GP+G +G+ G +G VG
Sbjct:  654 GAKGILGEPGDPGVDGEAGPSGPDGAKGEQGDVGLEGESGEKGV--IGFKGTEGRTGDPGLIGVKGPEGKIGKTGERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERG--IPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPG--------VLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVG 1054          

HSP 3 Score: 132.494 bits (332), Expect = 1.083e-30
Identity = 151/401 (37.66%), Postives = 190/401 (47.38%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----------VAVKGEAGVQGSQGMPGYKGEKGNTG----IGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRG---TPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIR 2150
            +RG+ G  GSKGH G  G++G  G  G  G  G  G RG  G  G  G          V  +G  G QGS G PG KGEKG  G    + G PG  G                  + G +G +G+RGE G+ G PG+ G  G  GK G  G+ G  G  G  GPKG+ G  G                         P+G+ G  G PG    +GV G +G++G  G +GD G  G  GKDG  G PG +G  G  G  G+PG +G  GA GLPG++G  G +GE G  G  G PG+ GL G    PG +GD+G  G  GD G +G   PG+ G+ G  G  GD G  G +GPKG  G       +G++G IG  G  +IG  G  G  G+ G KG  G  
Sbjct:  727 ERGKPGEKGSKGHQGQLGEMGALGEQGDTGFIGPKGSRGTTGFMGATGKMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSG------------------DIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKG-------------------KNSPRGESGNRGSPGP---VGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGKPGPQGNAGAPGLPGVQGSFGPKGERGIPGQSGPPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQG--FPGVLGIFGPQGPPGDFGPVGVQGPKGPQG------LMGMQGAIGPVG--IIGPSGNPGPQGDKGNKGEMGPP 1077          

HSP 4 Score: 102.064 bits (253), Expect = 2.109e-21
Identity = 129/323 (39.94%), Postives = 162/323 (50.15%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIG-FRGFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPG---ILGKIGTSGKPGKQGIKG---FKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGD------------QGEIGAMGLIGLPGESGLRGTPGPEGDEG 1889
            K+ + GE G VG +GH G +G +G  G  G+KGE+GD G   G PG +G  G       +GE G  G  G+ G +GE+G  G  G PG  G  G  G KG KGN G KG+    G  GNRG  G +G+PG   ++G+ G  G PG  G  G    KG  G  G  G+ G PGK                       GPQG+ G  G+PG  G+ G KGE+G+ G SG        GK G +G +G PGK G QG KG+ G  GE+G  G  G+ G +G PGD            QG +G  G IG  G  G  G PGP+GD+G
Sbjct:  775 KMGQHGEPGLVGYEGHQGPQGSLGSPGPKGEKGEQGDDGKVEGPPGPSGDIGPVGNRGDRGEPGDPGYPGLEGVQGERGKEGAPGVPGNSGPRGFPGPKGSKGNKGPKGKNSPRGESGNRGSPGPVGVPGPRGVIGREGFEGDPGPDGAAGKDGAKGMPGDLGHDGDVGLPGK----------------------PGPQGNAGAPGLPGVQGSFGPKGERGIPGQSG------PPGKRGLNGGMGFPGKQGDQGFKGQPGDAGEQGFPGVLGIFGPQGPPGDFGPVGVQGPKGPQGLMGMQGAIGPVGIIGPSGNPGPQGDKG 1069          

HSP 5 Score: 85.1149 bits (209), Expect = 3.505e-16
Identity = 70/177 (39.55%), Postives = 94/177 (53.11%), Query Frame = 3
Query: 1695 PGKIGIQGLKGEIGQP---GEKGTKGAKGLPGIEGEPGDQGE----IGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            P + G  GL GE G+P   G+KG +G+ GLPG++G+PG Q +    +    L G PG+       GP G  G+ GP     P  T  PG+ G +G +G +G  GE G     GE G+PG PGE G+ G  G       GKIG+ G  G TG  G++G  GP G  G++GE G  G +
Sbjct:  501 PCQQGELGLPGEPGEPGFQGDKGIQGSPGLPGVQGKPGPQVDFYVFVYYCFLKGFPGDI------GPPGQNGVEGPKVCGEPGMTGNPGMLGERGPVGFVGPFGEMGL---AGEKGHPGAPGERGLSGPAGAPVSHCYGKIGETGEAGPTGFTGVQGPTGPPGAKGILGEPGDPGVD 668          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: CR545476.3 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:23915065:23940181:-1 gene:ENSDARG00000114020.1 transcript:ENSDART00000190370.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR545476.3)

HSP 1 Score: 140.198 bits (352), Expect = 6.637e-33
Identity = 131/344 (38.08%), Postives = 158/344 (45.93%), Query Frame = 3
Query: 1164 GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG---------KPGKQGIKGFKGNVGKSGP---KGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK------GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKG---TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGP 2129
            G QG QG PG +G KG+ G                                   G +GE+GEIGL GI G+ GTSG          PG++G KG KG  G +G    +G+ GTPG+                   N  RGP+GDPG AG  GE G  G KG  G  G  G        G  G +G+ G DGL GEPG  G +G  G IG PG +G     G +G  G  G  G++G  GA+G  G PGE G +G  GP G     G  G+DG  G   PG KG KG+ G        G  GPKGE G+PG  G  G +G  G +G S V G  G+ G IG  GP
Sbjct: 1661 GTQGFQGCPGQRGVKGSRGY---------------------------------NGEKGEIGEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPGR------------------DNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPR---GEPGEDGRDGFGFPGPKGRKGDEGF------PGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKGDIGYPGP 1944          

HSP 2 Score: 119.783 bits (299), Expect = 1.010e-26
Identity = 108/312 (34.62%), Postives = 135/312 (43.27%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQG----IKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD------------------IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE-----------KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP 1937
            GF+G PG+ G+KG     GE G  G  G+ G  GE+G +GI G PG  G                          G RG  G  G  G  G+IG  G PG  G     +G KG+ G +GP G  G  G     G  G +GS G +G      G  G PG  G+ GE G  G +G  G +G  G +G+                   G+ G +G+ G  GEPG  G+ G  G  G+PGE           KG KG +G PG  G  G+ G+ G  G  G  G +G RGT G  G  G  G IG  GP  + LP
Sbjct: 1664 GFQGCPGQRGVKGSRGYNGEKGEIGEIGLDGINGEEGTSGIAGPPGDRG------------------------NPGQRGPKGAKGQAGDAGQIGIRGDPGTPGRDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPG-QAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEPGEDGRDGFGFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPGPRGNNGQRGTSGVRGGPGQKGDIGYPGPYVSTLP 1950          

HSP 3 Score: 113.235 bits (282), Expect = 1.215e-24
Identity = 119/356 (33.43%), Postives = 146/356 (41.01%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGK---PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG---VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG----EKGTKGAKGLPGIEGEPGDQGEI------------------GAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-------------------------------ALPGIKGVKGEMGLIGDIGEKGDRG-----PKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G RG+ G +G+PG  G+ G  G    PG +G  G +G  G +G +G  G PG+                      RG +G  G  G  GE G IG   + GE+G  GI+G  GD G  G+ G  G  G+ G  G  G++G+ G PG    ++G KG  G  G  GEPG  G                    G  G  G PG  GL G PG  G  G  GPIG  G RG                                  PG KGV G  G  G+ GE G  G     PKG  G+ G PG  G KGE GD G +           GN G +G  G+RG  GP    G+ G +GY
Sbjct: 1619 GPRGDRGAVGVPGQKGQSGGQGSSGHPGDEGGPGERGPPGVNGTQGFQGCPGQ----------------------RGVKGSRGYNGEKGEIGEIGLDGINGEEGTSGIAGPPGDRGNPGQRGPKGAKGQAGDAGQIGIRGDPGTPGRDNTQRGPKGDPGDAGPAGEPGVDGNKGGPGEPGRRGSDGRRGPPGQAGAAGRPGSDGLAGEPGIGGSRGPAGPIGAPGVRGEDGNPGPRGPGGQPGPAGEKGRRGAVGRKGEPGEPGPKGVTGPFGPRGEPGEDGRDGFGFPGPKGRKGDEGFPGFPGPKGEAGDPGTNGGPG-----PRGNNGQRGTSGVRG--GP----GQKGDIGY 1941          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col7a1l (collagen type VII alpha 1-like [Source:ZFIN;Acc:ZDB-GENE-030131-9861])

HSP 1 Score: 135.191 bits (339), Expect = 1.602e-31
Identity = 147/400 (36.75%), Postives = 183/400 (45.75%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIG--------LPGILGKIGTSGKPGKQGIKG--------------------FKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD--IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGE---KGDRGPKGENGNP--GIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G RG PG +GI G+   G  G  G  G PG +G  G  G  G PG  G                         +G RGE GE G        LPG  G+ G+SG  G  G+ G                     KG  G+ GPKG  G PG+                      +G +G+ G  G+PG  G +GV G  GL G  GEKG   IG  G  G  G  GE G  G+ G KGE+G  G +G  G +G  G++G+ G++G  G  G IG PG +G  G  G +GDEG  G  G+        PG KG +G++GL+G  G    KGDRG KGE GNP  GIPG+ G KGE G++        G  G  G  GPKG +G +G +G IGL G  G  G
Sbjct: 1103 GERGLPGTDGIPGLP--GRPGRTGPPGSPGQRGPSGIPGDMGPPGNTG------------------------PKGQRGERGEPGYVMGGMEVLPGRKGEPGSSGPSGAPGVPGVSGPPGLPGLPGPSGSPGLSIKGESGEPGPKGPRGKPGQ----------------------KGEKGEQGNNGLPGLPGPVGVDGLPGLAGQKGEKGQDGIGTQGAQGPPGPPGEKGNTGLSGSKGEVGIQGLQGIAGPRGKKGLKGDQGEKGAQGENGPIGSPGIAGFPGAAGRKGDEGQRGAPGEPAKGILGPPGKKGARGDIGLVGPPGPQGIKGDRGDKGEKGNPGFGIPGQPGPKGESGER--------GNVGLSGKPGPKGNDGSKGDKGEIGLPGTSGSPG 1446          

HSP 2 Score: 119.013 bits (297), Expect = 1.440e-26
Identity = 149/418 (35.65%), Postives = 187/418 (44.74%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGG---NPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGL------------------------------PGESGL--------------RGTPGPEGDEGLHG-PIGDDGPRGTALPGIKGVKGEMGLIGDI---GEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            + G  G  GE GI+G+  +G AG +G +G+ G +GEKG  G  G   +PG+ GF G                       G +G+ G+ G PG   K G  G PGK+G +G  G VG  GP+G  G  G                      ++G +G+PG  GIPG+ G  G  GE+G +G+SG+ G  G  G  G  G IG PG  G  GL+G+ G PG KG  G++G PG  GEPGD+G  G  G  GL                              PGESGL                         L G   G DG  G  LPGI G KGE G  G+    GEKGD G  G  G PG+PG  G  G  G +G+S  GK G+ G  G+ G KG++G  G  G  G  GE G  G
Sbjct: 1284 NTGLSGSKGEVGIQGL--QGIAGPRGKKGLKGDQGEKGAQGENGPIGSPGIAGFPGAA---------------------GRKGDEGQRGAPGEPAK-GILGPPGKKGARGDIGLVGPPGPQGIKGDRG----------------------DKGEKGNPGF-GIPGQPGPKGESGERGNVGLSGKPGPKGNDGSKGDKGEIGLPGTSGSPGLRGKDGVPGLKGDTGSRGEPGSRGEPGDRGVKGPEGHKGLKGEPGLPGPPGVTQFTTSDNTVLTRAIKGEPGESGLPGPPGETGRPGPPGPEGKPGPPGNSLFGSSTGKDGLDG--LPGIPGSKGEAGQKGEPGSKGEKGDHGRAGITGMPGLPGTPGKPGVDGKRGVS--GKDGERGPKGDEGEKGVKGEPGANGNEGQKGEQGSPG 1650          

HSP 3 Score: 117.472 bits (293), Expect = 4.499e-26
Identity = 164/426 (38.50%), Postives = 206/426 (48.36%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAG--VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV-----------KGEKGLMGISGEKGDI------GKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR------GTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +RG  GT G  G PG  G  G  G PG++G  G  G  G PG  G KG    +GE G  + G + +PG KGE G++G  G PG+ G +G  G  G+ G +G  G          +GE GE       G  G  GKPG++G KG +GN       G  G PG +                      G  G PGLAG  GE G  G+            GEKG  G+SG KG++      G +G  GK GL G+ G+ G QG  G IG PG  G  GA G  G EG+ G  GE  A G++G PG+ G R      G PGP+G +G  G  G+ G  G  +PG  G KGE G  G++G  G  GPKG +G+ G  GE+G+ G  G  GL   GK G  G  G+TG +G  G RG  G  G+ G  G  G
Sbjct: 1104 ERGLPGTDGIPGLPGRPGRTGPPGSPGQRGPSGIPGDMGPPGNTGPKGQRGERGEPGYVMGGMEVLPGRKGEPGSSGPSGAPGVPGVSGPPGLPGLPGPSGSPGLSI-------KGESGEP------GPKGPRGKPGQKGEKGEQGN------NGLPGLPGPV----------------------GVDGLPGLAGQKGEKGQDGIGTQGAQGPPGPPGEKGNTGLSGSKGEVGIQGLQGIAGPRGKKGLKGDQGEKGAQGENGPIGSPGIAGFPGAAGRKGDEGQRGAPGEP-AKGILGPPGKKGARGDIGLVGPPGPQGIKGDRGDKGEKGNPGFGIPGQPGPKGESGERGNVGLSGKPGPKGNDGSKGDKGEIGLPGTSGSPGLR--GKDGVPGLKGDTGSRGEPGSRGEPGDRGVKGPEGHKG 1485          

HSP 4 Score: 90.5077 bits (223), Expect = 9.776e-18
Identity = 101/288 (35.07%), Postives = 129/288 (44.79%), Query Frame = 3
Query: 1542 RGPQGDPGLAGI------PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKI--GIQGLKGEIGQPGEKGTKGAKGLPGI-----------------------EGEP------------GDQGEIGAMGLIGLPGESGLRGTPG--------------------------PEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGI---PGEVGIKGEIGDKG---------LSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            +G +G PG  GI      PG  G  G  G++G  GI G+ G  G +G  G+ G  GEPG +  G++ L G  G+PG  G  GA G+PG+                        GEP            G++GE G  GL GLPG  G+ G PG                           +G+ GL G  G+ G +G  L GI G +G+ GL GD GEKG +G  G  G+PGI   PG  G KG+ G +G         L   GK G  G IG  GP G +GI+G RG
Sbjct: 1102 KGERGLPGTDGIPGLPGRPGRTGPPGSPGQRGPSGIPGDMGPPGNTGPKGQRGERGEPGYVMGGMEVLPGRKGEPGSSGPSGAPGVPGVSGPPGLPGLPGPSGSPGLSIKGESGEPGPKGPRGKPGQKGEKGEQGNNGLPGLPGPVGVDGLPGLAGQKGEKGQDGIGTQGAQGPPGPPGEKGNTGLSGSKGEVGIQG--LQGIAGPRGKKGLKGDQGEKGAQGENGPIGSPGIAGFPGAAGRKGDEGQRGAPGEPAKGILGPPGKKGARGDIGLVGPPGPQGIKGDRG 1387          

HSP 5 Score: 87.4261 bits (215), Expect = 7.100e-17
Identity = 143/409 (34.96%), Postives = 174/409 (42.54%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPG--AKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAG-----VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKG---------FKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXN--VNRGPQGDPG---------------------------------------LAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP-----EG----DEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPG 2030
            G KG  G +G PG  AKG +G  G  G +G   DIG  G PG  GIKG    KGE G     + G  G  G  GE+GN G+ G PG  G                          G++G+ GEIGLPG  G  G  GK G  G+KG          +G  G  G KG  G  G     G+ G  G        N  + R  +G+PG                                       L G+PG  G+ G  G+KG  G  GEKGD G++G  G  GL G PGK G+ G +G  G+ GE+G KG +G  G++GEPG  G  G  G      E G  G PGP     EG    D     P+    P  T  PG+KG KGEMGL      KG+   KG+ G PG
Sbjct: 1340 GRKGDEGQRGAPGEPAKGILGPPGKKGARG---DIGLVGPPGPQGIKGDRGDKGEKGNPGFGIPGQPGPKGESGERGNVGLSGKPGPKG------------------------NDGSKGDKGEIGLPGTSGSPGLRGKDGVPGLKGDTGSRGEPGSRGEPGDRGVKGPEGHKGLKGEPGLPGPPGVTQFTTSDNTVLTRAIKGEPGESGLPGPPGETGRPGPPGPEGKPGPPGNSLFGSSTGKDGLDGLPGIPGSKGEAGQKGEPGSKGEKGDHGRAGITGMPGLPGTPGKPGVDGKRGVSGKDGERGPKGDEGEKGVKGEPGANGNEGQKG------EQGSPGLPGPPIVLQEGMSIEDMKKAFPLPMGPPGATGPPGMKGEKGEMGL------KGE---KGDAGAPG 1706          

HSP 6 Score: 85.8853 bits (211), Expect = 2.574e-16
Identity = 147/459 (32.03%), Postives = 183/459 (39.87%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAG--VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVG---KSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAG---IPGENGNIGVKGEKGLMGISGEKGDIGKSGKLG------------------------KDGLIGEPGKIGI---------------------------------QGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGD-----------------------------------RGPKGENGNPGIPGEVGIKGEIGDKG 2075
            +G +G  G +G  G KGD GEKG  G+ G  G  G  GFPG  G KG    +G  G   +G  G PG KG +G+ G+ G PG  G                         +G+RG+ GE G PG     G  G+PG +G  G +GNVG   K GPKGN G+ G     G+                 G  G PGL G   +PG  G+ G +GE G  G  G++G  G  G  G                           + GEPG+ G+                                  GL G  G PG KG  G KG PG +GE GD G  G  G+ GLPG  G    PG +G  G+ G  G+ GP+G    G KGVKGE G  G+ G+KG+                                    GP G  G     GE+G+KGE GD G
Sbjct: 1297 QGLQGIAGPRGKKGLKGDQGEKGAQGENGPIGSPGIAGFPGAAGRKGDEGQRGAPGEPAKGILGPPGKKGARGDIGLVGPPGPQGI------------------------KGDRGDKGEKGNPGF----GIPGQPGPKGESGERGNVGLSGKPGPKGNDGSKGDKGEIGLP----------------GTSGSPGLRGKDGVPGLKGDTGSRGEPGSRGEPGDRGVKGPEGHKGLKGEPGLPGPPGVTQFTTSDNTVLTRAIKGEPGESGLPGPPGETGRPGPPGPEGKPGPPGNSLFGSSTGKDGLDGLPGIPGSKGEAGQKGEPGSKGEKGDHGRAGITGMPGLPGTPG---KPGVDGKRGVSGKDGERGPKGDE--GEKGVKGEPGANGNEGQKGEQGSPGLPGPPIVLQEGMSIEDMKKAFPLPMGPPGATGPPGMKGE---KGEMGLKGEKGDAG 1703          

HSP 7 Score: 66.2402 bits (160), Expect = 2.549e-10
Identity = 75/221 (33.94%), Postives = 91/221 (41.18%), Query Frame = 3
Query: 1749 KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG---------TALPGIKG-----------------------------------VKGEM------GLIGDIGEKGDRGPKGENGNPGIPGEVGI---------KGEIGDKGLSVI------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KG KG +GLPG +G PG  G  G  G  G PG+ G  G PG  G  G  GP G  G RG           LPG KG                                   +KGE       G  G  G+KG++G +G NG PG+PG VG+         KGE G  G+               G  G  G+ G  G +GL+GI GPRG  GL G+ G+ G
Sbjct: 1099 KGEKGERGLPGTDGIPGLPGRPGRTGPPGSPGQRGPSGIPGDMGPPGNTGPKGQRGERGEPGYVMGGMEVLPGRKGEPGSSGPSGAPGVPGVSGPPGLPGLPGPSGSPGLSIKGESGEPGPKGPRGKPGQKGEKGEQGNNGLPGLPGPVGVDGLPGLAGQKGEKGQDGIGTQGAQGPPGPPGEKGNTGLSGSKGEVGIQGLQGIAGPRGKKGLKGDQGEKG 1319          

HSP 8 Score: 61.6178 bits (148), Expect = 6.502e-9
Identity = 104/329 (31.61%), Postives = 140/329 (42.55%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKI---------------------GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGT-----------KGAKGLP------------GIEGEPGDQGEIGAMGLIGLPGES 1850
            + GE+G VG  G PG KG+       G KG+KG+IG  G  G  G++G   V G  G  GS+G PG +GE G+ G+ G  G  G  G  G  G  G          +  +  +GE GE GLPG  G+                       ++GK G  G+ G  G+ G++G KG  G+ G+                      +G  G  G+ G+PG  G  G  G  G  G+SG+ G+ G  G  G+ G+ GEPG  G +G KGE G PG  G               K  P            G++GE G+ G  G  G  G PG +
Sbjct: 1408 ESGERGNVGLSGKPGPKGN------DGSKGDKGEIGLPGTSGSPGLRGKDGVPGLKGDTGSRGEPGSRGEPGDRGVKGPEGHKGLKGEPGLPGPPGVTQFTTSDNTVLTRAIKGEPGESGLPGPPGETGRPGPPGPEGKPGPPGNSLFGSSTGKDGLDGLPGIPGSKGEAGQKGEPGSKGE----------------------KGDHGRAGITGMPGLPGTPGKPGVDGKRGVSGKDGERGPKGDEGEKGVKGEPGANGNEGQKGEQGSPGLPGPPIVLQEGMSIEDMKKAFPLPMGPPGATGPPGMKGEKGEMGLKGEKGDAGAPGRA 1708          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000017769.1 (collagen, type XXVII, alpha 1 [Source:NCBI gene;Acc:100490770])

HSP 1 Score: 152.91 bits (385), Expect = 9.184e-37
Identity = 229/767 (29.86%), Postives = 327/767 (42.63%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV---------------------------NRGPQGD------PGLAGIPGENGNIGVKGE------------KGLMGISGEKGDIG---KSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----TALPGIKGVKGEMGLI---GDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDA-VSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAV-WLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTF--TKMLLSTNKPDMLPIVD 3113
            G KG  G+KG PG  G+ G KG         D+G  G PGE G+ G      ++GE+G+ G  GM G  G+ G  G  G  G+ G  G  G  G  G  G +G +G+ G+QG +G+ G+ G  G  G +G +G PG QG  G +G  G  G +G  G+PG+M  +G  G  G +G +G                               +RGP GD      PG  G PG++G  G +G             +GL G+ G KG +G   K GK G+ G  G+PG IG+ G +G +G+ G++G  G  G+PG +G PG +GE G  G IGL G  G RG  G  G  G  GP G  G RG      LPG +G++G MGL    G++G KG  G  GE G PGI G  G KG  GD G   I G  G  G +G  G  G  GI GP G  G VG+ G  G NG  G  G  G +G  G         + IL +  +E  +   ++L+       +  N+  V   + + +    L S+     +   + + P   C+D+ +    ++ +   W+DPN G S D+ +  C  +E     +T    +T  +  +E G +                                     Q+NFL + S  A Q + F C     +       +    A  F+ +  +                    I+  E    +F   +  D CK +  G +  T ++  T  P   PIVD
Sbjct:  993 GHKGPQGAKGEPGPPGETGLKG---------DLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGMPGPRGPPGPRGKPGP-----PGPSVILDSYRQEDFAASYQALMDSSGTSYQSTNYMMVDNGSEIFKTLHYLSSLIQSIKSPLGTRDNPARICRDL-MNCQQKMGDGTYWIDPNIGCSSDTIEVTCNFTE---GGQTCLKPITKSKMEFEVGRV-------------------------------------QMNFLHLLSSEAMQSITFHCLNVPAW-------EKSSKAVRFKAWSGH--------------------IFGTEG---MFQPEVSVDGCKVQD-GRWHQTVLIFRTQDPTQFPIVD 1673          

HSP 2 Score: 127.102 bits (318), Expect = 8.438e-29
Identity = 142/384 (36.98%), Postives = 190/384 (49.48%), Query Frame = 3
Query: 1152 KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE------------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----ALPG---------------IKGVKGEMG----LIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G  G PG  G KG +GI G  GL+G                            +G+MGE G+PG  G  G SG  G  G KG  GN G +G +G  G  G++  KG +G KG  G  G++ +    +GD G  GIPGE G IG +G+ GL G SG  G  G  G++G+ G  GE G+ G++G KG+             G  G+ G +G KG PG +G  G +G +G     G+PG+ G  G  GP+G  G  GP+G  G  G      +PG               IKG KGE G      G  G  GDRGP G+ G+ G PG+ G  G+ G +G    G  G+ G  G++GP+GL+G+RG +G +GL G+ GK G
Sbjct:  911 RGARGPDGPAGEPGLAGTKGPSGIQGKQGLIG---------------------------PQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGL----KGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGE---TGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPR--GNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPG 1258          

HSP 3 Score: 121.324 bits (303), Expect = 4.017e-27
Identity = 176/493 (35.70%), Postives = 222/493 (45.03%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKG---DIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG------------LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPGENGNIGVKGEK------------------------GLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQ---------------------------------------------PGEKGTKGAKGLPGIEGEP------GDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG +G+ G+KG+PG +G    IG  G  G +G  G  G  G PG +G +G+  V G+ G  G  G PG  GE+G  G+ GNPG             +G  G  G  G  G  G KG  G  G  G +G+ G  G PGI G IG  G  G QG+ G  G  GK+G  G  G  G     G  G +G  G  G    N   G +G PG  G PG  G  G +G++                        G  G  GE G+ G+SGK+G+ GL G  G +G  G+ GE G                                               G KG +GA+G  G  GEP      G  G  G  GLIG  G+ G RG PGP G  G+ GP G  G +G T  PG  G +G +G +G+IG KG +G KGE   PG PGE G+KG++G  G+      G+ G IG  G  GLEG  G  GP G+ GE+G+ G
Sbjct:  572 RGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGE---PGPPGETGLKGDLGPLGIP-----GEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPG 1056          

HSP 4 Score: 111.694 bits (278), Expect = 3.894e-24
Identity = 163/487 (33.47%), Postives = 189/487 (38.81%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEP---GKIGIQGLKG------------------EIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG------------LIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGD---------------------------------------------RGPKGENGNPGIPGEVGIKGEIGDKGLS-------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            L ++G+KG  G +GHPG                  + G RG  G  G KG       G QG  G  G  G KGN G  G PGL G                             G  GE GLPG+ GK GT G+P      GF G+ G+ GP G  G PG++   G  G  G  G  G       P G  GL G+PG +G  G+KG+KG+ G  G  GDIG  G  G  GL G P   GK G+ G  G                  +IG PGE G +G KG PG  G PG +G+ G  G            L G PG  G  G  G EG +G  G  G  G  G    G++G  G +G  G  GEKGD                                             RGPKG  G  G  G  G  G  G KG S       +IG  GK G  G  GP G  GI GP GP G  G  G  G
Sbjct:  551 LSRKGQKGYPGPQGHPG------------------EPGVRGPEGSPGAKGY-----PGRQGLPGPIGVSGPKGNRGYIGPPGLFGLP---------------------------GADGERGLPGVPGKRGTMGRP------GFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFP-GLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQ--GLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPG 978          

HSP 5 Score: 99.7525 bits (247), Expect = 2.078e-20
Identity = 136/390 (34.87%), Postives = 165/390 (42.31%), Query Frame = 3
Query: 1164 GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPG---ENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGE------------------------PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLH---------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPK---------------GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            G +G +G PG    K   G+ G+PGL G  G  G    KG            ++G  G  G  G PG+ G  G+ G  G  G +G  G +G SGPKGN                            RG  G PGL G+PG   E G  GV G++G MG  G  GD G+ G  G DG  GE                        PG  G++GL G  G+ G KG KG +G PGI G+ G QG+ G+ GL G PG  G  G  G  GD+G                 GP G++GP      GIKG  G  G  G  G+ G  G +               G  G PGI G  G KGE G+ G S  GKIG+ G  G  GP G  GI G +G
Sbjct:  516 GPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKG------------QKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGN----------------------------RGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPE-----GIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRS--GKIGEQGLQGFIGPVGETGIAGEKG 858          

HSP 6 Score: 83.1889 bits (204), Expect = 1.971e-15
Identity = 101/248 (40.73%), Postives = 124/248 (50.00%), Query Frame = 3
Query: 1458 SGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPK 2132
             G PG   + G KG KG  G+     +N G +GDPGL G+ G  G +  KG+KG  G  G  G+ G  G  G  G  G PG+   QGL G IG  G KG +G  G PG+ G PG  GE    GL G+PG+ G  G PG  GD G  GP G DG  G                         PG+KG+K   GL G+ GE G +G KG  G PGIPG++G +G+ G +GL    G  GK G +G  G K
Sbjct:  506 HGNPGPPGMHGPKGQKGDPGLSPGKAIN-GLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGR---QGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGE---RGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLK---GLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDK 743          

HSP 7 Score: 78.1814 bits (191), Expect = 6.622e-14
Identity = 90/242 (37.19%), Postives = 119/242 (49.17%), Query Frame = 3
Query: 1620 LMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE---GDEGLHGPIGDDGPRGT-------------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            + G  G+KGD G S     +GL G+PG  G+ G+ G + +      KG KG PG +G PG+            PG  G  G+PG +   G +GL GPIG  GP+G                     LPG+ G +G MG  G  G+ G+RGP G +GNPG      +           IG +G  G +G  G KGL+G+ G  G  GL G+ G  G+ G  G+IG  G+KG +GLPG PG RG
Sbjct:  514 MHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSR------KGQKGYPGPQGHPGE------------PGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGE-----LGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRG 732          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000032329.1 (collagen, type XXVII, alpha 1 [Source:NCBI gene;Acc:100490770])

HSP 1 Score: 152.525 bits (384), Expect = 1.053e-36
Identity = 229/767 (29.86%), Postives = 327/767 (42.63%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV---------------------------NRGPQGD------PGLAGIPGENGNIGVKGE------------KGLMGISGEKGDIG---KSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----TALPGIKGVKGEMGLI---GDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDA-VSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAV-WLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTF--TKMLLSTNKPDMLPIVD 3113
            G KG  G+KG PG  G+ G KG         D+G  G PGE G+ G      ++GE+G+ G  GM G  G+ G  G  G  G+ G  G  G  G  G  G +G +G+ G+QG +G+ G+ G  G  G +G +G PG QG  G +G  G  G +G  G+PG+M  +G  G  G +G +G                               +RGP GD      PG  G PG++G  G +G             +GL G+ G KG +G   K GK G+ G  G+PG IG+ G +G +G+ G++G  G  G+PG +G PG +GE G  G IGL G  G RG  G  G  G  GP G  G RG      LPG +G++G MGL    G++G KG  G  GE G PGI G  G KG  GD G   I G  G  G +G  G  G  GI GP G  G VG+ G  G NG  G  G  G +G  G         + IL +  +E  +   ++L+       +  N+  V   + + +    L S+     +   + + P   C+D+ +    ++ +   W+DPN G S D+ +  C  +E     +T    +T  +  +E G +                                     Q+NFL + S  A Q + F C     +       +    A  F+ +  +                    I+  E    +F   +  D CK +  G +  T ++  T  P   PIVD
Sbjct:  993 GHKGPQGAKGEPGPPGETGLKG---------DLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGETGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPRGNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPGESGAHGQPGAIGVTGPRGVVGRQGQEGPAGPDGIPGKDGSPGLKGEQGDDGEIGLAGTLGKRGNTGVPGLPGAQGPPGFRGERGLPGEIGLPGKRGMEGGMGLSGAKGELGTKGQPGDPGEMGFPGIAGLFGPKGPPGDVGFKGIQGPKGPLGLMGKEGAGGPMGIVGPNGNPGPVGDRGSQGDNGMPGPRGPPGPRGKPGP-----PGPSVILDSYRQEDFAASYQALMDSSGTSYQSTNYMMVDNGSEIFKTLHYLSSLIQSIKSPLGTRDNPARICRDL-MNCQQKMGDGTYWIDPNIGCSSDTIEVTCNFTE---GGQTCLKPITKSKMEFEVGRV-------------------------------------QMNFLHLLSSEAMQSITFHCLNVPAW-------EKSSKAVRFKAWSGH--------------------IFGTEG---MFQPEVSVDGCKVQD-GRWHQTVLIFRTQDPTQFPIVD 1673          

HSP 2 Score: 126.716 bits (317), Expect = 1.000e-28
Identity = 142/384 (36.98%), Postives = 190/384 (49.48%), Query Frame = 3
Query: 1152 KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE------------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----ALPG---------------IKGVKGEMG----LIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G  G PG  G KG +GI G  GL+G                            +G+MGE G+PG  G  G SG  G  G KG  GN G +G +G  G  G++  KG +G KG  G  G++ +    +GD G  GIPGE G IG +G+ GL G SG  G  G  G++G+ G  GE G+ G++G KG+             G  G+ G +G KG PG +G  G +G +G     G+PG+ G  G  GP+G  G  GP+G  G  G      +PG               IKG KGE G      G  G  GDRGP G+ G+ G PG+ G  G+ G +G    G  G+ G  G++GP+GL+G+RG +G +GL G+ GK G
Sbjct:  911 RGARGPDGPAGEPGLAGTKGPSGIQGKQGLIG---------------------------PQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGEPGPPGETGL----KGDLGPLGIPGEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPGPEGEKGEKGVEGTKGKDGPPGPSGIPGVRGVEGKPGKQGEKGKPGQKGSKGFEGHLGE---TGVPGDQGPTGNQGPKGSRGTRGPVGSPGRMGAQGEPGMPGYQGHKGPPGPLGPPGIKGEKGEQGDDGKAEGTPGAPGDRGPVGDGGDRGEPGDPGYPGQDGPEGPR--GNAGQQGLPGHSGPRGLQGLRGSKGTVGLKGKPGKPG 1258          

HSP 3 Score: 121.324 bits (303), Expect = 4.603e-27
Identity = 176/493 (35.70%), Postives = 222/493 (45.03%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKG---DIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG------------LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPGENGNIGVKGEK------------------------GLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQ---------------------------------------------PGEKGTKGAKGLPGIEGEP------GDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG +G+ G+KG+PG +G    IG  G  G +G  G  G  G PG +G +G+  V G+ G  G  G PG  GE+G  G+ GNPG             +G  G  G  G  G  G KG  G  G  G +G+ G  G PGI G IG  G  G QG+ G  G  GK+G  G  G  G     G  G +G  G  G    N   G +G PG  G PG  G  G +G++                        G  G  GE G+ G+SGK+G+ GL G  G +G  G+ GE G                                               G KG +GA+G  G  GEP      G  G  G  GLIG  G+ G RG PGP G  G+ GP G  G +G T  PG  G +G +G +G+IG KG +G KGE   PG PGE G+KG++G  G+      G+ G IG  G  GLEG  G  GP G+ GE+G+ G
Sbjct:  572 RGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQGLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPGPAGAQGPVGALGEIGHKGPQGAKGE---PGPPGETGLKGDLGPLGIP-----GEQGLIGQRGDPGLEGESGLTGPDGMKGEIGQPG 1056          

HSP 4 Score: 111.694 bits (278), Expect = 4.275e-24
Identity = 163/487 (33.47%), Postives = 189/487 (38.81%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEP---GKIGIQGLKG------------------EIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG------------LIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGD---------------------------------------------RGPKGENGNPGIPGEVGIKGEIGDKGLS-------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            L ++G+KG  G +GHPG                  + G RG  G  G KG       G QG  G  G  G KGN G  G PGL G                             G  GE GLPG+ GK GT G+P      GF G+ G+ GP G  G PG++   G  G  G  G  G       P G  GL G+PG +G  G+KG+KG+ G  G  GDIG  G  G  GL G P   GK G+ G  G                  +IG PGE G +G KG PG  G PG +G+ G  G            L G PG  G  G  G EG +G  G  G  G  G    G++G  G +G  G  GEKGD                                             RGPKG  G  G  G  G  G  G KG S       +IG  GK G  G  GP G  GI GP GP G  G  G  G
Sbjct:  551 LSRKGQKGYPGPQGHPG------------------EPGVRGPEGSPGAKGY-----PGRQGLPGPIGVSGPKGNRGYIGPPGLFGLP---------------------------GADGERGLPGVPGKRGTMGRP------GFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFP-GLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPEGIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRSGKIGEQ--GLQGFIGPVGETGIAGEKGDRGGIGSPGPPGEKGTMGHPGNPGPPGSPGPPGPPGSPGSRGSPGVRGPKGRRGARGPDGPAGEPGLAGTKGPSGIQGKQGLIGPQGKMGERGIPGPNGFPGISGPSGPPGEKGITGNPG 978          

HSP 5 Score: 99.3673 bits (246), Expect = 2.400e-20
Identity = 136/390 (34.87%), Postives = 165/390 (42.31%), Query Frame = 3
Query: 1164 GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPG---ENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGE------------------------PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLH---------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPK---------------GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            G +G +G PG    K   G+ G+PGL G  G  G    KG            ++G  G  G  G PG+ G  G+ G  G  G +G  G +G SGPKGN                            RG  G PGL G+PG   E G  GV G++G MG  G  GD G+ G  G DG  GE                        PG  G++GL G  G+ G KG KG +G PGI G+ G QG+ G+ GL G PG  G  G  G  GD+G                 GP G++GP      GIKG  G  G  G  G+ G  G +               G  G PGI G  G KGE G+ G S  GKIG+ G  G  GP G  GI G +G
Sbjct:  516 GPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSRKG------------QKGYPGPQGHPGEPGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGN----------------------------RGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDKGFAGFPGPPGPEGFPGDIGPPGENGPE-----GIKGKPGARGFPGPRGQPGHEGDEGPIGPPGAPGLEGFPGRKGYPGILGAEGPKGEAGNTGRS--GKIGEQGLQGFIGPVGETGIAGEKG 858          

HSP 6 Score: 83.1889 bits (204), Expect = 2.005e-15
Identity = 101/248 (40.73%), Postives = 124/248 (50.00%), Query Frame = 3
Query: 1458 SGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPK 2132
             G PG   + G KG KG  G+     +N G +GDPGL G+ G  G +  KG+KG  G  G  G+ G  G  G  G  G PG+   QGL G IG  G KG +G  G PG+ G PG  GE    GL G+PG+ G  G PG  GD G  GP G DG  G                         PG+KG+K   GL G+ GE G +G KG  G PGIPG++G +G+ G +GL    G  GK G +G  G K
Sbjct:  506 HGNPGPPGMHGPKGQKGDPGLSPGKAIN-GLKGDPGLPGLTGVPGPLSRKGQKGYPGPQGHPGEPGVRGPEGSPGAKGYPGR---QGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGE---RGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVPGFIGDMGAVGAVGFPGLKGLK---GLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRGKTGVMGKPGDK 743          

HSP 7 Score: 78.1814 bits (191), Expect = 6.909e-14
Identity = 90/242 (37.19%), Postives = 119/242 (49.17%), Query Frame = 3
Query: 1620 LMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE---GDEGLHGPIGDDGPRGT-------------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            + G  G+KGD G S     +GL G+PG  G+ G+ G + +      KG KG PG +G PG+            PG  G  G+PG +   G +GL GPIG  GP+G                     LPG+ G +G MG  G  G+ G+RGP G +GNPG      +           IG +G  G +G  G KGL+G+ G  G  GL G+ G  G+ G  G+IG  G+KG +GLPG PG RG
Sbjct:  514 MHGPKGQKGDPGLSPGKAINGLKGDPGLPGLTGVPGPLSR------KGQKGYPGPQGHPGE------------PGVRGPEGSPGAKGYPGRQGLPGPIGVSGPKGNRGYIGPPGLFGLPGADGERGLPGVPGKRGTMGRPGFPGDFGERGPPGLDGNPGE-----LGAPGPPGVPGFIGDMGAVGAVGFPGLKGLKGLPGNSGESGLKGDKGIQGFPGIPGDIGFQGDKGSQGLPGPPGMRG 732          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col1a2 (collagen type I alpha 2 [Source:NCBI gene;Acc:780175])

HSP 1 Score: 148.673 bits (374), Expect = 1.191e-35
Identity = 169/417 (40.53%), Postives = 203/417 (48.68%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGG---NPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGT---PGPEGDEGLHGPIGDDGPRGTA----LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +L K GE+G  G+ G  GA G +G  G  G  G  G  G +G PG  G+ G        G  G +G+ G+PG KGEKG+ G  G   NPG  G A       +  + G+ G  G  G  G RG  GE G  G  G  G +G PG  G  G KG  G  GPKG SG+PG +   G  G  G  G  G +   RG  G PG  G PG  G  G  G  G++G SG  G  GK G  G  G  G  G+ G QG+ G  G  GEKG+ G  G  G  G  G  G +GA+G+ GLPG  G RGT   PG  G+ G  GP G  G RG +     PG+ GV GE G  G+    G+ GP G +G PG+ GE G  G     G    G +G  G  G  GP G  G RG  GP+G  G VG  G
Sbjct:  406 ELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDG-ARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGP-RGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIGEKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPSGPVGSPGLTGVHGEAGRDGN---PGNDGPPGRDGLPGVKGERGYPG-----GTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAG 812          

HSP 2 Score: 122.479 bits (306), Expect = 1.484e-27
Identity = 168/467 (35.97%), Postives = 202/467 (43.25%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK---PGKQGIKGFKGNVGKSGPKGNSGT---PGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD---------------------IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLP------------------------GIEGEPGDQGEIGAMGLIGLPGESGL-----------RGTPGPEGDEGLHGPIGDDGPRGTALP----GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G+ G  G KG  GAKG+ G  G  G  G  G+ G RG  GE G  G A   G  GV G++G+PG  G  G  G  G+ G  G AG RG  G  G            R G  G +G  GLPG  G  G +GK    G QGI+G  G  G SGP+G  G+   PG     G  G           N ++G QG  G  G PG +GN G +G  GL G +G+KG+                     +GK G+ G+ G  GE G  G  G  G  G  G  G+ GAKG P                        G+ G  G++G+ G  G  G PG  G            RG  GP G  GL GP G  G RG A P    G  G  G  G  G  GE+G +GPKGE+G+PG  G VG  G  G  G +   G  G  G  G  G  G  G  G  GP G+VG  G  G+
Sbjct:  186 GDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAG------------RPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGK----------NGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGARVSRLHYLYAHRGESGPAGPSGLAGPRGAPGERGEAGPAGSTGFAGPPGAAGHTGVKGERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGH 630          

HSP 3 Score: 114.005 bits (284), Expect = 7.488e-25
Identity = 164/484 (33.88%), Postives = 196/484 (40.50%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAG---------------------------VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD---------IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE------------------------------GDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIG---------------DIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            LL +GE G+ GS G  GA    G +G PG  G  G +G  G PG NG+ G   KG AG                            +G  G PG  G KG+TG  G PG  G +               G  G  G +G RG  GE G  G  G  G  G PG +G+ G  G  G  G  G+ G  G                       RGP GD   AG PGE G +G +G  G  G +G  G           G+SG  G  G  GEPG IG  G KG  G+PG+ G KG++G  G  G PG  G  GA G  GL G +G +G  GP                               G+ G  GP+G  GPRG T  PG  G KGE G  G               + G  G  GPKGE G+ G  GE G  G  G + +S +  +  Y   G +GP G  G+ GPRG  G  GE G  G
Sbjct:  101 LLLQGEIGSAGSTGSAGA---AGPRGEPGPPGALGPVGPAGNPGANGVNGA--KGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPS---------------GPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGA-------------------RGPNGD---AGRPGEPGLLGARGLPGFSGSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGFPGPKGPAGEPGKNGDKGSQGPSGNRGAPGPDGNNGAQGPPGLAGNTGDKGEQGPAGAPGFQGLPGPGGAAGELGKHGERGERGAPGESGAAGPLGALGPRGPTGAPGSDGAKGEPGAAGLNGALGPSGPGGIPGERGAAGVPGPKGEKGDAGHSGEYGNPGRDGAR-VSRLHYL--YAHRGESGPAGPSGLAGPRGAPGERGEAGPAG 539          

HSP 4 Score: 102.064 bits (253), Expect = 2.892e-21
Identity = 135/380 (35.53%), Postives = 167/380 (43.95%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRG---FPGENGIKGVA----VKGEAGVQGSQGMPGY------KGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPG------ILGKIGTSGKPGKQGIKGFKGNVG---KSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENG------NIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---------KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGV----KGEMGLIGDIGEKGDRGPKGE 2015
            +RG KG  G  G PGA G +G  G  G  G  G  G RG    PG NG  G A      G AG+ G  G  G+      +G +G++G  G PG  G  G +G  G                +G+ GE G  G PG      +LG +G SG PG +G +G  G  G   +SGP G +G+ G                        GP G PGL G+ GE G      N G  G  GL G+ GE+G  G +G  G  G +G PG +G  G  G  G+PG           G +G  G  G  G+ G+ GE GA GL G  G +GL+G PGP G  G  GP G +GP G   P         +G  G  G IG  G RGP G 
Sbjct:  558 ERGPKGPKGESGSPGALGAVGSHGPAGPNGPAGTTGPRGDGGAPGANGFPGPAGRTGAPGPAGIVGPSGATGHPGKDGPRGPRGDSGPVGRPGEQGIGGPQGLIG---------------EKGSSGESGPAGPPGASGPSGVLGALGISGLPGARGERGTPGGPGANGESGPAGPAGSAGSRGPS-------------------GPVGSPGLTGVHGEAGRDGNPGNDGPPGRDGLPGVKGERGYPGGTGPAGSLGAVGAPGAVGPSGKSGNRGEPGPVGHAGAVGPAGPRGPSGQQGTRGDKGEAGERGARGLDGRKGHNGLQGLPGPAGSPGETGPAGSNGPSGPRGPAGPSGPPGKEGRSGHNGPIGPVGLRGPAGH 903          

HSP 5 Score: 85.1149 bits (209), Expect = 5.097e-16
Identity = 90/232 (38.79%), Postives = 107/232 (46.12%), Query Frame = 3
Query: 1590 GNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGT---------------------KGAKGLPGIEGEPGD---QGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G IG  G  G  G +G +G+ G  G LG  G  G PG  G+ G KG  G PG  G                      +G  G PG+ G  GD   +GE G+ G  G  G SG  G  GP G+ G  GP G+ G RG      LPG  G  G MG  G  G  G  G +G NG+ G PGE G+ G  G  G S  G  G  G  G  GP+G+EG  GP G  G  GE G +G+
Sbjct:  105 GEIGSAGSTGSAGAAGPRGEPGPPGALGPVGPAGNPGANGVNGAKGAAGLPGVGGAPGLPGPRGIPGPPGPSGPAGARGLSGDPGVAGGKGDTGAKGEPGSAGPSGPAGPSGEEGRRGPNGEAGSSGPAGNAGIRGVPGTRGLPGPDGRAGGMGAPGSRGASGPAGARGPNGDAGRPGEPGLLGARGLPGFS--GSTGPAGKEGPAGPQGIEGRSGPAGASGPRGEPGSIGF 334          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000010623.1 (collagen type VII alpha 1 chain [Source:NCBI gene;Acc:100489404])

HSP 1 Score: 145.591 bits (366), Expect = 1.762e-34
Identity = 160/425 (37.65%), Postives = 206/425 (48.47%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQ------------PGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGI---------KGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++GEKG  G +G PGA G  G+ G         D G RG PGE G KG        GE G +G +G PG++G KG+ G  G PG  G  G  G                    G RG+ G+ G PG  GK  T G PG +G KG +G  G  GPKG+ G  G+                      RGP G  G+ G PG  G+ G +G  GL G +G+KG+ G+ G+ G+ G  G PG+IG++G +G+ G+            PG+ G +G +GLPG  G  G++G+ G  G  G  G  G  GT G  GD G  GP G  G  GT    + G KGE G  GD GE G +G KGE G  G+PGE G+         +GE GD+G    G+ G+ G  G  G  GL+G  G  G  G  G+ GK G
Sbjct: 1553 QKGEKGEAG-EGFPGAAGRTGDPG---------DRGPRGPPGEQGTKGDRGAPGQDGERGEKGERGPPGFQGLKGSPGQNGLPGPSGPIGPSGGL------------------GPRGDKGDQGAPGEPGK-STLGLPGGKGDKGSQGPAGPEGPKGSRGDSGEKG-------------------ERGPPGF-GIPGQPGAKGDQGERGNVGLAGKTGQKGEPGEPGQNGEPGKSGPPGQIGLRGKEGDRGEKGDEGTPGESGIPGKNGERGLRGLPGQRGLSGEKGDSGDPGESGRNGTPGAPGTKGERGDPGTQGPQGPQGKPGTVESVVAGAKGEKGDAGDPGEHGMKGAKGEAGANGLPGERGLEGLRGPPGPRGETGDRGTP--GEKGERGPPGVDGRNGLDGKPGQPGSPGQRGDAGKQG 1926          

HSP 2 Score: 133.65 bits (335), Expect = 8.581e-31
Identity = 163/432 (37.73%), Postives = 207/432 (47.92%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGE--------------KGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXR--QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDD------GPRGTALPGIKGVKGE------MGLIGDIGEKGDRGPKGENGNP---GIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++GE G  G+ G PG+ G  G  G P   G KG  G RG+PGE G       G +G +G +G+PG  GE               G  GI G PG  G  G  G  G  G  G  G  G  G+  +G +GE GE GLPG +   G  G+PG  G  G +G  G  GP G SG  G+    G      +           G  GDPG  G  G  G  G KG++G  G  GE+G+ G+ G  G  GL G PG+ G+ G  G IG  G  G +G KG  G  GEPG          +GLPG  G +G+ GP G EG  G  GD       GP G  +PG  G KG+      +GL G  G+KG+ G  G+NG P   G PG++G++G+ GD+G     G  G+ G  G  G +GL G+ G RG  G  G+ G  G
Sbjct: 1387 QKGETGDPGTDGIPGSPGRPGNPGTPASPGSKGSQGERGYPGERG-----SPGPSGPKGEKGVPGEPGEVINGGGGIPGRKGEPGIPGIPGQPGTPGQRGIPGTPGPPGPEGPSGSSGLPGQSVKGEKGERGERGLPGSVDGAGGKGEPGSPGSPGAQGQAGPRGPTGLSGQKGEKGEAGEGFPGAA-----------GRTGDPGDRGPRGPPGEQGTKGDRGAPGQDGERGEKGERGPPGFQGLKGSPGQNGLPGPSGPIGPSGGLGPRGDKGDQGAPGEPGKS-------TLGLPGGKGDKGSQGPAGPEGPKGSRGDSGEKGERGPPGFGIPGQPGAKGDQGERGNVGLAGKTGQKGEPGEPGQNGEPGKSGPPGQIGLRGKEGDRGEKGDEGTPGESGIPGKNGERGLRGLPGQRGLSGEKGDSGDPG 1795          

HSP 3 Score: 112.079 bits (279), Expect = 3.557e-24
Identity = 141/426 (33.10%), Postives = 180/426 (42.25%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGN--------VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV------KGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPG------------DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMG--------------------------LIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIG-----DKGLSVIG 2090
            A K  ++GE G  G  G PG  G              G IG RG  G+ G      KG+ G  G  G+PG  GE+G  G+ G  GL G                     E G  G+ GE G  G PG  G  G  G PG QG +G +G          G  G KG++G PG+  +                   +G +G+ G  G+PGE G  G+      +GE G  G  GEKG+ G  G  G++GL G+PG+ G  G +G+ G+ G+ G  G  GL G +G PG             QGE G  G  G  GE G  G  G +GD+G  GP G DG       G KG +GE G                          L G  G KGDRG +G  G  G PGE+G +GE G     +K L ++G
Sbjct: 1716 AGKTGQKGEPGEPGQNGEPGKSG------------PPGQIGLRGKEGDRG-----EKGDEGTPGESGIPGKNGERGLRGLPGQRGLSG---------------------EKGDSGDPGESGRNGTPGAPGTKGERGDPGTQGPQGPQGKPGTVESVVAGAKGEKGDAGDPGEHGM-------------------KGAKGEAGANGLPGERGLEGLRGPPGPRGETGDRGTPGEKGERGPPGVDGRNGLDGKPGQPGSPGQRGDAGKQGDPGRDGLPGLRGEQGPPGLIGPVGPPGIPGKQGEDGKPGFNGKNGEDGTPGEDGRKGDKGDVGPAGRDG-----RDGQKGTQGEPGSVGPAGPPGVPGNPGPIGPPGQGIPGLAGQAGSKGDRGEQGAKGEQGRPGEMGARGEPGSTANVEKSLGILG 2079          

HSP 4 Score: 109.383 bits (272), Expect = 1.989e-23
Identity = 168/543 (30.94%), Postives = 223/543 (41.07%), Query Frame = 3
Query:  999 KRGEKGT--VGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKM-AXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKG------EKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPG------------DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMG--------------------------LIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIG-----DKGLSVIG-------------------------KI-------------GKYGTIGNTGPKGLEGIRG-------------------PRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            ++GE+G    G  G PGAKGD GE+G  G  G+ G  G  G PG+NG  G       + ++G+ G +G +G  G  GE G  G  G  GL G                          G RG  GE G  G  G+ G +G PG  G KG +G+ G  GP+G  G PG + ++      +         +  +G +G+ G  G+PGE G  G++G      E G  G  GEKG+ G  G  G++GL G+PG+ G  G +G+ G+ G+ G  G  GL G +G PG             QGE G  G  G  GE G  G  G +GD+G  GP G DG       G KG +GE G                          L G  G KGDRG +G  G  G PGE+G +GE G     +K L ++G                         KI             G+ GT+G  G +G +G RG                   P GP G  G+ GK G                  +PG+PG+ G
Sbjct: 1686 EKGERGPPGFGIPGQPGAKGDQGERGNVGLAGKTGQKGEPGEPGQNGEPGKSGPPGQIGLRGKEGDRGEKGDEGTPGESGIPGKNGERGLRGLP------------------------GQRGLSGEKGDSGDPGESGRNGTPGAPGTKGERGDPGTQGPQGPQGKPGTVESVVAGAKGEKGDAGDPGEHGMKGAKGEAGANGLPGERGLEGLRGPPGPRGETGDRGTPGEKGERGPPGVDGRNGLDGKPGQPGSPGQRGDAGKQGDPGRDGLPGLRGEQGPPGLIGPVGPPGIPGKQGEDGKPGFNGKNGEDGTPGEDGRKGDKGDVGPAGRDG-----RDGQKGTQGEPGSVGPAGPPGVPGNPGPIGPPGQGIPGLAGQAGSKGDRGEQGAKGEQGRPGEMGARGEPGSTANVEKSLGILGIKVASLKDLMDTIDDGSGRPITAQMKIKGEPGVPGEKGAPGREGTMGFPGERGQKGERGDLGPAGPQGPPGRAIGERGPEGPSGQTGDPGKPG------------------IPGIPGKAG 2181          

HSP 5 Score: 105.145 bits (261), Expect = 4.943e-22
Identity = 144/456 (31.58%), Postives = 195/456 (42.76%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGP--QGDPGLAGIPGENGNIGVKGEKGLMGI------------SGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI-----------------------------EGEPGDQGEIGAMGLIGLPGESGLRGTPGP---------------------------------------EGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGD----------IGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG 2075
            ++G++GT G  G PG  G+                G RG PG+ G+ G        GE+G  G+ G PG KGE+G+ G  G  G  G          K    +    G  G +G+ G+ GE G+ G  G+ G +G PG++G++G +G  G  G  G+ GTPG+   +G  G  G  G+ G+      P  +GD G  G PG +G  G++GE+G  G+             GE G  G +GK G+DG  GE G+ G +G  G  G+ G  G KG +G PG                               G  GD+GE GA G  G PGE G RG PG                                        +G+ G+ G  G  G  GT   PG +G KGE G +G           IGE+G  GP G+ G+PG PG  GI G+ G+ G
Sbjct: 1754 EKGDEGTPGESGIPGKNGER---------------GLRGLPGQRGLSGEKGDSGDPGESGRNGTPGAPGTKGERGDPGTQGPQGPQG----------KPGTVESVVAGAKGEKGDAGDPGEHGMKGAKGEAGANGLPGERGLEGLRGPPGPRGETGDRGTPGEKGERGPPGVDGRNGLDGKPGQPGSPGQRGDAGKQGDPGRDGLPGLRGEQGPPGLIGPVGPPGIPGKQGEDGKPGFNGKNGEDGTPGEDGRKGDKGDVGPAGRDGRDGQKGTQGEPGSVGPAGPPGVPGNPGPIGPPGQGIPGLAGQAGSKGDRGEQGAKGEQGRPGEMGARGEPGSTANVEKSLGILGIKVASLKDLMDTIDDGSGRPITAQMKIKGEPGVPGEKGAPGREGTMGFPGERGQKGERGDLGPAGPQGPPGRAIGERGPEGPSGQTGDPGKPGIPGIPGKAGEPG 2184          

HSP 6 Score: 96.2857 bits (238), Expect = 2.076e-19
Identity = 118/339 (34.81%), Postives = 155/339 (45.72%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENG---------NIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKI--------------GIQGLKGEIGQPGEKG------------TKGAKGLPG--IEGEPGDQGEIGAMGLI---------GLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            QG +G+ GE         +G++G+P            G +GP G +G  G     G  G +G  G    S   +G  GDPG  GIPG  G         + G KG +G  G  GE+G  G SG  G+ G+ GEPG++              GI G+ G+ G PG++G              G+ GLPG  ++GE G++GE G  G +         G PG  G +G  GP G  GL G  G+ G  G   PG  G  G+ G  G  G  G++G KG+ G PG  GE G KGE G  G   + G  G+ G  G +GP G  G  GPRG  G  G  G+ G
Sbjct: 1336 QGEKGQKGE---------LGSAGRP------------GATGPPGEAGRNGIPGPPGPVGPRGPPGEGTASRGQKGETGDPGTDGIPGSPGRPGNPGTPASPGSKGSQGERGYPGERGSPGPSGPKGEKGVPGEPGEVINGGGGIPGRKGEPGIPGIPGQPGTPGQRGIPGTPGPPGPEGPSGSSGLPGQSVKGEKGERGERGLPGSVDGAGGKGEPGSPGSPGAQGQAGPRGPTGLSGQKGEKGEAGEGFPGAAGRTGDPGDRGPRGPPGEQGTKGDRGAPGQDGERGEKGERGPPGFQGLKGSPGQNGLPGPSGPIGPSGGLGPRGDKGDQGAPGEPG 1653          

HSP 7 Score: 83.9593 bits (206), Expect = 1.185e-15
Identity = 137/446 (30.72%), Postives = 168/446 (37.67%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV---------KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLA---------------GIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG---LIGEPGKI-----------------------------------GIQGLKGEIGQPGEKGTKGAKGLPG------------------------------------IEGEPGDQGEIGA---MGLIGLPGESGLRGTPG-------------PEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDR 2000
            GE G  G+ G PG KG+            +GD G +G  G  G  G            KG+AG  G  GM G KGE G  G+ G  GL G  G  G +G  G+            +G  GE GE G PG+ G+ G  GKPG+ G  G +G+ GK G  G  G PG                       RG QG PGL                G PG NG  G  G  G  G  G+KGD+G +G+ G+DG     GEPG +                                   G QG KGE G+PGE G +G  G                                       I+GEPG  GE GA    G +G PGE G +G  G               G+ G  GP G  G  G   PGI G+ G+ G  G+ G+ GD+
Sbjct: 1795 GESGRNGTPGAPGTKGE------------RGDPGTQGPQGPQGKPGTVESVVAGAKGEKGDAGDPGEHGMKGAKGEAGANGLPGERGLEGLRGPPGPRGETGD------------RGTPGEKGERGPPGVDGRNGLDGKPGQPGSPGQRGDAGKQGDPGRDGLPGL----------------------RGEQGPPGLIGPVGPPGIPGKQGEDGKPGFNGKNGEDGTPGEDGRKGDKGDVGPAGRDGRDGQKGTQGEPGSVGPAGPPGVPGNPGPIGPPGQGIPGLAGQAGSKGDRGEQGAKGEQGRPGEMGARGEPGSTANVEKSLGILGIKVASLKDLMDTIDDGSGRPITAQMKIKGEPGVPGEKGAPGREGTMGFPGERGQKGERGDLGPAGPQGPPGRAIGERGPEGPSGQTGDPGK--PGIPGIPGKAGEPGEQGKAGDK 2192          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: COL5A1 (collagen type V alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2209])

HSP 1 Score: 142.124 bits (357), Expect = 1.184e-33
Identity = 200/722 (27.70%), Postives = 287/722 (39.75%), Query Frame = 3
Query: 1320 RQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGD---PGLAGIPGENGNIGVKGEKGLMGISGEKG-------------DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIG------------DDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPG------IP-----GEVGIKGEIGD-------------------------------------------KGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQV--------KIDAVSRMKTV------LQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEA-VWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYP-HISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCM--LGANIYPACFV 3185
            R   RG  G +GL    G+ G  G PG  G+KG  G++G  GP+G  G+PG +   G +G  GS G +G      GP+GD    GL G+PGE G+ G  G +G +G  G +G             +IG  G  G+DG  G  G+ G  G  G +G  GEKG  G  GLPG +G PG +G  G  GL   PG  G +G  GP G +G+ GP+G            +DG +G+   G  G +G+ GL G   +KGD GP+G  G PG      +P     GE G++G  G                                            KG    G IG  G  G  G KG  G+ GP+GP G  GE G  G                       G+ G              I    I       + I+ +QV         +D    M+ +      L+       +   +   P  +C+D+ L    ELP+   W+DPN+G S DSFK  C    +    E      +C+    ++        P ++  +W SE +   L+ Y      G P  + Q+ F+++ S   +Q + + C +S+ + D   N     Y  A +    N  ++S                  ++N  SI     + D C  K     T + L T+K +  PIVD     FND G  +   G  + P CF+
Sbjct:  387 RLALRGPSGPMGL---TGRPGPLGSPGPSGLKGESGDLGPQGPRGPQGSPGPLGKPGRRGRAGSDGARGMPG-QTGPKGDRGFDGLGGLPGEKGHRGPAGPQGPIGYPGPRGVKVRSVGIFLFHGEIGPPGPRGEDGPEGPKGRGGPSGEIGPLGPGGEKGDPGPAGLPGKDGPPGLRGFTGERGL---PGPIGEKGPQGPAGRDGIQGPVGLPGPAGPVGPPGEDGDKGSD--GEPGPRGQQGLFG---QKGDEGPRGFAGPPGPVGLQVMPTNIANGESGLEGPPGKTGPIGPQGPPGKPGPEGLRGIPGPVVSSSLKSYDCLSSDPQCVKGYGHPGLIGLIGPPGEQGEKGDRGLPGPQGPHGAKGEQGPTGPK---------------------GESGIPGPPGPPGPPGEVIQPLPIHSSKRTRRSIDASQVVDDGNADNYMDYADGMEEIFGSLNSLKQEIEQMKHPLGNQQNPARTCKDLLL-CHPELPDGEYWIDPNQGCSRDSFKVFCN---FTAGGE------SCIFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSY--VDSNGNPIGVVQMTFMKLLSASVKQNITYNCYQSVAWHDATTNS----YDKAIRFLGSNDEEMS------------------YDNNPSI---RAIMDGCASKKGYQKTVLELDTSKVEQAPIVDI---MFNDFGDPVQKFGFEVGPVCFM 1035          

HSP 2 Score: 104.375 bits (259), Expect = 4.813e-22
Identity = 125/355 (35.21%), Postives = 154/355 (43.38%), Query Frame = 3
Query: 1197 KGEKGNTGIGGNPGLLG---------------FAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPG----KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV---------GIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGL 2174
            +G  G  G+ G  GL G                 G      V     Q     +  R   RG  G +GL    G+ G  G PG  G+KG  G++G  GP+G  G+PG +   G                 RG  G  G  G+PG+ G  G +G  GL G+ GEKG  G +G  G  G  G  G     +GI    GEIG PG +G  G +   G +G  G  GEIG +G    PG  G +G PGP G  G  GP           PG++G  GE GL G IGEKG +GP G +   GI G V         G  GE GDKG     G  G+ G  G  G +G  G  GP GP+GL
Sbjct:  331 RGPPGRAGLPGADGLPGPPGTMLMLPFRFSGGGDGGSKGPQVSAQESQAQAILQQARLALRGPSGPMGL---TGRPGPLGSPGPSGLKGESGDLGPQGPRGPQGSPGPLGKPG----------------RRGRAGSDGARGMPGQTGPKGDRGFDGLGGLPGEKGHRGPAGPQGPIGYPGPRGVKVRSVGIFLFHGEIGPPGPRGEDGPE---GPKGRGGPSGEIGPLG----PG--GEKGDPGPAGLPGKDGP-----------PGLRGFTGERGLPGPIGEKGPQGPAGRD---GIQGPVGLPGPAGPVGPPGEDGDKGSDGEPGPRGQQGLFGQKGDEGPRGFAGPPGPVGL 643          

HSP 3 Score: 94.7449 bits (234), Expect = 4.824e-19
Identity = 132/415 (31.81%), Postives = 164/415 (39.52%), Query Frame = 3
Query: 1143 VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGT---PGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGE-------------NGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGL---------------PGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-LPGIKGVK--------GEMGLIGDIGE------------------KGDRGPKGEN------------------GNPGIPGEVGIKGEIGDKGLSVI----GKIGKYGTIGNTGPKGLEGI 2147
            +A++G +G  G  G PG  G  G +G+ G  G LG                         QG RG  G    PG LGK G  G+ G  G +G  G  G  G +G  G    PG+                     +RGP G  G  G PG              +G IG  G +G  G  G KG  G SG++G  G  GE G  G  GL G+ G PG +G  G +GLPG  GE G QG  G  G+ G                 G+ G  G PGP G +GL G  GD+GPRG A  PG  G++        GE GL G  G+                  +G  GP   +                  G+PG+ G +G  GE G+KG   +    G  G  G  G TGPKG  GI
Sbjct:  388 LALRGPSGPMGLTGRPGPLGSPGPSGLKGESGDLG------------------------PQGPRGPQGS---PGPLGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLGGLPGEKG-------------------HRGPAGPQGPIGYPGPRGVKVRSVGIFLFHGEIGPPGPRGEDGPEGPKGRGGPSGEIGPLGPGGEKGDPGPAGLPGKDGPPGLRGFTGERGLPGPIGEKGPQGPAGRDGIQGPVGLPGPAGPVGPPGEDGDKGSDGEPGPRGQQGLFGQKGDEGPRGFAGPPGPVGLQVMPTNIANGESGLEGPPGKTGPIGPQGPPGKPGPEGLRGIPGPVVSSSLKSYDCLSSDPQCVKGYGHPGLIGLIGPPGEQGEKGDRGLPGPQGPHGAKGEQGPTGPKGESGI 756          

HSP 4 Score: 80.4925 bits (197), Expect = 1.194e-14
Identity = 76/217 (35.02%), Postives = 97/217 (44.70%), Query Frame = 3
Query: 1638 EKGDIGKSGKLGKDGLIGEPGKIGIQGLK---------------------------GEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM---GLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            E+G  G++G  G DGL G PG + +   +                             +   G  G  G  G PG  G PG  G  G  G +G  G  G +G+PGP G  G  G  G DG RG  +PG  G KG+    GL G  GEKG RGP G  G  G PG  G+K       +  +G    +G IG  GP+G +G  GP+G  G  GE+G +G
Sbjct:  330 ERGPPGRAGLPGADGLPGPPGTMLMLPFRFSGGGDGGSKGPQVSAQESQAQAILQQARLALRGPSGPMGLTGRPGPLGSPGPSGLKGESGDLGPQGPRGPQGSPGPLGKPGRRGRAGSDGARG--MPGQTGPKGDRGFDGLGGLPGEKGHRGPAGPQGPIGYPGPRGVK-------VRSVGIFLFHGEIGPPGPRGEDGPEGPKGRGGPSGEIGPLG 537          

HSP 5 Score: 71.633 bits (174), Expect = 7.085e-12
Identity = 126/405 (31.11%), Postives = 156/405 (38.52%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILG----KIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKG---EKGLMGISGEKGDIGKSGKLGKDGLI---------------------GEPGKIGIQGLKGEIGQPGEKGTKG--------------AKGLPGIEGEPGDQGE------------------------------------------IGAMGLIGL------PGESGLRGTPGPEGDEGLHGPIGDDGPRGTA 1931
            +L  RG  G +G  G PG  G  G  GL G+ G+ G  G RG  G  G  G    +G AG  G++GMPG  G KG+ G  G  GL G                     E G +G  G  G IG PG  G     +G     G+ G  G +G  G  GPKG  G  G++   G                  G +GDPG AG+PG++G  G++G   E+GL G  GEKG  G +G+ G  G +                     GEPG  G QGL G+ G  G +G  G              A G  G+EG PG  G                                            G  GLIGL       GE G RG PGP+G  G  G  G  GP+G +
Sbjct:  387 RLALRGPSGPMGLTGRPGPLGSPGPSGLKGESGDLGPQGPRGPQGSPGPLGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLGGLPG---------------------EKGHRGPAGPQGPIGYPGPRGVKVRSVGIFLFHGEIGPPGPRGEDGPEGPKGRGGPSGEIGPLGPG----------------GEKGDPGPAGLPGKDGPPGLRGFTGERGLPGPIGEKGPQGPAGRDGIQGPVGLPGPAGPVGPPGEDGDKGSDGEPGPRGQQGLFGQKGDEGPRGFAGPPGPVGLQVMPTNIANGESGLEGPPGKTGPIGPQGPPGKPGPEGLRGIPGPVVSSSLKSYDCLSSDPQCVKGYGHPGLIGLIGPPGEQGEKGDRGLPGPQGPHGAKGEQGPTGPKGES 754          

HSP 6 Score: 59.3066 bits (142), Expect = 4.064e-8
Identity = 106/351 (30.20%), Postives = 141/351 (40.17%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRG---------FPGENGIKGVAV-----KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIG-----KSGKLGKDGLIGEPGKI---------------------------------------------GIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR 1859
            +RG  G+ G++G PG  G  G++G  G  G  G+ G RG         +PG  G+K  +V      GE G  G +G  G +G KG  G  G  G LG                          G +G+ G  GLPG  G  G  G  G++G+ G  G  G  GP G  G  G + + G  G  G  G     + ++G  G+PG  G   + G  G KG++G  G +G  G +G      +   G+ GL G PGK                                              G  GL G IG PGE+G KG +GLPG +G  G +GE G  G  G   ESG+ 
Sbjct:  441 RRGRAGSDGARGMPGQTGPKGDRGFDGLGGLPGEKGHRGPAGPQGPIGYPGPRGVKVRSVGIFLFHGEIGPPGPRGEDGPEGPKGRGGPSGEIGPLGPG------------------------GEKGDPGPAGLPGKDGPPGLRGFTGERGLPGPIGEKGPQGPAGRDGIQGPVGLPGPAGPVGPPGE----DGDKGSDGEPGPRG---QQGLFGQKGDEGPRGFAGPPGPVGLQVMPTNIANGESGLEGPPGKTGPIGPQGPPGKPGPEGLRGIPGPVVSSSLKSYDCLSSDPQCVKGYGHPGLIGLIGPPGEQGEKGDRGLPGPQGPHGAKGEQGPTGPKG---ESGIP 757          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col6a3 (collagen, type VI, alpha 3 [Source:MGI Symbol;Acc:MGI:88461])

HSP 1 Score: 159.844 bits (403), Expect = 7.078e-39
Identity = 138/435 (31.72%), Postives = 171/435 (39.31%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEA-GVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQG---------------------------------EIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +RG++G +GS G  G  G+                G+RG+PG+ G  G        G QG QG PG +G KG+ G                                   G +GE+GEIGL G+ G+ G  G PG  G KG  G  G  GPKG+                            +G +GD G+ G PG++G      +    G  GE GDIG  G  G+DG+ G PG  G  G  G  G  G KG +G  G PG EGE G +G                                 E G  G +G  GE G    PGP+G       IG+ GPRG          G+ G  G +G +G RG KGE G PG PG  G  GE G                G  GPKG+ G RG  GP G  G+ G  GY
Sbjct: 2036 ERGDRGPIGSIGPKGISGED---------------GYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGF---------------------------------PGEKGELGEIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGD----------------------------KGERGDVGIRGDPGDSGR-----DSQQRGPKGETGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQGPPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPG---EPGPKGS------IGNRGPRGET--------GDDGRDG-VGSEGRRGKKGERGFPGYPGPKGTPGEPGAD--------------GPPGPKGIRGRRGNSGPPGATGQKGDPGY 2357          

HSP 2 Score: 134.42 bits (337), Expect = 3.775e-31
Identity = 111/318 (34.91%), Postives = 145/318 (45.60%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGK--MAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL--KGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTAL 1934
            G++G  GS+G PG KG++G            +IG  G  GE G KG+      KG  G +G +G  G KGE+G+ GI G+PG  G                     +  ++G +GE G+IG  G+ G+ G  G PG  G  G  G  G +G KGN G PG+     +                   G QG PG  G  G  G  G +G  G +G  GE G+ G  G +G  G  GE G  G  G+  +G  G+ GE+G  G  G  G  GEPG  G  G  G+ G  G SG  G  G +GD G  GP G  G RG ++
Sbjct: 2086 GQRGVKGSRGFPGEKGELG------------EIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSG--------------------RDSQQRGPKGETGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQGPPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGSIGNRGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRRGNSGPPGATGQKGDPGYPGPSGHKGNRGDSV 2371          

HSP 3 Score: 125.176 bits (313), Expect = 2.518e-28
Identity = 87/223 (39.01%), Postives = 113/223 (50.67%), Query Frame = 3
Query: 1608 GEKGLMGI----SGEKGDIGKSGKLGKDGLIGEPGKIG---------------IQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKG----DRGPKGENGN---PGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
             EK   G+    SGE+GD G  G +G  G+ GE G  G               + G +G  G PG++G KG++G       PG++GE+G +GL GL GE G +G PG  G++G  G  GD GP+G      KG +G++G+ GD G+ G     RGPKGE G+    G+PG  GI G  GD         GK G  G  GP G +G RG  G  G  GE G  G
Sbjct: 2022 AEKACCGVPCKCSGERGDRGPIGSIGPKGISGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGF------PGEKGELGEIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGD-----KGERGDVGIRGDPGDSGRDSQQRGPKGETGDIGPMGLPGRDGIPGSPGDP--------GKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRG 2225          

HSP 4 Score: 119.398 bits (298), Expect = 1.500e-26
Identity = 109/304 (35.86%), Postives = 132/304 (43.42%), Query Frame = 3
Query: 1572 GIP----GENGNIGVKGEKGLMGISGEKGDIGKSGKL------------GKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP---GESGLRGTPGPEGDEGLHGPIGDD-------GPRG-------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSV----------------------------------IGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGT 2282
            G+P    GE G+ G  G  G  GISGE G  G  G              G  G  G PG+   +G+KG  G PGEKG  G  GL G++GE GD+G  G+ G  G P   G+ G +G  G  GD G+ G  GD        GP+G         LPG  G+ G  G  G  G  G RGP G  GN G PG+ G +GE G +G                                      G +G+ G  G  GPKG  G RGPRG  G  G  G VG        G  G+KG++G PG PG +GT
Sbjct: 2028 GVPCKCSGERGDRGPIGSIGPKGISGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQ---RGVKGSRGFPGEKGELGEIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKGETGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQGPPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGSIGNRGPRGETGDDGRDG-VG------SEGRRGKKGERGFPGYPGPKGT 2321          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col6a4 (collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:MGI:1915803])

HSP 1 Score: 139.428 bits (350), Expect = 1.160e-32
Identity = 138/360 (38.33%), Postives = 173/360 (48.06%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE---IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            G RG  GE G+ G+      +G+ G +G +G+PG +GE+G  G+ G  G  GF+G                      +GN GE G  GL G  G  G +G  G++G  G +G  G  GP G  G PG     G  G              RG QG PG  G  GE G++G +G  G  G+ G KG +G++G+LG  G  G PG  G +G +G     GQ G+ GT+G  GLPG  G  G  G  G  G +G  GE G RG  GP G  GL       GP G   PG KG KGE G        G  G +GE+GNPG  GE G KG  G +G S  G  G  GT G+ GP G  G +G +G
Sbjct: 1420 GSRGEQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRGEEGCPGVRGPKGARGFSG---------------------EKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLF------GPDGHGYPGRKGRKGEPGF------PGYPGVQGEDGNPGRGGEKGAKGIRGKRGNS--GFPGLAGTPGDQGPPGKMGTKGSKG 1744          

HSP 2 Score: 121.324 bits (303), Expect = 3.901e-27
Identity = 105/264 (39.77%), Postives = 129/264 (48.86%), Query Frame = 3
Query: 1554 GDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIG---------AMGLIGLPGESGLRGTPGPEGDEG-------------------------LHGPIGDDG---PRGTA----LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            GD G+ G PG  G  G +G  GL G  GE+GD G+ G  G  GL GE G  G++G KG  G  GEKG  G +G+ G++GE GD+G  G         + GL GLPG +G RG PG  GD G                          HGP+G+ G   PRG+     LPG+KGV GE G +G  GE G  GP+G  G  G PG  G KG+ G +G   +       G  G  G  G  GP G  G RG +GP G  G  G  G+
Sbjct: 1411 GDDGIRGEPGSRGEQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRGEEGCPGVRGPKGARGFSGEKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLFGPDGH 1674          

HSP 3 Score: 115.931 bits (289), Expect = 1.578e-25
Identity = 139/384 (36.20%), Postives = 167/384 (43.49%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGE---------NGNPGI--------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            D G RG PG  G      +GE G+ G  G PG +G+ G  G  G PGL G               ++G  G  G +G RG  GE G PG  G  G  G+ G +G  G  G  G SG +G +G PG                        GP+G+PGL G PG+ G      +  + G  GEKG  G  G  G  G +GE G +G +G  G  G PG KG  G  G  G  GEPG  G  G  G  G PG  G +G PG +G+ GL GP G  GP G      +G+KGE+G            P GE          G PG+        PG  G KGE G  G    G  G+ G  G  G KG +GIRG RG  G  G  G  G
Sbjct: 1412 DDGIRGEPGSRG-----EQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRG---------------EEGCPGVRGPKGARGFSGEKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPA----------------------GPRGEPGLRGDPGDPGI-----DNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGP-----RGLKGEVG------------PAGERGPRGQQGPRGQPGLFGPDGHGYPGRKGRKGEPGFPGYP--GVQGEDGNPGRGGEKGAKGIRGKRGNSGFPGLAGTPG 1729          

HSP 4 Score: 101.293 bits (251), Expect = 4.892e-21
Identity = 109/314 (34.71%), Postives = 137/314 (43.63%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV--KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE---PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA 1931
            GEKG+ GS+G  G  G           G +G+ G RG PG+ GI  +    KGE G +G QG PG+ G  G  G                                   G RG +G  GLPG+ G +G +G+ G    +G  G+ G  GP+G  G PG                        G +GDPG  G PG  G  G KG  G  G+ GE G  G+ G  G+ G  G+PG  G  G  G  G+ G KG  G  G PG++GE   PG  GE GA G+ G  G SG  G  G  GD+G  G +G  G +G A
Sbjct: 1501 GEKGSSGSRGLTGLPG---------PAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAG---------------------------------SVGPRGSLGRHGLPGLKGVLGETGELGS---RGEPGHPGPQGPRGRQGPPGFF----------------------GQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLFGPDG-HGYPGRKGRKGEPGFPGYPGVQGEDGNPGRGGEKGAKGIRGKRGNSGFPGLAGTPGDQGPPGKMGTKGSKGLA 1746          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col24a1 (collagen, type XXIV, alpha 1 [Source:MGI Symbol;Acc:MGI:1918605])

HSP 1 Score: 134.806 bits (338), Expect = 2.612e-31
Identity = 154/425 (36.24%), Postives = 191/425 (44.94%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQ---------------------GSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL-SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            GE G  G KG  G +GDIG+ G  G  G  G++G  G  GE G +G    +  +GE GV                      G++G PG  G KG  G  G  GL G                  ++G  G +G +G  G+ GLPG+ GK G+ G+ G QG  GF+G  G SG  G +G PG                         P+G PG+AG+PGE G  G  G +G  G+ GE G  G  G  G  G  GEPG  G  G  GE G  G+ G KGA G  G+ GE GD+GE+G  G  G  G  G  G PGPE                    GI G  G+ G +G  G+KG  GP GE G+ G PG VG  G  G +G    +G +G  G  G  G  G  G +G  GP GL G  G+ GY
Sbjct:  850 GEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAG------------------DQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPG-------------------------PRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPE--------------------GIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGYRGHQGQPGPSGLPGPKGEKGY 1211          

HSP 2 Score: 127.487 bits (319), Expect = 4.008e-29
Identity = 152/417 (36.45%), Postives = 204/417 (48.92%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILG---KIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLG---KDGLIGEPG---KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-----------------------------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G RG PG  G KG    +G  G+ G QG  G KGEKGN G  G PGL G AG+ G++GV+G  G +G  G  G  G  GE G  GLPGI G   ++G  G PG +G  G +G  G  G  G +G+ G     G +G  G+ G         G QG  GL G PG +G  G  G+KG MG+ G  G +G+ G++G    +G++G PG   ++G +G KG++G  GE G++G  G  G  G  G +G  GA+G +GL G  G  G PG  G +G  GP G  GP+G                                           +PG++G  G+ G  G+ G++G +GPKGE G+ G  G+ G+ G  G  G+         G  G  GPKGL+G  G  G  G  G+ G  G
Sbjct:  930 VGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPG-------EEGLQGKDGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIP--------GVPGFPGPKGLQGYPGVDGMSGYPGKPGLPG 1331          

HSP 3 Score: 121.709 bits (304), Expect = 2.400e-27
Identity = 167/457 (36.54%), Postives = 206/457 (45.08%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI------PGENGNIGVKGEKGLMG-------------------------------ISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG---EKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-LPGIKG---------------VKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIK---GEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G +G PGAKGD G  G  G  GE G  G  G PGE G++G    G  G  G  G+PG  G+KG  G+ G  G +G                                G++GLPG  G +GT G+ G+ G KG KG VG +G  G+ G PG +   G KG +G++G  G   +  GP+G+PG+ G       PG +G  G KGEKG  G                                 G  G  G  G  G+ G  GEPG  G QG KGE G  G   ++G  G  G PGI G PG  G  G  G  G+ G SG  G PG  G +GL G  G  G  G A  PG +G                KGE GL G  G  G RG +G  G+ G+ G  G+K   GE GD+GL+  G  G  G  G  G  G+ GI GP+GPIG  G  G +G
Sbjct: 1033 GTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGK--DGLKGAPGGSGLPGEDGDKGEMGLPGTAGPVG------------------------------RPGQMGLPGPEGIVGTPGQRGRLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGL-MGPEGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLA--GFQGFPGPRGPEGDAGIVGIVGPKGPIGQRGNTGPLG 1454          

HSP 4 Score: 120.553 bits (301), Expect = 6.222e-27
Identity = 177/515 (34.37%), Postives = 228/515 (44.27%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHP---------GAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--------------NRGPQ------------GDPGLAGIPGENGNIGVKGEKGL------------------------------MGISGEKGDIGKSGKLGK---------DGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEI---GAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----------------ALPGIKGVKGEMGLIGDIGEKGDRGP------------KGENGN------PGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KRG +G  G  G+P         G KGD G        GEKGD G  G  G  G++G       G++G  G+PG +GE G  G+ GN G  G+ G +G  G +GN G KG +G I   G+ GE+G++G  G  G  G  GK G +G +GF G+ G  GP G  G+PG +   G  G  G  G  G +                +RGP             G+PG  G PG+ GNIG  G  G+                              +GI G+ G  G  G LG           G  GE G IG  G  G  G+PG KG  G  G  G++GE GDQG+I   G  G +GLPGE G+ G+ G +G+ G  GP+G  G +G                  LPG+ G +G  G  G  G++G RGP            KGE GN      PG+PG+ G  GE G +G      + G  G  G  G  GP+GL GI G  G +G+ G  G  G
Sbjct:  530 KRGPRGIPGPHGNPGLPGLPGPKGPKGDPGLSPGQAASGEKGDPGLLGLVGPPGLQGA-----KGLKGHPGLPGLRGEHGLPGLAGNIGSPGYPGRQGLAGPEGNPGSKGVRGFI---GSPGEVGQLGPEGERGTPGVRGKKGPKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGVTGSVGPAGPTGPPGAPGPMGLSGSRGPSGIKGDKGEQGVAGEPGEPGYPGDKGNIGSPGPPGIRGKSGPSGQPGDPGPQGPSGPPGPEGFPGDIGIPGQNGPEGPKGHLGNRGPPGPPGLKGTQGEEGPIGPFGELGSRGKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEG 1036          

HSP 5 Score: 109.768 bits (273), Expect = 1.348e-23
Identity = 172/478 (35.98%), Postives = 222/478 (46.44%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXX---------------------XXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFK------------------------GNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKG------------------LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE---GDEGLHGPIGDDGPRG----TALPGIKGVKGEMGL------------IGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G +G  G +G+PG+KG      + G  G  G++G  G  GE G  GV  +G+ G +G QG PG  G++G  G+ G+PGL+G  G  G  GV                      G+ G  G KG+ G QG  GE GE G PG  G IG+ G PG +G  G                          G  G++GP+G  G  G     G  G KG++G +G      GP G+ G  G PG  G +G  G +GL G  G++GDIGK+G+ G  GL GE G  G  G KGE G PG  G +G KG                  LPG+         +GA G  G PG  G RG  GP+   GD+G HG  G+ G +G      LPG  G  GE G+             GD+G  G+ GP+G  G  G+PGE+G++G  G +G S + G+ G  G  G  G  G  G  GPRG  G  GE G
Sbjct:  619 GRQGLAGPEGNPGSKG------VRGFIGSPGEVGQLGPEGERGTPGV--RGKKGPKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGVTGSVGPAGPTGPPGAPGPMGLSGSRGPSGIKGDKGEQGVAGEPGEPGYPGDKGNIGSPGPPGIRGKSGPSGQPGDPGPQGPSGPPGPEGFPGDIGIPGQNGPEGPKGHLGNRGPPGPPGLKGTQGEEGPI----GPFGELGSRGKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGAPGPMGPLGLPGL---------VGARGAPGSPGPKGQRGPRGPDGLAGDQGGHGAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIAGLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEG 1075          

HSP 6 Score: 100.908 bits (250), Expect = 5.726e-21
Identity = 128/345 (37.10%), Postives = 164/345 (47.54%), Query Frame = 3
Query:  990 KLLKRGEKGTVG------SKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGI---------------------------QGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG 1925
            +L K+G+KG VG      S+G PG+ G+ G KG  G +G  G +G  G  GE GI G   +G  G  G  G+PG KGEKG  G           G  G  G  G  G++GE GE G +G +G MG  GL G  G+ G  G+PG QG +G KG  G  GP+G  G PG                         P G PG+ G+PG  G  G++G  G+ G+SG  G  G  GK G  G+ G PG+ G+                           QGL G+ G PG++G +G  G  G+ G PG +G+ G  G  GL G  G  G  GPEGD G+ G +G  GP G
Sbjct: 1133 RLGKKGDKGQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGY--RGHQGQPGPSGLPGPKGEKGYPGEDST-----VLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQQGPPGEPGDQGGQGPKGERGSEGPQGKRGVPG-------------------------PSGKPGIPGVPGFPGPKGLQGYPGVDGMSGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQPGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGPKGPIG 1445          

HSP 7 Score: 93.5893 bits (231), Expect = 1.128e-18
Identity = 94/229 (41.05%), Postives = 118/229 (51.53%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGN---------TGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            RGP+G PG  G PG  G  G KG KG  G+S  +   G+ G  G  GL+G PG  G +GLKG  G PG +G  G  GL G  G PG  G  G  G  G PG  G+RG  G  G+ G  GP G+   RGT  PG++G KG  G  G  G+ GDRGP G +G+PG+     + G        V G +G  G  G          +G +G  GI+G +G  G+ GE G+ GY
Sbjct:  531 RGPRGIPGPHGNPGLPGLPGPKGPKGDPGLSPGQAASGEKGDPGLLGLVGPPGLQGAKGLKGHPGLPGLRGEHGLPGLAGNIGSPGYPGRQGLAGPEGNPGSKGVRGFIGSPGEVGQLGPEGE---RGT--PGVRGKKGPKGRQGFPGDFGDRGPAGLDGSPGL-----VGGTGPPGFPGVTGSVGPAGPTGPPGAPGPMGLSGSRGPSGIKGDKGEQGVAGEPGEPGY 749          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col27a1 (collagen, type XXVII, alpha 1 [Source:MGI Symbol;Acc:MGI:2672118])

HSP 1 Score: 134.42 bits (337), Expect = 3.008e-31
Identity = 164/415 (39.52%), Postives = 211/415 (50.84%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGE---------AGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----TALPGIK---GVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE+G +G +G PG +GD G  G  G KG++GD G  G  GE G +G+  KGE          GV G +G PG +GEKG  G  G  G  G+ G  G  G  G  G  G KG      +RG +G  G PG   ++G  G+PG  G  G KG  G  GP G  G  G     G                +RG +G+PG  G PG+ G  G++GE       G++G  G  G  G+ G  G  G+ G +G  G+ G  G +GT+G +GLPG  G  G QG  G  G  G+PG  G  G  G +G++G  GP+G  G RG      LPG +   G KGE GL G +G  G RG +G  G PG  GE G KG+ GD G +   G  G +G  G  G  G +GI+GPRGP GL+G+ G +G
Sbjct: 1162 GEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPDGEHGEKGQEGL--KGEDGSPGPPGITGVPGREGKPGKQGEKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKG------SRGTLGPTGAPG---RMGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGE------PGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQGNDGDPGPVGPAGRRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMGFPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIG 1559          

HSP 2 Score: 114.005 bits (284), Expect = 6.771e-25
Identity = 143/357 (40.06%), Postives = 188/357 (52.66%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLG-FAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSG------TPGKMAXXXXXXXXXXXXXXXXXNV--NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-------TALPGIKGVKGEMGLIGDIGEKGDRG 2003
            ++G++G  G+KGH G  G++G  G PG  G  G  G RG  G  G       G  G QG  G+ GY G KG TG  G PG  G           +G  G  G++G +G +G+RGE G+ G PG  G  G  G+PG+QG  G  G  G+ GPKG+ G       PGK    G +GT+G +G+ G   V   +GP+G  G  GIPG +G  G +G++G     G+ G +G +G+ G  G+ G PG  G  G KGE      +G PG++GT+G  GLPG +GEPG +G+ G  G +G PG +GL G  GP GD G  G  G  GP G          PG+ G  G  G  GD G +GD G
Sbjct: 1235 EKGQRGAKGAKGHQGYLGEMGIPGEPGPPGTPGPKGSRGTLGPTG-----APGRMGAQGEPGLAGYNGHKGITGPLGPPGPKGEKGDQGEDGKTEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGEPGQQGQPGHPGPRGRPGPKGSKGEEGPKGKPGKAGPSGRRGTQGLQGLPGPRGVVGRQGPEGTAGSDGIPGRDGRPGYQGDQG---NDGDPGPVGPAGRRGNPGVAGLPGAQGPPGFKGESGLPGQLGPPGKRGTEGGTGLPGNQGEPGSKGQPGDSGEMGFPGVAGLFGPKGPPGDIGFKGIQGPRGPPGLMGKEGIIGPPGMLGPSGLPGPKGDRGSRGDLG 1583          

HSP 3 Score: 113.62 bits (283), Expect = 7.371e-25
Identity = 145/432 (33.56%), Postives = 180/432 (41.67%), Query Frame = 3
Query: 1152 KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGI---KGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGL------------------------------------IGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-------------ALPGIKGVKGEMGLIGDIGEKGD---RGPKGEN---GNPGIPGEVGIKGEIGDKGL----------SVIGKIGKYGTI---------------GNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KG+ G+   Q   G KG  G  G+ GNPG LG                        R+G++G  G  G PG  G+ G  G PG +G    +GF G VG  GPKG+ G  G +           +         RG  G PG  G  GE G  G+ G  G +G+ G  G +G  G  G  G +G PG  G++GL G +G+PG KG KG +G+PG+ G+PG QG+ G+ GL                                    IG PG++G  G  G  G  GL GP G  GP G                PG KG  G  GL G  GE GD    GP GE    G  G+ GE GI GE GD+G+            +G  G  G I               G  G +G +G RGPRGP G  GE G  G
Sbjct:  660 KGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLG------------------------RKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIG-LPGLFGLPGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGSKG 1066          

HSP 4 Score: 112.464 bits (280), Expect = 2.008e-24
Identity = 175/513 (34.11%), Postives = 230/513 (44.83%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFR---------------------GFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVG------------KSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPGENGNIGVKGEK------------------------GLMGISGEKGDIGKSGKLGKD------GLIGEPGKIGIQGLKG------------EIGQPGEKG------------TKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-------------------LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            L ++G KG  G+ GHPG +G  G +G PG KG  G  GF                      G PG +G +G+  V G+ G  G  G PG  GE+G  G+ GNPG +G  G  G  G+ G+ G  G  G  G +G +G MG +G PG+ G  G  G PG  G  GF+G+ G            K GP G +G  G +   G  G +G  G  G    N   G +G PG  G+PG  G +G +G++                        GL G  GE GD G+ G +G+       GL+GEPG +G +G +G             +G PG  G              G++GLPG+ G  G +G  G  G  G  G  GL+G  GP G  G  G  G  G RG +                   LPG  G +G  G +G  GE G +GP G  G PG+PG+ G+KG++G      +G  G+ G IG  G  GLEG  GP GP GL G+ G  G +
Sbjct:  690 LGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRPGFPGDFGERGPPGLDGNPGEIGLPGPPGVLGLIGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGSKGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVGEKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGSKGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGLPGDSGMKGDLGP-----LGPPGEQGLIGQRGEPGLEGDHGPVGPDGLKGDRGDPGPD 1197          

HSP 5 Score: 100.523 bits (249), Expect = 9.235e-21
Identity = 149/406 (36.70%), Postives = 183/406 (45.07%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG---------EIGLPGILGKIG------------TSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRG 2153
            K G +G  G  G  G +GD G  G PG  G +G  G +GFPG  G+ G   KGE G  G  G  G +G  G  G+ G PG++G                         +G+RG MG          +G PG  G IG            + G PG +G KG +G  G  GP G  G+                         +G +G  G  G PG+ G  G  GE+G  G  G  G  G SG  G  GL GEPG  G QG  G  G+ G KG  GA G PG+   PGD G  G +G +G PGE GL G  G  G EG HGP+G D        G+KG +G+ G  G+ GEKG  G KGE+G+PG PG  G+ G          GK GK G  G  G KG +G +G
Sbjct:  914 KPGARGLPGPPGQLGPEGDEGPMGPPGVPGLEGQPGRKGFPGRPGLDGS--KGEPGDPGRPGPVGEQGLMGFIGLVGEPGIVG------------------------EKGDRGVMGPPGAPGPKGSMGHPGTPGGIGNPGEPGPWGPPGSRGLPGMRGAKGHRGPRGPDGPAGEQGS-------------------------KGLKGRVGPRGRPGQPGQQGAAGERGHSGAKGFLGIPGPSGPPGAKGLPGEPGSQGPQGPVGPPGEMGPKGPPGAVGEPGL---PGDSGMKGDLGPLGPPGEQGLIGQRGEPGLEGDHGPVGPD--------GLKGDRGDPGPDGEHGEKGQEGLKGEDGSPGPPGITGVPGR--------EGKPGKQGEKGQRGAKGAKGHQG 1249          

HSP 6 Score: 90.8929 bits (224), Expect = 7.281e-18
Identity = 99/251 (39.44%), Postives = 121/251 (48.21%), Query Frame = 3
Query: 1545 GPQGDPGLAGIPGENGNI---------------------------GVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE------GLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GP   P L G PG  G+                            G  G  G  G  G+KGD G S     DG  G  G  G+ G  G +G+ G KG  GA G PG +G+PG +G  GA G  G  G  G  G PGP+G        GL G  G DG RG  LPG+ G +GEMG  G  G+ G+RGP G +GN   PGE+G+ G  G  GL  IG  G  G +G  GPKG++G+ G  G  GL G+ G+ G
Sbjct:  601 GPTPFPMLMGPPGSKGDCGLPGPPGLPGLPGSPGARGPRGPPGPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRKGHKGHPGAAGHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERG--LPGVPGKRGEMGRPGFPGDFGERGPPGLDGN---PGEIGLPGPPGVLGL--IGDTGALGPVGYPGPKGMKGLMGGVGEPGLKGDKGEQG 844          

HSP 7 Score: 82.8037 bits (203), Expect = 2.250e-15
Identity = 119/361 (32.96%), Postives = 142/361 (39.34%), Query Frame = 3
Query: 1326 GNRGEMGEI------------------------------------------GLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSV----------IGKIGKYGTI------------------GNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  G  G+                                           G PG+       G  G  G+ G  GN G  G KG+ G PG                           G PG  G PG  G+ G KG  G  G  G  GD G     G  G IG PG  G+ G  GE G PG  G +G  G PG    PGD GE G  GL G PGE GL   PGP G  GL G  G  GP G   PG KG+KG MG +G+ G KGD   KGE G PG+ G+ G +G+ G  GL            +GK G  G++                  G+ GP+G++G  G RG  G  G++G  G
Sbjct:  610 GPPGSKGDCGLPGPPGLPGLPGSPGARGPRGPPGPYGNPGPPGPPGAKGQKGDPGLSPGQAHDGAKGNMGLPGLSGNPGPLGRKGHKGHPGAA-------------------------GHPGEQGQPGPEGSPGAKGYPGRQGFPGPVGDPGPK---GSRGYIGLPGLFGLPGSDGERGLPGVPGKRGEMGRPGF---PGDFGERGPPGLDGNPGEIGL---PGPPGVLGLIGDTGALGPVG--YPGPKGMKGLMGGVGEPGLKGD---KGEQGVPGVSGDPGFQGDKGSHGLPGLPGGRGKPGPLGKAGDKGSLGFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPPGQLGPEG 931          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col11a1 (collagen, type XI, alpha 1 [Source:MGI Symbol;Acc:MGI:88446])

HSP 1 Score: 127.872 bits (320), Expect = 3.846e-29
Identity = 249/833 (29.89%), Postives = 338/833 (40.58%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNR-----GPQGDPGLAGI---------PGENGNIGVKGEKG---LMGISGEKGDIGKSGKLGKDGLIGEPG---------------------------KIGIQGLKGE------------------------------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTAL----------PGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGL------------------------EGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEA-VWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            G+ G +G  G  G IG  G PG +G  G  G +G PGE G +G A  G  GVQG  G+PG  G  G+ G  G+ G +G  G +G KG KG NG  G  G  G  G  G  G  G PG  G+ G  G+ G +G +GF G  G  G +G  G PG+    G  G  G  G  G           GPQG PG  G          PGE GN G  GE G   L G  GEKG+ G  G  G  G+ G PG                           + G+ G KGE                               G  G +G KGAKG  G EG PG  G +G  G  G PG  GLRG PGP G++GL G  G DGP G             PG KG KG  GLIG IG  G+                  +GE GD+GL         GT G+ G KG                         +G +G  GP G  G+ G  G  G  G  GE+ +      P    +R T  ++  A + + + S  +  IF       +   +K D +  MK  + + ++           P  +C+D+QL    + P+   W+DPN+G S DSFK  C    +    E      TC+    ++  +     P +   +W SE +   L+ Y  ++     ++ Q+ FL++ +  A Q   + C +S  + DVL    S  Y  A +    N  ++S                  +EN     ++  LYD C  +     T + ++T K D +PI+D  I  F D  +   G  + PACF+
Sbjct: 1055 GSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPA--GRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGLPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGVVGDKGEPGEAGNPGPPGEAGSGGLKGERGEKGEAGPPGAAGPAGIKGPPGDDGPKGNPGPVGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGASGSEGRQGEKGAKGEAGAEGPPGKTGPVGPQGPSGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPLGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGE------------------QGEKGDRGLP--------GTQGSPGAKGDGGIPGPAGPIGPPGPPGLPGPAGPKGNKGSSGPTGQKGDSGMPGPPGPPGPPGEVIQPLPILSPKK-TRRHTESIQGDAGDNILDYSDGMEEIFG------SLNSLKQD-IEHMKFPMGTQTN-----------PARTCKDLQLSHP-DFPDGEYWIDPNQGCSGDSFKVYCN---FTAGGE------TCIYPDKKSEGVRISSWPKEKPGSWYSEFKRGKLLSY-LDVEGNSINMVQMTFLKLLTASARQNFTYNCHQSAAWYDVL----SGSYDKALRFLGSNDEEMS------------------YENNP---HIKALYDGCASRKGYEKTVIEINTPKIDQVPIIDVMINDFGDQNQ-KFGFEVGPACFL 1803          

HSP 2 Score: 80.8777 bits (198), Expect = 7.574e-15
Identity = 79/193 (40.93%), Postives = 95/193 (49.22%), Query Frame = 3
Query: 1380 GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE------------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPR 1922
            G  GKPG  G+ G  G  G  G +G SG  G +   G +G  G  G +G     +G  G  GL G  GE G  G  G KG MG+ G++G++G+ G  G+DG  G  G+ G  G  G  GQ GEKG  G  GLPG  G             PG  GE GA G+ G PG  G RG  GP G  G  GP G  GP+
Sbjct:  713 GPQGKPGLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGV----KGADGVRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 901          

HSP 3 Score: 80.8777 bits (198), Expect = 9.519e-15
Identity = 107/307 (34.85%), Postives = 126/307 (41.04%), Query Frame = 3
Query: 1365 ILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGL------------AGIPGENGNIGVKGE---------------KGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL------KGEIGQPGEKGTKGAKG---------------LPGI---EGEPGDQGEIG---------AMGLIGLPGESGLRGTPGPEGDEGLH-------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV---GIKGEIGDKG 2075
              GK G  G PG QGI G  G  G  G  G  G PG                          QG PGL             G PGE G+ G  G                 G  G  GEKG  G +G+ G  G +G PG  G  G       KGEIG+PG+KG+KG KG                PGI   +GEPG +G+ G         A G  GLPG  GL+G PGP G++G +        P            G  G +G  G IG +G  GD+G  GE GNPG PGE    G+KGE G+KG
Sbjct:  999 AAGKEGAKGDPGPQGISGKDGPAGIRGFPGERGLPGA-------------------------QGAPGLKGGEGPQGPQGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGLPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGVVGDKGEPGEAGNPGPPGEAGSGGLKGERGEKG 1280          

HSP 4 Score: 70.0922 bits (170), Expect = 1.564e-11
Identity = 114/306 (37.25%), Postives = 142/306 (46.41%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGK------SGKLGKDGLIGEPGKIGIQGLKGEIGQPGE------------------KGTKGAKG---------LPGIEGEPGDQ---------------GEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP----GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLA 2303
            RG  G  G  G+PGE+G+ G +G  GL G+ G+KG  G+       G  G DG+ GE G+IG +GL GE G  G                    G +G KG          PG +G PG Q               G  G  GL GLPG  G  G PG EG  G  G +G  GP+G        G+KG  G  GL      KG +G KGE+G PG  G++G+KG+ G+     +G++G  G  G  GPKG  G  G  GP G  GE GK+G  G  G  G  G KG  G PG PG  G    + +A
Sbjct:  577 RGRPGADGGRGMPGESGSKGDRGFDGLPGLPGDKGHRGERGPQGPPGLPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGPPGQPGIGGIDGPQGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGL------KGSKGEKGEDGFPGFKGDMGLKGDRGE-----VGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIA 871          

HSP 5 Score: 58.5362 bits (140), Expect = 5.198e-8
Identity = 139/498 (27.91%), Postives = 178/498 (35.74%), Query Frame = 3
Query: 1110 RGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK------------------------------------LGKDGLIGEPGKIGIQGLKGEIGQP------------GEKGTKGAKGLPGIEGE------------------PGDQ---GEIGAMGLIGLPGESGLR---------------------GTPGPEGDEGLHGPI---------------------GDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----------------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            RG  G +G++G+  KG  G +G  G PG+KG+ G  G  G  G +G                       G  G  G  G  G  G  G  G +G+ GK G+ G  G  G+ GPKG++G PG                        G  G+ G  GI G+ G  G +G  G  G  G +G  GK G                                      GKDGL G PG+ G  G +G+ G P            GE G  G +G PG  G                   PG Q   G+ G  G+ G PGE GL                      G+PG  G  G  GPI                     G+ GP+G A  G  GV+G +GL G  G  G  G  G+ G  G PG+ G KG+ G+ G                          G+ G +G  G+ G +G  G+ GP G  GL G  G+ G N
Sbjct:  760 RGVKGADGVRGL--KGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVG---------------------PRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPG----------------------FPGANGEKGARGIAGKPGPRGQRGPTGPRGSRGARGPTGKPGPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPAGKDGLPGHPGQRGETGFQGKTGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKDGPAGIRGFPGERGLPGAQGAPGLKGGEGPQGPQGPVGSPGERGSAGTAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPA--GRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGLPGPIGLQGLPGPPGEKGEN 1210          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q17RW2|COOA1_HUMAN (Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=9606 GN=COL24A1 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 2.857e-37
Identity = 244/800 (30.50%), Postives = 341/800 (42.62%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMG---EIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV----------------------KGEKGLMGISGEKGDIGKSG---KLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDGPRGTA----------------LPGIKGVKGEMGLIGDI---------GEKGDRGPKGENGNPGIPGEVGI------------KGEIGDKGL-SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQL--SNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEA-VWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTK--MLLSTNKPDMLPIVDY---------RIKYFNDNGKCML 3155
            G +G  G +G PGAKGD+G  G  G  GE G  G  G PGE G++G    G  GV G +G+PG  GEKG  G+ G  G LG +G  G  G +G  G  G++G  G++G++G++G   E+G  G  GKIG SG  G +G +G  G++G  GP G  G PG                       RG QG PG +G+PG  G  G                       +GE+G  G  G KG +G  G     G+ G  GEPG  G QGLKGE G  G KG KGA G  G  G PG QG +G  G+ G  G  G+ G PG   P G +GL G  G  G  G A                 PGI+G KGE GL G           G +GD+GP G+ G  G PGE G+            KG  GD G+  + G  G  G  GNTGP G EGI GP G  G  GE G  G  G +G  G+ G  G  G PG   Q    +  N A + L  SN +  + +  N E  +I+ ++     ++ +  +L S+ +    R +    P   C+D+ L    ++ +   W+DPN G   D+ +  C    +    +T  P ++  +  +  G +                                     Q+NFL + S  A   +   C  +  +             T+ QT          G  L  G+   + +I+      ++    +L D+CK +  G++ K   L  T +P+ LP+++          R  Y + +  C L
Sbjct: 1014 GTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGK--DGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGY----------------------RGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQ----MDINAAIQALIESNTALQMESYQNTEVTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDN----PARICKDL-LNCEQKVSDGKYWIDPNLGCPSDAIEVFCN---FSAGGQTCLPPVSVTKLEFGVGKV-------------------------------------QMNFLHLLSSEATHIITIHCLNTPRW-------------TSTQT---------SGPGLPIGFKGWNGQIFKV---NTLLEPKVLSDDCKIQD-GSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL 1714          

HSP 2 Score: 133.65 bits (335), Expect = 3.592e-30
Identity = 163/409 (39.85%), Postives = 204/409 (49.88%), Query Frame = 3
Query: 1011 KGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE------GLHGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            KGT G +G  GA G++G +G PG+KG  G+ G  G  GE G +G    +   G  G+ G  GM G  GEKG  G  G  G  G  G  G  G  G  G  G  G  G  G RG  G  G  G  G  G  G  G+QGI+G KG  G  G +G  G  GK    G                 RG QG PGL G+PG  G+ G+ GE GL G+   +GD+G  G++G +G  G  G+ G+QG  G  G  G  G+ G  G PG+ GEPG  GE G  G  GL G  G RG PG +G++      G+ GP+G  G  G   P GI G+ G+ G  G  G+KG  GP GE G+ G PG++G  G  G +G    +G +G  G  G  G  G  G +G  GP GL G  G+ GY
Sbjct:  803 KGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPG----------------ERGFQGKPGLQGLPGSTGDRGLPGEPGLRGL---QGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKGEMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIGKSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGY 1192          

HSP 3 Score: 121.709 bits (304), Expect = 1.882e-26
Identity = 145/436 (33.26%), Postives = 187/436 (42.89%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGV-------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSG------KLGKDGLIGEPG---------------KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMG---------LIGLPGESGLRGTPGP---------------------------------EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G RG PG +G  G+         KG+ G    Q +PG KG++G +G+ G PG+                           QG++G  G  GLPG+         PG+QGI GF GN+G  G  G  G  G                      N GP+G  G  G PGE G +G +GE+G+ GI G+KG  G+ G        G  GL G PG                +G  G  G  G PG  G  G KGLPGI+G+ G+QG  G +G          +GLPG  G+RG  GP                                 EG +GL   +G+        PG+KG +GE G IG  GE G RG  G+ G  G PG  G+KGE+GD+G    +   G +G  G +G TG  G +G RG  GP+G  GE G
Sbjct:  513 GPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPGEKGDQGLSGLMGPPGM---------------------------QGDKGLKGHPGLPGL---------PGEQGIPGFAGNIGSPGYPGRQGLAGPEG-------------------NPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGL---LGNR--GPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKG 888          

HSP 4 Score: 108.227 bits (269), Expect = 2.809e-22
Identity = 165/466 (35.41%), Postives = 214/466 (45.92%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLA------------------GIPGENGNIGVKGEKG---------LMGISGEKGDIGKSGKLG------KDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPG---IEGEPGDQGEIGAMGLIGLPGESGLR---------------------GTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGE---------MGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G +G+PG KG  G  G PG+ G+ G  G RG PG        ++G+ G +G QG PG  G++G  G+ G+PGL+G  G  G  G+               +G+ G +G IG  GI G +G SG  G  GIKG KG  G +G  G  G PG     G+ G  G +G         GP G  G                    GIPG+NG  G KG  G         L G  GE+G IG  G+LG      + G  GEPG  G++G  G+ G  G+ G  G  GLPG   + G  G++GE G+ G +G  GE G+                      G  GP G +G  G  G  GP G     GI+G KGE          GLIG  G  G+RG +G+ G  G+PG  G +G  G+ GL  + G +G  G +G  GP G EG  G +G  G  G+VG  G
Sbjct:  600 GRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPG--------IRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGL---------------RGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRG-------KSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKGEVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPGPIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIGKTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESGLQGEPGAKGDVGTAG 1035          

HSP 5 Score: 107.071 bits (266), Expect = 6.292e-22
Identity = 126/331 (38.07%), Postives = 152/331 (45.92%), Query Frame = 3
Query: 1374 KIGTSGKPGKQGIKGFKGNVGKSGPKGNSG-TPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK------GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEK---GTKGAKGLPGIEGE---------PGDQGEIGAMGLIGLPG---------ESGLRGTPGPE---GDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-------------LSVIGKIGKYGTIGNTGPKG------------LEGIRGPRGPIGLVGEVGKVG 2198
            K G  G PG  G  G  G  G  GPKG+ G +PG+                      +G QG  GL G PG  G+ G+KG  GL G+ GE+      G+IG  G  G+ GL G  G  G +G +G IG PGE    G +G +G+PGI G+         PGD G+ G  GL G PG           GLRG+ GP    G  G+ GP+G  G +G  LPGIKG KGE G  G++GE G  G KG  G PG PG  G  G  G  G                 G IG  G  G  GPKG            L+G +G  GPIG  GE+G  G
Sbjct:  511 KRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPGQPVPG-----------------EKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKG--LPGIKGDKGEQGTAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPGQNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRG 822          

HSP 6 Score: 101.679 bits (252), Expect = 2.503e-20
Identity = 122/332 (36.75%), Postives = 150/332 (45.18%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGD----------IXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM 1964
            RG +G  G  G PG KG+          +G  G  G+ G  GD G RG PG  G KG V V G  G  G QG PG  G++G  G+ G  G  G                       G++G  G  G+ G+PG+ G +G  G  G  G  G  GN GK GP G  G PG     G  G  G+ G  G     +G  G PG  GI G  G  G+ G+ G+ G  G +G  G  G  G  GL G+PG+ G+QGL G  G PG KG                +G+ G +G+ G  G  G RG  GP G EG+ GP G  GPRG      KG +GE 
Sbjct: 1172 RGHQGQPGPSGLPGPKGEKGYPGEDSTVLGPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGERGSEG---------------------NKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIRGGPGRTGLAGAPGPPGV----KGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPCGDPGLKGQPGEYGVQGLTGFQGFPGPKGP---------------EGDAGIVGISGPKGPIGHRGNTGPLGREGIIGPTGRTGPRGE-----KGFRGET 1458          

HSP 7 Score: 90.1225 bits (222), Expect = 8.956e-17
Identity = 112/278 (40.29%), Postives = 140/278 (50.36%), Query Frame = 3
Query: 1560 P------------------GLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGE--PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGP------------IGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGI------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
                               G  GIPG +GN G+    GL G  G KGD G S         G+  PG+ G QGL G +G PG +G KG KG PG+ G PG+QG  G  G IG PG  G +G  GPEG+ G  G             +G +G RG  +PGI+G KG  G  G  G+ GDRGP G +G+PG+      PG  G++G +G  G   IG  G  G +G +G KGL GI+G +G  G  GE+G+ GY          G+KG  GLPG PG RG
Sbjct:  494 TGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGL---PGLPGPKGPKGDPGFS--------PGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPGRQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERG--IPGIRGKKGFKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGLRGSVGPVG--PIGPAGIPGPMGLSGNKGLPGIKGDKGEQGTAGELGEPGY---------PGDKGAVGLPGPPGMRG 747          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96P44|COLA1_HUMAN (Collagen alpha-1(XXI) chain OS=Homo sapiens OX=9606 GN=COL21A1 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.954e-37
Identity = 174/530 (32.83%), Postives = 234/530 (44.15%), Query Frame = 3
Query:  654 FKVPKLET----GWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIK--------SNSNEMEKCVID----KCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGP 2165
            F  P+++T    GW++I + +    + L I+ Q+IE   N+ L  +     +LI G     K   K    Q +++          +N    C I     +CL   S                 +T A  +   G+ G  G KG PG  G+                   G+PG+               G  G PGY+G  G  G+ G+PG+                           QG RG  G  G PG  G  G  G PG  G+ G  G+ G+ G KG+ G+PG    KG KG             N G  G PG AG PG +G  G+ G  G  G +G  G  G+ G  G+ G+ G PG  G+ G KGEIG PG++G KGA G+PG+          G PG +G  G  G+ G+PG SGL+G PG  G  G  G +G        LPGI+G KG+    G+ GEKG +G KGENG  GIPG+ GI+G  G KG     G+ G  G IG+ G  G++G+ GP GP
Sbjct:  336 FANPQVKTLFDEGWHQIRLLVTEQDVTLYIDDQQIE---NKPLHPV---LGILINGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETACEIPGFNGECLNGPS--------------DVGSTPAPCICPPGKPGLQGPKGDPGLPGN------------------PGYPGQ--------------PGQDGKPGYQGIAGTPGVPGSPGI---------------------------QGARGLPGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGE----------KGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGEPGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTPGSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGYMG--------LPGIQGKKGDK---GNQGEKGIQGQKGENGRQGIPGQQGIQGHHGAKGERGEKGEPGVRGAIGSKGESGVDGLMGPAGP 765          

HSP 2 Score: 105.531 bits (262), Expect = 1.175e-21
Identity = 95/250 (38.00%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1542 RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG------------ESGLRGTPGPEGDEGLH------------------GPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +GP+GDPGL G PG  G  G  G+ G  GI+G  G  G  G  G  GL          G KGE G+ G+KG +G  G PG+ G PG +GE+GA G  G PG             +G  G PGP G+ G H                  G  G DG RG   PGI G  G  GL+G  GE G  G +G+ G PG+PG +G  G  G  G       G  G+ G  G +G+ G  G +G  G  G  G+ GY
Sbjct:  454 QGPKGDPGLPGNPGYPGQPGQDGKPGYQGIAGTPGVPGSPGIQGARGL---------PGYKGEPGRDGDKGDRGLPGFPGLHGMPGSKGEMGAKGDKGSPGFYGKKGAKGEKGNAGFPGLPGPAGEPGRHGKDGLMGSPGFKGEAGSPGAPGQDGTRGE--PGIPGFPGNRGLMGQKGEIGPPGQQGKKGAPGMPGLMGSNGSPGQPGTP-----GSKGSKGEPGIQGMPGASGLKGEPGATGSPGEPGY 687          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P18856|CAF1_EPHMU (Collagen EMF1-alpha (Fragment) OS=Ephydatia muelleri OX=6052 GN=COLF1 PE=3 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 5.035e-35
Identity = 185/627 (29.51%), Postives = 257/627 (40.99%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXX------XXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLS--TNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            G+ G  G  G  G+ G  G  G  G+ G+ G  G  GKSG  G  G PG +   G  G+                   RG +G  G  G PG +G  G+ G  G  G  G  G  G SG  G DG+ G+PG  G  G KG+ G+ G +GT G +G  G+ G  G  G  G  G  G  G+ G RGT G  G +G  G  G+ GP+G A  G+KGVKGE G +GD   KG  GP G+ G  G+ G+ G  G IGD G+      G  G  G TG +G  G +GP+GP G VG+VG  G  G  G  G  G  G   +          +  N      S +S S+      E   +N   V  D +   K +    S   +        P  SC D+ L+         W+DPN G   D+ K  C      ++    +   TC+ ++  AGD    LK +   + W S++     + Y  ++ +     SQL F++  S +A Q   + C  S               A  F+T D+  I  +K                            + YD CK + P       ++  T + + LPI D+         +   G  + PACF
Sbjct:    7 GDVGPAGPTGPAGLDGAPGAQGPDGEPGLPGLPGQSGKSGASGQPGVPGPVGAAGKPGSIRGQPGPPGPPGDLGRPGERGAKGVRGTPGAPGVDGVAGIAGAIGFPGPMGPDGAAGPSGYPGFDGVAGKPGPQGAMGPKGQAGERGPQGTPGTQGSKGVVGPKGVVGPQGDSGDTGDAGQKGARGTAGSVGAKGTVGLPGNQGPQGPA--GLKGVKGEKGEVGD---KGILGPDGDKGPTGMSGDAGPAGPIGDAGIQ-----GPPGQDGPTGAQGPRGGQGPKGPAGAVGDVGDRGSTGPAGPPGPPGPTGGGII---------LVPVNDQNPTRSPVSGSVFYRGQAEETDVNLGSV-ADVIELHKKLQHLKSPTGTKDS-----PARSCHDLFLEDNSTSDGYYWIDPNGGCIGDAVKVFC-----NFTGGVQQ---TCISATKNAGD----LKSWSGHSIWFSDMLGGFKLTY--DISR-----SQLQFIRAASRHAVQSFTYKCRNSAA-------------AVIFRTQDNKEIAANK----------------------------VTYDGCKSR-PSVPDAAFVAVETKRVEQLPIRDFASSDIAGQHQ-EFGFEMGPACF 546          

HSP 2 Score: 92.4337 bits (228), Expect = 7.241e-18
Identity = 116/315 (36.83%), Postives = 144/315 (45.71%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXX----XXXXXXXXXXXXXXRQGNRGEMGEIGLPGI------------LGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEK 1991
            D+G  G  G  G+ G    G  G  G  G+PG  G+ G +G  G PG+ G  G  GK G      G  G  G+ G  G +G +G  G  G PG+             G +G  G  G  G  GF G  GK GP+G  G  G+                      RGPQG PG  G     G +G KG  G  G SG+ GD G+ G  G  G +G  G +G+ G +G  G  G KG KG KG      E GD+G +G  G  G  G SG  G  GP GD G+ GP G DGP G   P G +G KG  G +GD+G++
Sbjct:    8 DVGPAGPTGPAGLDGA--PGAQGPDGEPGLPGLPGQSGKSGASGQPGVPGPVGAAGKPGSIRGQPGPPGPPGDLGRPGERGAKGVRGTPGAPGVDGVAGIAGAIGFPGPMGPDGAAGPSGYPGFDGVAGKPGPQGAMGPKGQAG-------------------ERGPQGTPGTQG---SKGVVGPKGVVGPQGDSGDTGDAGQKGARGTAGSVGAKGTVGLPGNQGPQGPAGLKGVKGEKG------EVGDKGILGPDGDKGPTGMSGDAGPAGPIGDAGIQGPPGQDGPTGAQGPRGGQGPKGPAGAVGDVGDR 292          

HSP 3 Score: 88.9669 bits (219), Expect = 7.706e-17
Identity = 85/229 (37.12%), Postives = 103/229 (44.98%), Query Frame = 3
Query: 1626 GISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQG----------------------EIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV------------GIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGL---VGEVGKVG 2198
            G+ G  GD+G +G  G  GL G PG  G  G  G  G PG+ G  GA G PG+ G  G  G                      E GA G+ G PG  G+ G  G  G  G  GP+G DG  G +  PG  GV G+ G  G +G KG  G +G  G PG  G              G  G+ GD G    G  G  G++G  G  GL G +GP+GP GL    GE G+VG
Sbjct:    1 GVPGPNGDVGPAGPTGPAGLDGAPGAQGPDGEPGLPGLPGQSGKSGASGQPGVPGPVGAAGKPGSIRGQPGPPGPPGDLGRPGERGAKGVRGTPGAPGVDGVAGIAGAIGFPGPMGPDGAAGPSGYPGFDGVAGKPGPQGAMGPKGQAGERGPQGTPGTQGSKGVVGPKGVVGPQGDSGDTGDAGQK--GARGTAGSVGAKGTVGLPGNQGPQGPAGLKGVKGEKGEVG 227          

HSP 4 Score: 57.7658 bits (138), Expect = 4.844e-7
Identity = 84/229 (36.68%), Postives = 102/229 (44.54%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-------VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSG 1664
            +RG KG  G+ G PG  G  G              G  GFPG  G  G A         G AG  G QG  G KG+ G  G  G PG  G  G  G KGV G  G  G+ G+ G++G RG  G +G  G +G  G  G  G  G+KG KG  G+ G KG  G  G     G+ G  G            GP GD G+ G PG++G  G +G +G  G  G  G +G  G
Sbjct:   84 ERGAKGVRGTPGAPGVDGVAGI------------AGAIGFPGPMGPDGAAGPSGYPGFDGVAGKPGPQGAMGPKGQAGERGPQGTPGTQGSKGVVGPKGVVGPQGDSGDTGDAGQKGARGTAGSVGAKGTVGLPGNQGPQGPAGLKGVKGEKGEVGDKGILGPDGDKGPTGMSGDAGPA----------GPIGDAGIQGPPGQDGPTGAQGPRGGQGPKGPAGAVGDVG 290          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5UPS7|COLL4_MIMIV (Collagen-like protein 4 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R240 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.067e-32
Identity = 165/408 (40.44%), Postives = 225/408 (55.15%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV------NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            +GE G  G+KG  G++GD+G KG         D G +G  G  GIKG    KGE G++G+ G+ G KGE G+ G  G  G+ G  G +G  G KG++G KG +G  G  G +G +G+ G  GI G+ G+ G  G +G+ G KG++G  G KG+ G  G +        KG KG +G SN       ++G +GD G  G  G+ G  G+KG KG +G  GEKGD+G +G  G  GL G  G  G+  +KGE G  G+ G+KG+K         GD+GE G  G IG+ G+ G +G  G +GD+G  G IG+ G +G T   GI G  G  G+ G    KGD+G KG  G+ GI    GIKG+ G KG    L  +G+ G+ GT G+ G KG  G++G  G  G +G  G
Sbjct:  177 KGENGINGTKGLKGSQGDLGTKG---------DDGIKGIIGSKGIKGDPGNKGEDGIKGTNGLKGSKGETGSKGDDGTKGITGLKGTKGNSGSKGDDGDKGIQGLKGEFGTKGNVGDKGDTGINGEKGSDGDKGNKGLDGIKGDLGDDGIKGDKGIKG-LKGDTGNSDKGDKGSKGDSNFSKGGIGDKGSKGDNGSKGESGDKGIFGLKGSKGDIGDKGEKGDLGDTGLKGSKGLKGSKGDKGLVNVKGENGFVGDLGSKGSK---------GDKGESGDKGDIGIKGDKGAKGVTGDKGDKGTKGFIGNVGFKGDTGDKGIIGDNGSKGIKGSSNNKGDKGDKGNTGDKGITNTKGIKGDKGIKGSKGDLGSVGEKGEKGTKGDIGTKGETGLKGIIGDKGELGSKG 565          

HSP 2 Score: 131.724 bits (330), Expect = 7.030e-30
Identity = 199/509 (39.10%), Postives = 266/509 (52.26%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXD---IGFRGFPGENGIKGV----AVKGEAGVQGSQGMP--GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEM---GEIGLPGILGKIGTSGKPGK------QGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--------NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGK------------------IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEG---DEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----------SVIGKIGKYGTIGNTGPKGL---EGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEE 2357
            G  GSKG  G KG+IG+ G  G  G+ GD   IG +G  G NG  G       KG  G++G +G    G KG+KG TG  G+ G+ G  G++G KG  G  G+ G  G  G +G++G++   G+ G+ GI+G  G  G PG       +G  G KG+ G++G KG+ GT G   +KG KG  GSKG  G   +         +G  GD G  GI GE G+ G KG KGL GI G+ GD G  G  G  GL G+ G                   IG +G KG+ G  GE G KG  GL G +G+ GD+GE G +G  GL G  GL+G+ G +G    +G +G +GD G +G+    G  G KG++G+ GD G KG  G KG+ G  G  G VG KG+ GDKG+                G  G  GNTG KG+   +GI+G +G  G  G++G VG  G KG  G+IG KG+ GL G+ G +G      L  + +  +S+S I  F +E
Sbjct:   77 GLRGSKGDTGNKGEIGDNGENGDIGQIGDNGSIGSKGIKGMNGFNGSKGIKGDKGTDGIKGDKGQDNFGSKGQKGETGSKGDDGIKGITGSKGFKGDPGTKGENGINGTKGLKGSQGDLGTKGDDGIKGIIGSKGIKGDPGNKGEDGIKGTNGLKGSKGETGSKGDDGTKGITGLKGTKGNSGSKGDDGDKGIQGLKGEFGTKGNVGDKGDTGINGEKGSDGDKGNKGLDGIKGDLGDDGIKGDKGIKGLKGDTGNSDKGDKGSKGDSNFSKGGIGDKGSKGDNGSKGESGDKGIFGLKGSKGDIGDKGEKGDLGDTGLKGSKGLKGSKGDKGLVNVKGENGFVGDLGSKGSKGDKGESGDKGDIGIKGDKGAKGVTGDKGDKGTKGFIGNVGFKGDTGDKGIIGDNGSKGIKGSSNNKGDKGDKGNTGDKGITNTKGIKGDKGIKGSKGDLGSVGEKGEKGTKGDIGTKGETGLKGIIGDKG-----ELGSKGIKGLSESFIESFYQE 580          

HSP 3 Score: 104.375 bits (259), Expect = 2.153e-21
Identity = 105/264 (39.77%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 1407 GIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKG--DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G  GF G  G  G  GN G  G     G  G  G          + G  G  G+ G+ G NG+ G+KG+KG  GI G+KG  + G  G+ G+ G  G+ G  GI G KG  G PG KG  G  G  G++G  GD G  G  G+ G+ G  G++G PG +G++G+ G  G  G +G T   G  G KG  GL G  G  G +G  G+ G  G+ GE G KG +GDKG + I   G+ G+ G+ G KGL+GI+G  G  G+ G+ G
Sbjct:   71 GDNGFIGLRGSKGDTGNKGEIGDNGENGDIGQIG----------DNGSIGSKGIKGMNGFNGSKGIKGDKGTDGIKGDKGQDNFGSKGQKGETGSKGDDGIKGITGSKGFKGDPGTKGENGINGTKGLKGSQGDLGTKGDDGIKGIIGSKGIKGDPGNKGEDGIKGTNGLKGSKGETGSKGDDGTKGITGLKGTKGNSGSKGDDGDKGIQGLKGEFGTKGNVGDKGDTGI--NGEKGSDGDKGNKGLDGIKGDLGDDGIKGDKG 322          

HSP 4 Score: 102.449 bits (254), Expect = 1.011e-20
Identity = 92/227 (40.53%), Postives = 126/227 (55.51%), Query Frame = 3
Query: 1554 GDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIE-----GEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            GD G  G+ G  G+ G KGE   +G +GE GDI   G++G +G IG  G  G+ G  G  G  G+KGT G KG  G +     G+ G+ G  G  G+ G+ G  G +G PG +G+ G++G  G  G +G        GIKG+ G  G+ GD G KG+ G KG NG  G  GE G KG+ G KG++ + G  G  G+ G+ G KG++G++G  G  G VG+ G  G N
Sbjct:   71 GDNGFIGLRGSKGDTGNKGE---IGDNGENGDI---GQIGDNGSIGSKGIKGMNGFNGSKGIKGDKGTDGIKGDKGQDNFGSKGQKGETGSKGDDGIKGITGSKGFKGDPGTKGENGINGTKGLKGSQGDLGTKGDDGIKGIIGSKGIKGDPGNKGEDGIKGTNGLKGSKGETGSKGDDGTKGITGLKGTKGNSGSKGDDGDKGIQGLKGEFGTKGNVGDKGDTGIN 291          

HSP 5 Score: 84.7297 bits (208), Expect = 2.411e-15
Identity = 108/340 (31.76%), Postives = 157/340 (46.18%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMP----------GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD---------IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLP---GIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGV 1952
            ++G  G  G+KG  G KGD+            GD G +G  G  G+KG     + G +GS+G            G KG+ G+ G  G+ G+ G                            +G  G+IG  G  G +G +G  G +G+KG KG+ G    KG +G  G +                    ++G +GD G +   G+ G+IG+KG+KG  G++G+KGD         +G  G  G  G+IG+ G  GI+G     G  G+KG  G KG+    GI+G+ G +G  G +G +G  GE G +G  G +G+ GL G IGD G  G+   GIKG+
Sbjct:  293 EKGSDGDKGNKGLDGIKGDL------------GDDGIKGDKGIKGLKGDTGNSDKGDKGSKGDSNFSKGGIGDKGSKGDNGSKGESGDKGIFGL---------------------------KGSKGDIGDKGEKGDLGDTGLKGSKGLKGSKGDKGLVNVKGENGFVGDLG-------------------SKGSKGDKGES---GDKGDIGIKGDKGAKGVTGDKGDKGTKGFIGNVGFKGDTGDKGIIGDNGSKGIKGSSNNKGDKGDKGNTGDKGITNTKGIKGDKGIKGSKGDLGSVGEKGEKGTKGDIGTKGETGLKGIIGDKGELGS--KGIKGL 569          

HSP 6 Score: 80.1073 bits (196), Expect = 7.428e-14
Identity = 108/289 (37.37%), Postives = 145/289 (50.17%), Query Frame = 3
Query: 1002 RGEKGTVGS--KGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGN---TGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTK---GAKGLPGIEGEPGDQGEIGAMGLIGLP 1841
            +G KG  G+  KG  G+KGD               IG +G  G+NG KG    KG  G++GS+G  G KGEKG+   TG+ G+ GL G                KG+KG +  +G  G +G++G  G  G  G SG  G  GIKG KG  G +G KG+ GT G +                    N G +GD G  GI G+NG+ G+KG     G  G+KG+ G  G     G+ G+ G  G +G  G +G+ GEKGTK   G KG  G++G  GD+GE+G+ G+ GL 
Sbjct:  324 KGLKGDTGNSDKGDKGSKGDSNFSKGG--------IGDKGSKGDNGSKGESGDKGIFGLKGSKGDIGDKGEKGDLGDTGLKGSKGLKG---------------SKGDKGLVNVKGENGFVGDLGSKGSKGDKGESGDKGDIGIKGDKGAKGVTGDKGDKGTKGFIG-------------------NVGFKGDTGDKGIIGDNGSKGIKGSSNNKGDKGDKGNTGDKGITNTKGIKGDKGIKGSKGDLGSVGEKGEKGTKGDIGTKGETGLKGIIGDKGELGSKGIKGLS 570          

HSP 7 Score: 73.1738 bits (178), Expect = 1.007e-11
Identity = 73/176 (41.48%), Postives = 96/176 (54.55%), Query Frame = 3
Query: 1683 LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDD--GPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++G+ G IG++G KG+ G  GE G  G  G  G   + GD G IG+ G+ G+ G +G +G  G +G +G+ G  G D  G +G     G KG  G  G+ G  G KGD G KGENG  G  G  G +G++G KG   I G IG  G  G+ G KG +GI+G  G  G  GE G  G
Sbjct:   69 IMGDNGFIGLRGSKGDTGNKGEIGDNGENGDIG---QIGDNGSIGSKGIKGMNGFNGSKGIKGDKGTDGIKGDKGQDNFGSKGQKGETGSKGDDGIKGITGSKGFKGDPGTKGENGINGTKGLKGSQGDLGTKGDDGIKGIIGSKGIKGDPGNKGEDGIKGTNGLKGSKGETGSKG 241          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AX52|CO6A4_MOUSE (Collagen alpha-4(VI) chain OS=Mus musculus OX=10090 GN=Col6a4 PE=1 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 7.977e-32
Identity = 138/360 (38.33%), Postives = 173/360 (48.06%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVA----VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE---IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            G RG  GE G+ G+      +G+ G +G +G+PG +GE+G  G+ G  G  GF+G                      +GN GE G  GL G  G  G +G  G++G  G +G  G  GP G  G PG     G  G              RG QG PG  G  GE G++G +G  G  G+ G KG +G++G+LG  G  G PG  G +G +G     GQ G+ GT+G  GLPG  G  G  G  G  G +G  GE G RG  GP G  GL       GP G   PG KG KGE G        G  G +GE+GNPG  GE G KG  G +G S  G  G  GT G+ GP G  G +G +G
Sbjct: 1420 GSRGEQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRGEEGCPGVRGPKGARGFSG---------------------EKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLF------GPDGHGYPGRKGRKGEPGF------PGYPGVQGEDGNPGRGGEKGAKGIRGKRGNS--GFPGLAGTPGDQGPPGKMGTKGSKG 1744          

HSP 2 Score: 121.324 bits (303), Expect = 2.775e-26
Identity = 105/264 (39.77%), Postives = 129/264 (48.86%), Query Frame = 3
Query: 1554 GDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIG---------AMGLIGLPGESGLRGTPGPEGDEG-------------------------LHGPIGDDG---PRGTA----LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            GD G+ G PG  G  G +G  GL G  GE+GD G+ G  G  GL GE G  G++G KG  G  GEKG  G +G+ G++GE GD+G  G         + GL GLPG +G RG PG  GD G                          HGP+G+ G   PRG+     LPG+KGV GE G +G  GE G  GP+G  G  G PG  G KG+ G +G   +       G  G  G  G  GP G  G RG +GP G  G  G  G+
Sbjct: 1411 GDDGIRGEPGSRGEQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRGEEGCPGVRGPKGARGFSGEKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLFGPDGH 1674          

HSP 3 Score: 116.316 bits (290), Expect = 1.040e-24
Identity = 139/384 (36.20%), Postives = 167/384 (43.49%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGE---------NGNPGI--------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            D G RG PG  G      +GE G+ G  G PG +G+ G  G  G PGL G               ++G  G  G +G RG  GE G PG  G  G  G+ G +G  G  G  G SG +G +G PG                        GP+G+PGL G PG+ G      +  + G  GEKG  G  G  G  G +GE G +G +G  G  G PG KG  G  G  G  GEPG  G  G  G  G PG  G +G PG +G+ GL GP G  GP G      +G+KGE+G            P GE          G PG+        PG  G KGE G  G    G  G+ G  G  G KG +GIRG RG  G  G  G  G
Sbjct: 1412 DDGIRGEPGSRG-----EQGERGLDGLPGHPGEEGDHGQRGPRGLPGLRG---------------EEGCPGVRGPKGARGFSGEKGNPGEEGVGGLDGEQGDRGAAGPSGEKGSSGSRGLTGLPGPA----------------------GPRGEPGLRGDPGDPGI-----DNLIQGPKGEKGRRGHQGSPGFHGPLGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGDPGTQGNPGLPGPSGSKGPDGP-----RGLKGEVG------------PAGERGPRGQQGPRGQPGLFGPDGHGYPGRKGRKGEPGFPGYP--GVQGEDGNPGRGGEKGAKGIRGKRGNSGFPGLAGTPG 1729          

HSP 4 Score: 101.293 bits (251), Expect = 3.540e-20
Identity = 109/314 (34.71%), Postives = 137/314 (43.63%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV--KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE---PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA 1931
            GEKG+ GS+G  G  G           G +G+ G RG PG+ GI  +    KGE G +G QG PG+ G  G  G                                   G RG +G  GLPG+ G +G +G+ G    +G  G+ G  GP+G  G PG                        G +GDPG  G PG  G  G KG  G  G+ GE G  G+ G  G+ G  G+PG  G  G  G  G+ G KG  G  G PG++GE   PG  GE GA G+ G  G SG  G  G  GD+G  G +G  G +G A
Sbjct: 1501 GEKGSSGSRGLTGLPG---------PAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGPLGEAG---------------------------------SVGPRGSLGRHGLPGLKGVLGETGELGS---RGEPGHPGPQGPRGRQGPPGFF----------------------GQKGDPGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLFGPDG-HGYPGRKGRKGEPGFPGYPGVQGEDGNPGRGGEKGAKGIRGKRGNSGFPGLAGTPGDQGPPGKMGTKGSKGLA 1746          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A4Z2DJH5 (Collagen alpha-1(V) chain isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_000274 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 8.161e-73
Identity = 268/819 (32.72%), Postives = 373/819 (45.54%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKG------------FKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIG------------LPGESGLRGTPGPEG------------------------DEGLHGPIGDDGPRGT----------ALPGIKGVKGEMGLIGDIGEKG------DRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXL---------------------PGVPGQRGTFILKNLAK-----EQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYG--DVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            +GE G  G++G PG  G+ G            + G +G  G+ G++G    G  G QG QG PG +G KG+ G  G  G  G                        +QG  G  G  G+ G  G+IG +G PG +GI+G             +G+ G+SGP+G  G  G +                      GP G PG  G+ G  G +GV G  G  G+ G KG+ GK G  G+ G  G  G  G +G+KG +G+PG +G  G+ G PGI GEPG QG  G MG IG            LPG+ G+RG  GPEG                          G  GPIGD G RG             PGI G +G++G  G  GE+G      D GPKG  G  G PG VG KGE G KG+      G  GT+G  GPKG +G  G  GP G  GE+G  G  G  G  G  G++G+ G                       G PG  G    +   K     E L    K    +  EET      Q+  +   R+  + + V S R   G S   P  +C+D++L       +  W+DPNEG++ D+ +  C      Y   T++   TCV SS + G L+TYLKP  S++ WQS+LRV  +    P     Y   SQ+N L+++  YA QE+EFLC+ + +YG  +   ++     AT+    ++  +DL+ G+ LGPG   MDKR Y     R   ++T+ YD C++   G  TK+L+ T   ++LPI+D++++ F+    C L  N+   C+
Sbjct:  910 QGEPGDKGARGPPGPVGETG------------EKGVQGLIGKPGLRGPT--GADGEQGDQGSPGPQGAKGDRGEPGEQGSTG------------------------QQGAAGSPGPQGMVGEPGEIGNAGVPGPKGIEGKVGPPGPPGPAGVQGSPGRSGPRGEPGIKGVIGA-------------------EGPVGFPGPVGLAGAPGKMGVPGAPGSPGLPGLKGEQGKPGARGEQGAQGAIGPAGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPMGPIGAPGLPGEPGSAGLPGKDGVRGDIGPEGIFGDDGPPGPPGPVGVPGVQGPPGTAGETGPIGDPGDRGAPGSIGSPGERGPPGIMGAEGQVGPQGPEGEQGLQGPPGDSGPKGNIGKIGSPGPVGPKGESGPKGVG-----GNPGTVGPPGPKGEQGSIGDPGPSGKQGEMGGHGDQGPPGPRGPNGDEGESGPPGPIGQPGPPGLQGPRGEQGHSGDPGPMGKQGPQGQVKITNNGENLRMRYKRSAVVQTEET----LEQINQNIFGRVDALNKKVRSRRYATGLSPQNPARTCKDVRLTNKFAQNDTYWIDPNEGSNRDAIRAKC----TFYDDGTVE---TCVDSSMDQGILVTYLKPLPSDSEWQSQLRV--MNSTTPLDLHNYGSHSQVNMLRIQHRYASQELEFLCDGTEIYGSWNPRTSQSDFSKATSLLAHNERMLDLTSGERLGPGKYHMDKRNYRNNLERVDTSITVEYDGCQYLTRGAATKLLIETRDLEVLPIIDFKVRNFDKQDTCSLSINVGAVCY 1653          

HSP 2 Score: 110.153 bits (274), Expect = 1.972e-20
Identity = 189/628 (30.10%), Postives = 241/628 (38.38%), Query Frame = 3
Query:  681 WNKIEIAIVSDKIGLRINCQEIEF-IRNQELKDIKRYTK--VLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVI-------DKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA--------------------------------VKGEAGVQGSQGMPGY------KGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG------------------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKS---------------GKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP---------GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----------------------------VIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGY 2201
            W++I ++I  D + L I+C+ I   + N+ L +  ++ K  + +L +     SF  A    L + S     ++C I       DK + +M  +E                      + GEKG VG KG  G  G                 G  G PG  G+ GV                                 +KG  G QG  G+PG       +G KG+ G+ G PG +G  G RG  G  G  G+ G  GE+G  G                  +RG  GEIG  GI G IG  G PG     G  G VG  G  G++G  G M                      GP G  GL G+PG +G  G+KGE    G SGE G  G                 G  GK G  G PG  G+ G  G  G PG +G  G KG PG+ GEPGD G +GA G                          GD GPRG  LP         G+ GV+G+ G  G  GE+G  GP+G  G  GI GE GI GE+G +GL                              IG  G+ G  G+ GP GL G  GPR   GP G  G+ G VG+
Sbjct:  179 WHRIALSIKGDSVTLLIDCKVITSKLLNRPLTENLKFNKGVLYVLQDKTGQASFSGAIEQLLIVPSPGGAYDQCSIYSPCSESDKTIEEMQLQEPYIYEQ-----------TRNFGQPGEKGEVGPKGEKGQPGRD---------------GRSGIPGAPGLPGVPSHILMMPLPSFGKNELSRMASFRTTVQQAVMMLKGSRGQQGMIGLPGIQGPPGPRGSKGDQGLIGEPGFIGPTGLRGPPGPVGPRGRPGVDGEVGASGLAGPKGLPGLPGLPGLPGHRGHKGEIGPSGIKGDIGLRGPPGPY---GRDGEVGPPGEPGSAGLQGPM----------------------GPVGPAGLRGLPGRSGPNGLKGE---FGDSGEIGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGY------------------------KGDRGPRG--LPGAKGAQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGTVGPAGGIGSPGEKGDPGHIGPLGLSGPVGPRGAPGPRGAPGQSGPVGF 726          

HSP 3 Score: 98.2117 bits (243), Expect = 7.557e-17
Identity = 170/454 (37.44%), Postives = 216/454 (47.58%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGE---------NGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLG---------FAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGES---GLRGT------------PGPEGDEGLHGPIGDDG----------------------PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G KG PG  G+ G+ G  G  G KGD G RG PG           G++G   +GE G +G +G+PG +G +G  GI G PG++G           GN G +G  G  G  G KG +G  G  G  GE G PG +G +G SG  G +G  G +G  G+SGP G  G                      +   +GP+G PG AG+PG  G  G  G  GL+G  GE G+ G  G++G  G++G PG++G QG  GE G PG +G +G  G PG+EG  G QGE G  G  G  G S   GLRGT             G EG  G HG +GD G                      P     PG KG +G  G +G+ GEKG    +G  G PG+ G  G  GE GD+G     G  G  G  G  G  G +G  G  GP G+VGE G++G
Sbjct:  560 GPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGAQGAAGLTGVRGD--RGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGTVGPAGGIGSPGEKGDPGHIGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGD----------EGPTGPTGPPGAAGPQGPRGTPGFAGVPGPPGLPGRPGPVGLLGDRGEPGEPGIPGEIGPIGMVGVPGQVGEQGAPGERGPPGPRGPQGIPGKPGVEGIEGVQGEKGTKGAPGPSGPSGPVGLRGTRGPPGPSGDPGAKGDEGRRGPHGSLGDKGDRGPPGPHGPPGPIGPVGPQGLPGSQGEPGDKGARGPPGPVGETGEKGV---QGLIGKPGLRGPTGADGEQGDQGSPGPQGAKGDRGEPGEQGSTGQQGAAGSPGPQGMVGEPGEIG 998          

HSP 4 Score: 92.8189 bits (229), Expect = 4.281e-15
Identity = 132/356 (37.08%), Postives = 169/356 (47.47%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQP------GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA----------LPGIKGVKGEMGLIGDIGEKGDRGPKGE 2015
            K G  G  GS G PG KG+                  +G PG  G +G     G AG +G +GM G  G +G  G  G PG++G  G                      QG +G MG IG PG+ G+ G++G PGK G++      G  GP+G  G  G     G  G  G +G  G +    GP GDPG  G P   G+IG  GE+G  GI G +G +G  G  G+ GL G PG  G +G  G+IG P      GE G KG  G PG  G PG +GE G+   IG PG SG +G  G  GD+G  GP G +G  G +           PG++G +GE G  GD G  G +GP+G+
Sbjct: 1062 KMGVPGAPGSPGLPGLKGE------------------QGKPGARGEQGAQGAIGPAGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGV---------------------QGAQGPMGPIGAPGLPGEPGSAGLPGKDGVR------GDIGPEGIFGDDGPPGPPGPVGVPGVQGPPGTAG-ETGPIGDPGDRGAP---GSIGSPGERGPPGIMGAEGQVGPQGPEGEQGLQGPPGDSGPKGNIGKIGSPGPVGPKGESGPKGVGGNPGTVGPPGPKGEQGS---IGDPGPSGKQGEMGGHGDQGPPGPRGPNGDEGESGPPGPIGQPGPPGLQGPRGEQGHSGDPGPMGKQGPQGQ 1365          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A095AG66 (Collagen alpha-1(V) chain OS=Schistosoma haematobium OX=6185 GN=MS3_01006 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.137e-71
Identity = 276/805 (34.29%), Postives = 379/805 (47.08%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILG------KIGTSGKPGKQGIKGFKGNVGKSGPKGN---------------------SGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTP---------GPEGDEGLHGPIGDDGPRGTA----LPGIKGVKGEMGLIGDIGEKG------------DRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLP------------------GVPGQRGTFILKNLAK-----EQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYG--DVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            +GE G  G++G PG  G+ G            + G +G  G+ G++G     GE G QGS G  G KG++G  G  G+ G  G AG+ G                   QG  GE GEIG+ G+ G      K+G +G PG  G++G   + G+SGP+G                      +G PGKM I G+ G  GS G+       +G QG PG  G  G  G  G  G KG+ G+ G  G  G+ G  G  G++GEPG  G QG  G IG PG        G PG  G PG  G  GA+GL GL G+ G  G P         GP G  G  GP GD G RG A    LPG +G  G MG  G +G +G            + GPKG  G  G PG  G KGE G KG+S     G  GT+G  GPKG +G  G  GP G  GE+G  G  G  G  G  G++G+ G P                  G PG  G    +   K     E L    K    I +EET      Q+  +   R+  + + V S R   G S   P  +C+D++L       +  W+DPNEG++ D+ +  C      +   T++   TCV SS + G L+TYLKP  S++ WQS+LRV  +    P     Y   SQ+N L+++  YA QE+EFLC+ + +YG  +   ++     ATA    ++  +DL+ G+ LGPG   MDKR Y     R   ++ + YD C++   G  TK+L+ T   ++LPI+D++++ F+  G C L  N+   C+
Sbjct:  859 QGEPGDKGARGPPGPIGETG------------EKGVQGLIGKPGLRGPTGADGEQGDQGSPGPQGTKGDRGEAGEQGSAGQQGAAGSPGP------------------QGMVGEPGEIGIAGVAGIKGVEGKVGPTGAPGPAGVQG---SPGRSGPRGEPGIKGVIGAEGPPGLPGPVGLAGAPGKMGIPGVPGPPGSPGL-------KGEQGKPGARGEQGAQGTTGPPGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPMGPIGAPG------LPGEPGAAGPPGKDGVRGAVGLEGLFGDDGPPGPPGSVGVPGVQGPPGTAGEAGPTGDPGDRGAAGSVGLPGERGPPGIMGAEGQVGPQGPEGEQGLQGPPGETGPKGNTGKTGSPGPNGPKGESGPKGVS-----GNPGTVGPPGPKGEQGSIGDPGPTGKQGEMGDHGDQGPPGPRGPNGDEGESGPPGPTGPPGPPGPRGEQGHQGDPGPMGKQGPQGQVKITNNGENLRMRYKRSAAIQSEET----LEQINQNIFGRVDALNKKVRSRRYATGLSPQNPARTCKDVRLTNKFAQNDTYWIDPNEGSNKDAIRAKC----TFFDDGTVE---TCVDSSMDQGILVTYLKPLPSDSEWQSQLRV--MNSTTPLDLHNYGSHSQVNMLRIQHRYASQELEFLCDGTEIYGSWNSRTSQSDFNKATALLAHNERMLDLTSGERLGPGKYHMDKRNYRNNLDRVDTSIIVEYDGCQYLTKGAATKLLIETRDLEVLPIIDFKVRNFDKQGTCSLSVNVGAVCY 1599          

HSP 2 Score: 98.2117 bits (243), Expect = 7.927e-17
Identity = 167/497 (33.60%), Postives = 220/497 (44.27%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-------VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLG---------FAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG------------------LAGIPGENGNIGVKGEKGLMGISGEKGDIGKS---------GKLGKDGLIGEPGKIGIQGLKGEIGQP------------GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIG------------------------LPG------ESGLRGTPGPEGD------------EGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G +G  G KG PG  G+ G+ G  G  G KGD G RG PG  G +G A        +GE G +G +G+PG +G +G  G+ G PG++G           GN G +G  G  G  G KG +G  G  G  GE G PG +G +G +G  G +G  G +G  G+SGP G             +           +   +GP+G PG                  L G  GE G  G+ GE G +G+ G  G IG+          G  G  G+ G+PG  GI+G++GE G              G +GT+G  G  G  G  GD+G IG  G +G                        LPG      + G RG PGP G+             GL GP G DG +G    PG +G KG+    G+ GE+G  G +G  G+PG  G VG  GEIG  G++ I    GK+G  G  G  G +G  G  GPRG  G+ G +G
Sbjct:  509 GPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGLKGEPGIVGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGSVGPAGGIGSPGEKGDPGHMGPLGLNGPVGPRGAPGPRGAPGQSGPVG----------FKGEEGPTGPTGPPGAAGPQGPRGSPGFVGVPGPPGLPGRPGPVGLLGDRGEPGEPGIPGEIGPIGMVGVPGQIGEQGAPGERGPPGPRGPQGVAGKPGVEGIEGVQGEKGTKGAAGPPGPSGPVGLRGTRGPPGPSGDPGSKGDEGRIGPQGSLGDKGDRGPPGPHGPPGPIGPVGPQGLPGSQGEPGDKGARGPPGPIGETGEKGVQGLIGKPGLRGPTGADGEQGDQGSPGPQGTKGDR---GEAGEQGSAGQQGAAGSPGPQGMVGEPGEIGIAGVAGIKGVEGKVGPTGAPGPAGVQGSPGRSGPRGEPGIKGVIG 992          

HSP 3 Score: 98.2117 bits (243), Expect = 9.235e-17
Identity = 194/613 (31.65%), Postives = 241/613 (39.31%), Query Frame = 3
Query:  681 WNKIEIAIVSDKIGLRINCQEIEF-IRNQELKDIKRYTK--VLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVI-------DKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA--------------------------------VKGEAGVQGSQGM------PGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG------------------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKS---------------GKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----------------------LSVIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGY 2201
            W++I ++I  D + L I+C+ I   + N+ L +  ++ K  + +L +     SF  A    L I + S   ++C I       DK   +M  +E                      + GEKG VG KG  G  G                 G  G PG  G+ GV                                 +KG  G QG  G+      PG +G KG+ G+ G PG +G  G RG  G  G  G+ G  GEIG  G                  +RG  GEIG  GI G +G  G PG     G  G VG  G  G  G  G M                      GP G  GL G+PG  G  G+KGE    G SGE G  G                 G  GK G  G PG  G+ G  G  G PG +G  G KG PG+ GEPGD G +GA G     G+ G RG PG +G +G  G  G  G RG      KG KGE GL    G +G  GP G  G PGI GE+G +G  G KG                         IG  G+ G  G+ GP GL G  GPR   GP G  G+ G VG+
Sbjct:  137 WHRIALSIKGDSVTLIIDCKVITSKLLNRTLTENLKFNKGMLYVLQDKAGSVSFSGAIEQLLIIPTPSGAYDQCTIYSPCSESDKTGDEMQLQEPG--------------------QPGEKGEVGPKGEKGQPGRD---------------GRNGIPGAPGLPGVPSHILMMPLPSFGKNELSRMASFRTTVQQAVMMLKGSRGQQGMTGLPGIQGPPGPRGPKGDQGLFGEPGFIGPTGLRGPPGPVGPRGRPGVDGEIGASGLAGPKGLPGLPGLPGLPGHRGHKGEIGPNGIKGDVGLRGAPGPY---GRDGEVGPPGEPGAVGLQGPM----------------------GPVGPAGLRGLPGRIGPNGLKGE---FGDSGEMGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGYK---GDRGPRGLPGAKGTQGAAGLTGVRGDRGE-----KGSKGERGL---PGPRGSEGPVGLKGEPGIVGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGSVGPAGGIGSPGEKGDPGHMGPLGLNGPVGPRGAPGPRGAPGQSGPVGF 675          

HSP 4 Score: 96.2857 bits (238), Expect = 3.529e-16
Identity = 141/421 (33.49%), Postives = 180/421 (42.76%), Query Frame = 3
Query: 1191 GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--------RGPQG------DPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQ---GLKGEIGQPGEKGTKGAKGLP---------GIEGEPGDQGEIGAMGLIGLPGE---------------------SGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIG------------DIGEKGDRGPKGEN---------------------GNPGIPGEVGIKGEIGDKGL-SVIGKIGK---------------YGTIGNTGPKGLEGIRGPRG 2162
            G+KGE G  GI G+ GL G  G                       G  GE+G  G PG +G  G  G  G  G++G  G +G +G KG  G  G+M   G +G  G  G+ G   +         RGP G       PG+ G PG  GN G KGE GL G  G+ G +G SG  G  G  G PG  G Q   GL G  G  GEKG+KG +GLP         G++GEPG  GE+G  GL G  G                      +G  G+PG +GD G  GP+G +GP G    PG +G  G+ G +G              G  G +GP+G                       G+ G PGE GI GEIG  G+  V G+IG+                G  G  G +G+EG++G +G
Sbjct:  386 GHKGEIGPNGIKGDVGLRGAPGPY---------------------GRDGEVGPPGEPGAVGLQGPMGPVGPAGLRGLPGRIGPNGLKGEFGDSGEMGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGLKGEPGIVGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGSVGPAGGIGSPGEKGDPGHMGPLGLNGPVGPRGAPGPRGAPGQSGPVGFKGEEGPTGPTGPPGAAGPQGPRGSPGFVGVPGPPGLPGRPGPVGLLGDRGEPGEPGIPGEIGPIGMVGVPGQIGEQGAPGERGPPGPRGPQGVAGKPGVEGIEGVQGEKG 785          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A4D6G2U3 (Collagen F-10 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=colF-10 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.093e-70
Identity = 153/159 (96.23%), Postives = 153/159 (96.23%), Query Frame = 3
Query: 2160 GPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCV 2636
            G  G  GEVGKVGYNG KGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSS FPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCV
Sbjct:    1 GQKGEKGEVGKVGYNGAKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSTFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCV 159          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A4Z2DJT0 (Collagen alpha-1(V) chain isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000274 PE=4 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.723e-70
Identity = 278/795 (34.97%), Postives = 371/795 (46.67%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEG------------------------DEGLHGPIGDDGPRGT----------ALPGIKGVKGEMGLIGDIGEKG------DRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXX---------------------XXXXXXXXLPGVPGQRGTFILKNLAK-----EQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYG--DVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            RG  G VG  G  G +G IG+ GL G  G  G+ G +G PG  G KG   +GE G QGS G  G  G  G  G+ G PG +G AG  G KG++G  G  G  G  G QG+ G  G  G PGI G IG             +G VG  GP G +G PGKM +                    G  G PGL G+ GE G  G +GE+G  G  G  G  G  G LG+ G  G+PG  G  G+ GE G  G +G  G  G PG+ GEPG           GLPG+ G+RG  GPEG                          G  GPIGD G RG             PGI G +G++G  G  GE+G      D GPKG  G  G PG VG KGE G KG+      G  GT+G  GPKG +G  G  GP G  GE+G  G  G  G  G                       G +G++G  G PG  G    +   K     E L    K    +  EET      Q+  +   R+  + + V S R   G S   P  +C+D++L       +  W+DPNEG++ D+ +  C      Y   T++   TCV SS + G L+TYLKP  S++ WQS+LRV  +    P     Y   SQ+N L+++  YA QE+EFLC+ + +YG  +   ++     AT+    ++  +DL+ G+ LGPG   MDKR Y     R   ++T+ YD C++   G  TK+L+ T   ++LPI+D++++ F+    C L  N+   C+
Sbjct:  597 RGPPGPVGETGEKGVQGLIGKPGLRGPTGADGEQGDQGSPGPQGAKGD--RGEPGEQGSTGQQGAAGSPGPQGMVGEPGEIGNAGVPGPKGIEGKVGPPGPPGPAGVQGSPGRSGPRGEPGIKGVIGA------------EGPVGFPGPVGLAGAPGKMGVP-------------------GAPGSPGLPGLKGEQGKPGARGEQGAQGAIGPAGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPMGPIGAPGLPGEPGS---------AGLPGKDGVRGDIGPEGIFGDDGPPGPPGPVGVPGVQGPPGTAGETGPIGDPGDRGAPGSIGSPGERGPPGIMGAEGQVGPQGPEGEQGLQGPPGDSGPKGNIGKIGSPGPVGPKGESGPKGVG-----GNPGTVGPPGPKGEQGSIGDPGPSGKQGEMGGHGDQGPPGPRGPNGDEGESGPPGPIGQPGPPGLQGPRGEQGHSGDPGPMGKQGPQGQVKITNNGENLRMRYKRSAVVQTEET----LEQINQNIFGRVDALNKKVRSRRYATGLSPQNPARTCKDVRLTNKFAQNDTYWIDPNEGSNRDAIRAKC----TFYDDGTVE---TCVDSSMDQGILVTYLKPLPSDSEWQSQLRV--MNSTTPLDLHNYGSHSQVNMLRIQHRYASQELEFLCDGTEIYGSWNPRTSQSDFSKATSLLAHNERMLDLTSGERLGPGKYHMDKRNYRNNLERVDTSITVEYDGCQYLTRGAATKLLIETRDLEVLPIIDFKVRNFDKQDTCSLSINVGAVCY 1331          

HSP 2 Score: 89.3521 bits (220), Expect = 4.416e-14
Identity = 148/423 (34.99%), Postives = 177/423 (41.84%), Query Frame = 3
Query: 1152 KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG------------------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKS---------------GKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP---------GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----------------------------VIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGY 2201
            +G  G+ G QG PG +G KG+ G+ G PG +G  G RG  G  G  G+ G  GE+G  G                  +RG  GEIG  GI G IG  G PG     G  G VG  G  G++G  G M                      GP G  GL G+PG +G  G+KGE    G SGE G  G                 G  GK G  G PG  G+ G  G  G PG +G  G KG PG+ GEPGD G +GA G                          GD GPRG  LP         G+ GV+G+ G  G  GE+G  GP+G  G  GI GE GI GE+G +GL                              IG  G+ G  G+ GP GL G  GPR   GP G  G+ G VG+
Sbjct:   36 QGMIGLPGIQGPPGPRGSKGDQGLIGEPGFIGPTGLRGPPGPVGPRGRPGVDGEVGASGLAGPKGLPGLPGLPGLPGHRGHKGEIGPSGIKGDIGLRGPPGPY---GRDGEVGPPGEPGSAGLQGPM----------------------GPVGPAGLRGLPGRSGPNGLKGE---FGDSGEIGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGY------------------------KGDRGPRG--LPGAKGAQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGTVGPAGGIGSPGEKGDPGHIGPLGLSGPVGPRGAPGPRGAPGQSGPVGF 404          

HSP 3 Score: 85.5001 bits (210), Expect = 5.685e-13
Identity = 170/454 (37.44%), Postives = 216/454 (47.58%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGE---------NGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLG---------FAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGES---GLRGT------------PGPEGDEGLHGPIGDDG----------------------PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G KG PG  G+ G+ G  G  G KGD G RG PG           G++G   +GE G +G +G+PG +G +G  GI G PG++G           GN G +G  G  G  G KG +G  G  G  GE G PG +G +G SG  G +G  G +G  G+SGP G  G                      +   +GP+G PG AG+PG  G  G  G  GL+G  GE G+ G  G++G  G++G PG++G QG  GE G PG +G +G  G PG+EG  G QGE G  G  G  G S   GLRGT             G EG  G HG +GD G                      P     PG KG +G  G +G+ GEKG    +G  G PG+ G  G  GE GD+G     G  G  G  G  G  G +G  G  GP G+VGE G++G
Sbjct:  238 GPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGAQGAAGLTGVRGD--RGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGTVGPAGGIGSPGEKGDPGHIGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGD----------EGPTGPTGPPGAAGPQGPRGTPGFAGVPGPPGLPGRPGPVGLLGDRGEPGEPGIPGEIGPIGMVGVPGQVGEQGAPGERGPPGPRGPQGIPGKPGVEGIEGVQGEKGTKGAPGPSGPSGPVGLRGTRGPPGPSGDPGAKGDEGRRGPHGSLGDKGDRGPPGPHGPPGPIGPVGPQGLPGSQGEPGDKGARGPPGPVGETGEKGV---QGLIGKPGLRGPTGADGEQGDQGSPGPQGAKGDRGEPGEQGSTGQQGAAGSPGPQGMVGEPGEIG 676          

HSP 4 Score: 82.0333 bits (201), Expect = 6.833e-12
Identity = 132/356 (37.08%), Postives = 169/356 (47.47%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQP------GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA----------LPGIKGVKGEMGLIGDIGEKGDRGPKGE 2015
            K G  G  GS G PG KG+                  +G PG  G +G     G AG +G +GM G  G +G  G  G PG++G  G                      QG +G MG IG PG+ G+ G++G PGK G++      G  GP+G  G  G     G  G  G +G  G +    GP GDPG  G P   G+IG  GE+G  GI G +G +G  G  G+ GL G PG  G +G  G+IG P      GE G KG  G PG  G PG +GE G+   IG PG SG +G  G  GD+G  GP G +G  G +           PG++G +GE G  GD G  G +GP+G+
Sbjct:  740 KMGVPGAPGSPGLPGLKGE------------------QGKPGARGEQGAQGAIGPAGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGV---------------------QGAQGPMGPIGAPGLPGEPGSAGLPGKDGVR------GDIGPEGIFGDDGPPGPPGPVGVPGVQGPPGTAG-ETGPIGDPGDRGAP---GSIGSPGERGPPGIMGAEGQVGPQGPEGEQGLQGPPGDSGPKGNIGKIGSPGPVGPKGESGPKGVGGNPGTVGPPGPKGEQGS---IGDPGPSGKQGEMGGHGDQGPPGPRGPNGDEGESGPPGPIGQPGPPGLQGPRGEQGHSGDPGPMGKQGPQGQ 1043          

HSP 5 Score: 75.0998 bits (183), Expect = 1.010e-9
Identity = 128/394 (32.49%), Postives = 165/394 (41.88%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--------RGPQG------DPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGK---------IGIQGLKGEIGQPGEK---GTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGE---------------------SGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGE---------------KGDRGP------------------------KGENGNPGIPGE------VGIKGEIGDKGLSVI----------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVG 2180
            G  GE+G  G PG  G  G  G  G  G++G  G  G +G KG  G  G++   G +G  G  G+ G   +         RGP G       PG+ G PG  GN G KGE GL G  G+ G +G SG  G  G  G PG           G++G +GE G  GE+   G +G++G  GI+GEPG  GE+G  GL G  G                      +G  G+PG +GD G  GP+G  GP G    PG +G  G+ G +G  G+               +G RG                         +GE G PGIPGE      VG+ G++G++G                    G  G  G  G  G KG  G  GP GP+GL G
Sbjct:  139 GRDGEVGPPGEPGSAGLQGPMGPVGPAGLRGLPGRSGPNGLKGEFGDSGEIGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGAQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSPGYPGGPGPKGTVGPAGGIGSPGEKGDPGHIGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGDEGPTGPTGPPGAAGPQGPRGTPGFAGVPGPPGLPGRPGPVGLLGDRGEPGEPGIPGEIGPIGMVGVPGQVGEQGAPGERGPPGPRGPQGIPGKPGVEGIEGVQGEKGTKGAPGPSGPSGPVGLRG 532          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A3Q0KKN8 (Putative collagen alpha-1(V) chain OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 7.930e-70
Identity = 260/792 (32.83%), Postives = 364/792 (45.96%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGE---------------KGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIG------------------------------------DDGPRGTA----------LPGIKGVKGEMGLIGDIGEKGDRGPKGENG------NPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG---------------------YNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAK-----EQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYG--DVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            G +G PG+ G +G    +   GE GVQG  G PG +G  G  G  G+ G  G                        +QG +G+ GE G  G  G+ G +G PG QG+ G  G +G +G  G  G  GK+   G  G  G +G  G      GP+G+PG+ G+ G  G  G  G  GL G  G+               KG+ GK G  G+ G  G  G  G +G+KG +G+PG +G  G+ G PGI GEPG QG  G MG +G PG  G  G  GP G +G+ GPIG                                    D G RG A           PGI G +G++G  G  GE+G +GP GE+G        G PG +G KGE G KG+      G  GT+G  GPKG +G  G  GP G  GE+G  G                       G  G  G  G +G++G  G PG  G    +   K     E L    K    I  EET      Q+  +   R+  + + V S R   G S   P  +C+D++L       +  W+DPNEG++ D+ +  C      +   T++   TCV SS + G L+TYLKP  S++ WQS+LRV  +    P     Y   SQ+N L+++  YA QE+EFLC+ + +YG  +   ++     ATA    ++  +DL+ G+ LGPG   MDKR Y     R   ++ + YD C++   G  TK+L+ T   ++LPI+D++++ F+  G C L  N+   C+
Sbjct:  915 GSQGEPGDKGARGPPGPIGETGEKGVQGLIGKPGLRGPTGADGEQGDQGSPG------------------------QQGTKGDRGEAGEQGSAGQQGAAGSPGPQGMVGEPGEIGIAGVAGIKGIEGKVGPPGAPGPAGVQGSPG----RSGPRGEPGIKGVIGAEGPPGFPGPVGLAGAPGKMGIPGVPGPPGLPGLKGEQGKPGARGEQGAQGTTGPPGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPMGPVGAPGLPGEPGAAGPPGKDGVRGPIGLEGLFGDDGPPGPPGPVGVPGVQGPPGTAGETGPTGDPGDRGAAGPMGSPGERGPPGITGAEGQVGPQGPEGEQGLQGPPGESGPKGNLGKTGSPGPIGPKGESGPKGVG-----GNPGTVGPPGPKGEQGSIGDPGPTGKQGEMGDHGDQGPPGPRGPNGDEGESGPPGPTGPPGPPGLQGPRGEQGHQGDPGPMGKQGPQGQVKITNNGENLRMRYKRSAAIQTEET----LEQINQNIFGRVDALNKKVRSRRYATGLSPQNPARTCKDVRLTNKFAQNDTYWVDPNEGSNKDAIRAKC----TFFDDGTVE---TCVDSSMDQGILVTYLKPLPSDSEWQSQLRV--MNSTTPLDLHNYGSHSQVNMLRIQHRYASQELEFLCDGTEIYGSWNSRTSQSDFNKATALLAHNERMLDLTSGERLGPGKYHMDKRNYRNNLDRVDTSIIVEYDGCQYLTKGAATKLLIETRDLEVLPIIDFKVRNFDKQGTCSLSVNVGAVCY 1660          

HSP 2 Score: 131.724 bits (330), Expect = 4.537e-27
Identity = 198/607 (32.62%), Postives = 252/607 (41.52%), Query Frame = 3
Query:  681 WNKIEIAIVSDKIGLRINCQEIEF-IRNQELKDIKRYTK--VLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVI-------DKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA--------------------------------VKGEAGVQGSQGMPGY------KGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQG------------------NRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKS---------------GKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----ALPGIK------GVKGEMGLIGDI------GEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPR---GPIGLVGEVGKVGY 2201
            W++I ++I  D + L I+C+ I   + N+ L +  ++ K  + IL +     SF  A    L I + S   ++C +       DK   +M  +E                      + GEKG VG KG  G  G                 G  G PG  G+ GV                                 +KG  G QG  G+PG       +G KG+ G+ G PG +G  G RG  G  G  G+ G  GEIG  G                  +RG  GEIG  GI G +G  G PG     G  G VG  G  G+ G  G M                      GP G  GL G+PG  G  G+KGE   +G SGE G  G                 G  GK G  G PG  G+ G  G  G PG +G  G KG PG+ GEPGD G +GA G  G  G  GL G  G +G  GL G  GD G +G+     LPG +      G+KGE G+IG++      G+KG+ GP+G  G PG PG    KG IG  G   IG  G+ G  G+ GP GL G  GPR   GP G  G+ G VG+
Sbjct:  186 WHRIALSIKGDSVTLIIDCKVITSKLLNRSLTENLKFGKGMLYILQDKTGSASFSGAIEQLLIIPTPSGAYDQCTVYSPCSETDKTGDEMQLQEPYIYEQ-----------TRNFGQPGEKGEVGPKGEKGQPGRD---------------GRNGIPGAPGLPGVPSHILMMPLPSFGKNELSRMASFRTTVQQAVMMLKGSRGQQGMIGLPGIQGPPGPRGSKGDQGLFGEPGFIGPTGLRGPPGPIGPRGRPGVDGEIGASGLAGPKGLPGLPGLPGLPGHRGHKGEIGPNGIKGDVGLRGVPGPY---GRDGEVGPPGEPGSVGLQGPM----------------------GPVGPAGLRGLPGRIGPNGLKGE---LGDSGEMGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSAGYPGAPGP---KGSIGPAG--GIGSPGEKGDPGHMGPLGLSGPVGPRGAPGPRGAPGQSGPVGF 733          

HSP 3 Score: 112.849 bits (281), Expect = 2.549e-21
Identity = 143/387 (36.95%), Postives = 170/387 (43.93%), Query Frame = 3
Query: 1191 GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--------RGPQG------DPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQ---GLKGEIGQPGEKGTKGAKGLP---------GIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGE-------IGDKGLSVIGKIGKYGTI------------------GNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G+KGE G  GI G+ GL G  G                       G  GE+G  G PG +G  G  G  G  G++G  G +G +G KG  G  G+M   G +G  G  G+ G   +         RGP G       PG+ G PG  GN G KGE GL G  G+ G +G SG  G  G  G PG  G Q   GL G  G  GEKG+KG +GLP         GI+GEPG  GE+G  GL G  G  G RG+ G  G  G  G IG  G  G   PG KG  G MG +G  G  G RG  G  G PG  G VG KG+                G  G  G +                  G+ G  G  GI G  GPIG+VG  G++G
Sbjct:  444 GHKGEIGPNGIKGDVGLRGVPGPY---------------------GRDGEVGPPGEPGSVGLQGPMGPVGPAGLRGLPGRIGPNGLKGELGDSGEMGPPGPQGPVGPPGVPGPQGIRGLTGKPGARGPPGVTGLPGSPGMTGNPGPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIGELGPRGLEGQKGNEGPRGSAGYPGAPGPKGSIGPAG--GIGSPGEKGDPGHMGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGDEGPTGPTGPPGAAGPQGPRGSPGFVGVPGPPGLPGRPGPAGLLGDRGEPGEPGIPGEIGPIGMVGVPGQIG 807          

HSP 4 Score: 104.76 bits (260), Expect = 9.173e-19
Identity = 172/451 (38.14%), Postives = 218/451 (48.34%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-------VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG---KPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXX--------XXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGES---GLRGT---------PGPEGDEGLHGPIGDDGPR-------------------GTALPGIKGV---KGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G KG PG  G+ G+ G  G  G KGD G RG PG  G +G A        +GE G +G +G+PG +G +G  GI G PG++G              G +G +G+ G +G RG  G  G PG  G IG +G    PG++G  G  G +G SGP G  G PG     G                     +   +GP+G PG  G+PG  G  G  G  GL+G  GE G+ G  G++G  G++G PG+IG QG  GE G PG +G +G  G PG+EG  G QGE G  G  G PG S   GLRGT         PG +GDEG  GP G  G +                      LPG +G    KG  G  G IGE G++G +G  G PG+ G  G  GE GD+G     G  G  G  G  G  G +G  G  GP G+VGE G++G
Sbjct:  567 GPQGNAGPKGEPGLTGEPGDTGPVGASGYKGDRGPRGLPGAKGTQGAAGLTGVRGDRGEKGSKGERGLPGPRGSEGPVGIKGEPGIIG------------ELGPRGLEGQKGNEGPRGSAGYPGAPGPKGSIGPAGGIGSPGEKGDPGHMGPLGLSGPVGPRGAPGPRGAPGQSGPVGFKGDEGPTGPTGPPGAAGPQGPRGSPGFVGVPGPPGLPGRPGPAGLLGDRGEPGEPGIPGEIGPIGMVGVPGQIGEQGAPGERGPPGPRGPQGIPGKPGVEGIEGVQGEKGTKGAAGPPGPSGPVGLRGTRGPPGPSGDPGSKGDEGRAGPQGSLGDKGDRGPPGPHGPPGPIGPVGPQGLPGSQGEPGDKGARGPPGPIGETGEKGVQGLIGKPGLRGPTGADGEQGDQGSPGQQGTKGDRGEAGEQGSAGQQGAAGSPGPQGMVGEPGEIG 1005          

HSP 5 Score: 73.9442 bits (180), Expect = 2.294e-9
Identity = 130/383 (33.94%), Postives = 170/383 (44.39%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPG---------------ENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGI---------------------------SGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGN 2024
            +G++G  G +G  G +G  G  G  G  GE G+IG  G  G                           AGVQGS G  G +GE G  G+ G  G  GF G  G  G  G  G  G  G  G  G +GE G+ G  G  G  GT+G PG +G+KG  G  G+ G  G++G PG +   G++G +G            GP G PGL G PG  G  G  G +G +G+                           +GE G  G  G  G  G +G PG+ G  G+ G  GQ G +G +G +GL   +G PG+ G  G +G  G PG  G +G  GP+G  G  G +G  GP           KGE G IGD G  G +G  G++G+
Sbjct:  971 KGDRGEAGEQGSAGQQGAAGSPGPQGMVGEPGEIGIAGVAGIKGIEGKVGPPGAPGP-----------AGVQGSPGRSGPRGEPGIKGVIGAEGPPGFPGPVGLAGAPGKMGIPGVPGPPGLPGLKGEQGKPGARGEQGAQGTTGPPGPKGMKGMLGRPGRQGQPGSAGPPGIVGEPGVQGAQGPM----------GPVGAPGLPGEPGAAGPPGKDGVRGPIGLEGLFGDDGPPGPPGPVGVPGVQGPPGTAGETGPTGDPGDRGAAGPMGSPGERGPPGITGAEGQVGPQGPEGEQGL---QGPPGESGPKGNLGKTGSPGPIGPKGESGPKGVGGNPGTVGPPGP-----------KGEQGSIGDPGPTGKQGEMGDHGD 1318          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col5a2a (collagen, type V, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030616-13])

HSP 1 Score: 133.65 bits (335), Expect = 3.238e-31
Identity = 150/459 (32.68%), Postives = 206/459 (44.88%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGVAVKGEAGV----------------QGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK---PGKQGIKGFKGN------VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR------------------------------------------GTPGPEGDEGLHGPIGDDGPRGTA----------LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----------------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G RG PGE G  G +                       QGS G PG KG+ G+ G+   PG  G AG +G++G +G  G  G +GE G++GNRG+ G +G PG +G+ G  G    PG+ G++G KG        G SGPKG++G PG++                         G+PGL G  G  G  GV+G +G  G  G  G+ G+ G  G  G  G  G +G+ G KG  G PG+ G +G+ G PG  G PG +GE+G +G  G PG +G R                                          GTPG  G +G+ G  G DGP+G+            PG++G+ GE G+ G  G KG+RG  GE G+ G PG  G +G  G+ G +                V G+ G+ G  G+ G  G +G+ GP  P+G  G  G  G
Sbjct:  192 MGPRGMPGERGRPGPSGVPGNVGPGGPVGLLGPPGPPGPQGSTGQPGIKGQGGDVGV---PGFKGEAGPKGEQGPQGAQGVIGPQGEEGKRGNRGDPGSVGPPGPVGERGAPGNRGFPGQDGLQGAKGAQGDRGITGTSGPKGSTGDPGRL-------------------------GEPGLPGARGLTGTPGVQGAEGKPGPLGATGEDGRPGPPGSTGTRGPAGSMGLPGPKGFSGDPGKTGEQGSPGAPGQRGPPGKEGEVGPLGSAGPPGPAGDRGEQGPPGMPGFQGLPGPPGPVGEGGKPGDQGERGTPGERGELGTPGLPGSKGIPGAPGPDGPKGSPGPAGALGDLGPPGLQGMPGERGISGPPGPKGERGALGEKGSEGTPGNDGARGSRGEPGPTGAVGFPGPPGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGPPEPVGTAGVAGPKG 622          

HSP 2 Score: 114.39 bits (285), Expect = 2.902e-25
Identity = 158/450 (35.11%), Postives = 201/450 (44.67%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG------LAGIPGENGNIGVKGEKGLMGI------------------SGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----------ALPGIKGVKGEMGLIGDIGEKGDR---------------GPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KRG +G  GS G PG  G+ G              G RGFPG++G++G       G QG +G+ G  G KG+TG   +PG LG  G  G +G+ G  G +G +G+ G  G  GE G  G PG  G  G +G  G  G KGF G+ GK+G +G+ G PG+                      RGP G  G       AG PG  G+ G +G  G+ G                    GE+G  G+ G+LG  GL G  G  G  G  G  G PG  G  G  G PG++G PG++G  G  G  G  G  G +G+ G  G++G  G  G+ GP G             PG+KG  GE G  GD G  G +               GPKG  G  G PG  G  G  G  G     G IG+ G +G  G +G  G+RG  GP G  GE G+ G
Sbjct:  278 KRGNRGDPGSVGPPGPVGERGA------------PGNRGFPGQDGLQGAK-----GAQGDRGITGTSGPKGSTG---DPGRLGEPGLPGARGLTGTPGVQGAEGKPGPLGATGEDGRPGPPGSTGTRGPAGSMGLPGPKGFSGDPGKTGEQGSPGAPGQ----------------------RGPPGKEGEVGPLGSAGPPGPAGDRGEQGPPGMPGFQGLPGPPGPVGEGGKPGDQGERGTPGERGELGTPGLPGSKGIPGAPGPDGPKGSPGPAGALGDLGPPGLQGMPGERGISGPPGPKGERGALGEKGSEGTPGNDGARGSRGEPGPTGAVGFPGPPGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGPPEPVGTAGVAGPKGGRGTQGAPGPTGFPGSAGRVGPPGATGPIGQPGPVGLPGKEGPPGLRGDHGPPGRQGERGQPG 685          

HSP 3 Score: 97.0561 bits (240), Expect = 6.595e-20
Identity = 146/452 (32.30%), Postives = 190/452 (42.04%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGI------------KGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGE---------------IGAMGLIGLPGESGLRG---------------TPGPEGDEG---------LHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPK---GENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE+G +G+ G PG+KG                    G PG +G KG    G AG  G  G PG +G  G  GI G PG  G                         +G  GE G  G PG  G  G+ G+PG  G              G KG  G+ G KG++G+PG   + G                   P G  G+AG  G  G  G  G  G  G +G  G  G +G +G+ G +G PGK G  GL+G+ G PG +G +G  G  G  G+ GD GE                G  G++GLPG+ G RG               +PG  GD+G          +GP GD GP  +++P  +       LI   GE+GD GP+   G  G PG  G VG  G  G +G +  G  G  G  G  G +GL G +GPRG  G +G+ G+ G
Sbjct:  478 GERGELGTPGLPGSKG------------------IPGAPGPDGPKGSP--GPAGALGDLGPPGLQGMPGERGISGPPGPKG------------------------ERGALGEKGSEGTPGNDGARGSRGEPGPTGAVGFPGPPGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGPPE----------------PVGTAGVAGPKGGRGTQGAPGPTGFPGSAGRVGPPGATGPIGQPGPVGLPGKEGPPGLRGDHGPPGRQGERGQPGPAGSPGDKGDPGEDGPTGPDGPPGPAGTTGQRGIVGLPGQRGERGMAGLPGPAGPPGKAGSPGSPGDKGPPGPVGSPGANGPRGDPGPDVSSVPSPQTQSAP--LI--TGERGDPGPEGLLGPRGAPGPAGPVGATGGAGKRGDA--GSRGPVGPPGPAGKRGLPGPQGPRGDKGELGDHGERG 863          

HSP 4 Score: 87.0409 bits (214), Expect = 8.161e-17
Identity = 95/257 (36.96%), Postives = 115/257 (44.75%), Query Frame = 3
Query: 1623 MGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL---------------------KGEIGQPGEKGTKGAKGLPGIEGEPG---DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG-PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-------GKIGKYGTIGNTGPKGLEGIRGPR------GPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
             G SG  G +G  G +G  G+ GE G+ G  G+                     +G  GQPG KG  G  G+PG +GE G   +QG  GA G+IG  GE G RG  G  G  G  GP+G+ G P     PG  G++G  G  GD G  G  GPKG  G+PG  GE G+ G  G  G   +       G +G  G  G  GP G  G RGP       GP G  G+ GK G  G+               PG PGQRG
Sbjct:  177 QGESGGTGPMGAPGPMGPRGMPGERGRPGPSGVPGNVGPGGPVGLLGPPGPPGPQGSTGQPGIKGQGGDVGVPGFKGEAGPKGEQGPQGAQGVIGPQGEEGKRGNRGDPGSVGPPGPVGERGAPGNRGFPGQDGLQGAKGAQGDRGITGTSGPKGSTGDPGRLGEPGLPGARGLTGTPGVQGAEGKPGPLGATGEDGRPGPPGSTGTRGPAGSMGLPGPKGFSGDPGKTGEQGS---------------PGAPGQRG 418          

HSP 5 Score: 79.337 bits (194), Expect = 1.572e-14
Identity = 147/419 (35.08%), Postives = 183/419 (43.68%), Query Frame = 3
Query:  999 KRGEKGTVG---SKGHPGAKGDIXXXXXXXXXXXXXDIG---FRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEP---------------GKIGIQGLKGEIGQ------------------PGEKGTK------------GAKGLPG--IEGEPGDQGEIGAM--GLIGLPGESGL---RGTPGPEGDEGLHGPIGDDGPRGT-------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPG 2039
            +RGE GT G   SKG PGA G  G KG PG  G  GD+G    +G PGE GI G    KGE G  G +G  G  G  G  G  G PG  G  G  G  G  G  G KGE GE G++G+ G  G  GL G    +GT+G     G KG +G  G  GP G  G+ G++   G                  GP G PG  G+PG+ G  G++G+ G  G  GE+G  G +G  G  G  GE                G+ GI GL G+ G+                  PG  G K            G +G PG  +   P  Q +   +  G  G PG  GL   RG PGP G  G  G  G  G  G+              LPG +G +G+ G +GD GE+G +G +G  G  G+PG
Sbjct:  479 ERGELGTPGLPGSKGIPGAPGPDGPKGSPGPAGALGDLGPPGLQGMPGERGISGPPGPKGERGALGEKGSEGTPGNDGARGSRGEPGPTGAVGFPGPPGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGPPEPVGTAGV---AGPKGGRGTQGAPGPTGFPGSAGRVGPPGAT----------------GPIGQPGPVGLPGKEGPPGLRGDHGPPGRQGERGQPGPAGSPGDKGDPGEDGPTGPDGPPGPAGTTGQRGIVGLPGQRGERGMAGLPGPAGPPGKAGSPGSPGDKGPPGPVGSPGANGPRGDPGPDVSSVPSPQTQSAPLITGERGDPGPEGLLGPRGAPGPAGPVGATGGAGKRGDAGSRGPVGPPGPAGKRGLPGPQGPRGDKGELGDHGERGQKGHRGYTGLQGLPG 878          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col10a1a (collagen alpha-1(X) chain [Source:NCBI gene;Acc:103042925])

HSP 1 Score: 131.339 bits (329), Expect = 5.882e-31
Identity = 147/412 (35.68%), Postives = 179/412 (43.45%), Query Frame = 3
Query: 1035 HPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGE-----------------MGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPG---EKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGL---RGTPGPEGDEGLHGPIGDDGPRG----TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            +PGAKGD G  G           G RG PG +G  G A    AG  G+ G+PG  G +G  G+ G+PGL G  G +G++GV               QG +GE                 +G+ G PG  G+ G SG PG+ G  G    VG  GPKG +G PG                              G++G PGENG  G+ G  G  G  G  G  G  G  G     G+PG  G++G  G  G PG   +KG  GA+G  G  G  G QG  G  G  G PGE G    +G  G  G +G+ G  G+ GP+G       PG +G +G  G  G  G KGD G  G  G PGIPG  G KG  G  G +           G TGP G  G RGP GP G  G  G
Sbjct:  110 YPGAKGDPGAPGPQ---------GARGAPGPSGSPGPAGISAAGKPGAAGLPGAMGPRGEQGLKGHPGLPGIPGQKGERGVGF-------------QGPQGETGATGPAGPAGAPGQPGVGKPGKPGYPGEPGKSGAPGQDGTPG---AVGPQGPKGQTGAPGI-----------------------------GVSGKPGENGAPGIPGPTGPKGPQGATGAPGAPGVPG----YGKPGANGLKGDTGPAGSPGTTGQKGEPGARGATGYTGATGSQGSAGPQGPRGFPGERGAQGDKGDTGSAGPQGIKGHKGEQGPQGIEGKQGYPGAQGPQGPRGATGATGSKGDTGATGAQGAPGIPGPAGHKGLTGHTGPA-----------GETGPAGAPGARGPTGPSGPAGATG 452          

HSP 2 Score: 95.5153 bits (236), Expect = 1.143e-19
Identity = 104/302 (34.44%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1371 GKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGE---NGNIGVKGEKGLMGISGEKGD--IGKSGKLGKDGL--------------IGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT---ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G  G  G PG QG +G  G  G  GP G S                               G PG AG+PG     G  G+KG  GL GI G+KG+  +G  G  G+ G               +G+PGK G  G  G+ G PG+ GT GA G  G +G+ G  G    +G+ G PGE+G  G PGP G +G  G  G  G  G      PG  G+KG+ G  G  G  G +G  G  G  G  G  G +G  G +G        G  G  G  G+ GP+G++G +G +GP G+ G+ G  G
Sbjct:  112 GAKGDPGAPGPQGARGAPGPSGSPGPAGISAA-----------------------------GKPGAAGLPGAMGPRGEQGLKGHPGLPGIPGQKGERGVGFQGPQGETGATGPAGPAGAPGQPGVGKPGKPGYPGEPGKSGAPGQDGTPGAVGPQGPKGQTGAPG----IGVSGKPGENGAPGIPGPTGPKGPQGATGAPGAPGVPGYGKPGANGLKGDTGPAGSPGTTGQKGEPGARGATGYTGATGSQGSAGPQGPRGFPGERGAQGDKGDTGSAGPQGIKGHKGEQGPQGIEGKQGYPG 380          

HSP 3 Score: 93.9745 bits (232), Expect = 3.119e-19
Identity = 113/320 (35.31%), Postives = 136/320 (42.50%), Query Frame = 3
Query: 1449 KGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGE---NGNIGVKGEKGLMGISGEKGDIG-------------------------KSGKLGKDGLIGEPGK------------IGIQGLKGEIGQP-----GEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGL-----PGESGLRGTPGPEGDEGLHGPIGDDGPRGTA-------------------LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KG+ G PG    +G  G  GS G  G S   +     PG AG+PG     G  G+KG  GL GI G+KG+ G                           GK GK G  GEPGK            +G QG KG+ G P     G+ G  GA G+PG  G  G QG  GA G  G+     PG +GL+G  GP G  G  G  G+ G RG                      PG +G +G+ G  G  G +G +G KGE G  GI G+ G  G  G +G     G  G  G  G TG +G  GI GP G  GL G  G  G
Sbjct:  114 KGDPGAPGPQGARGAPGPSGSPGPAGISAAGK-----PGAAGLPGAMGPRGEQGLKGHPGLPGIPGQKGERGVGFQGPQGETGATGPAGPAGAPGQPGVGKPGKPGYPGEPGKSGAPGQDGTPGAVGPQGPKGQTGAPGIGVSGKPGENGAPGIPGPTGPKGPQGATGAPGAPGVPGYGKPGANGLKGDTGPAGSPGTTGQKGEPGARGATGYTGATGSQGSAGPQGPRGFPGERGAQGDKGDTGSAGPQGIKGHKGEQGPQGIEGKQGYPGAQGPQGPRGATGATGSKGDTGATGAQGAPGIPGPAGHKGLTGHTGPAG 428          

HSP 4 Score: 85.5001 bits (210), Expect = 1.460e-16
Identity = 99/296 (33.45%), Postives = 125/296 (42.23%), Query Frame = 3
Query: 1020 VGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGY---KGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHG 1898
            VG  G PG  G+ G+ G PG+ G  G +G +G  G+ G  G+ V G+ G  G+ G+PG    KG +G TG  G PG+ G+                         G +G+ G  G PG  G+ G  G  G  G  G  G+ G +GP+G  G PG+                      RG QGD          G+ G  G +G+ G  GE+G  G  GK G  G  G  G  G  G  G  G  G  G +GA G+PG  G  G  G  G  G  G  G  G RG  GP G  G  G
Sbjct:  207 VGKPGKPGYPGEPGKSGAPGQDGTPGAVGPQGPKGQTGAPGIGVSGKPGENGAPGIPGPTGPKGPQGATGAPGAPGVPGYGKPGA-------------------NGLKGDTGPAGSPGTTGQKGEPGARGATGYTGATGSQGSAGPQGPRGFPGE----------------------RGAQGD---------KGDTGSAGPQGIKGHKGEQGPQGIEGKQGYPGAQGPQGPRGATGATGSKGDTGATGAQGAPGIPGPAGHKGLTGHTGPAGETGPAGAPGARGPTGPSGPAGATG 452          

HSP 5 Score: 66.6254 bits (161), Expect = 9.349e-11
Identity = 68/187 (36.36%), Postives = 82/187 (43.85%), Query Frame = 3
Query: 1725 GEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGL-------------------------IGDIGEKGDRGPKGENGNPG---IPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G  G PG  G +GA+G PG  G PG  G    +   G PG +GL G  GP G++GL G  G        LPGI G KGE G+                         +G  G+ G  G  G++G PG    PG VG +G  G  G   IG  GK G  G  G  G  G +GP+G  G  G  G  GY
Sbjct:  112 GAKGDPGAPGPQGARGAPGPSGSPGPAG----ISAAGKPGAAGLPGAMGPRGEQGLKGHPG--------LPGIPGQKGERGVGFQGPQGETGATGPAGPAGAPGQPGVGKPGKPGYPGEPGKSGAPGQDGTPGAVGPQGPKGQTGAPGIGVSGKPGENGAPGIPGPTGPKGPQGATGAPGAPGVPGY 286          

HSP 6 Score: 53.1434 bits (126), Expect = 1.634e-6
Identity = 51/138 (36.96%), Postives = 63/138 (45.65%), Query Frame = 3
Query: 1836 LPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGE-----VGIKGEIGD------------KGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
             PG  G  G PGP+G  G  GP G  GP G +     G  G  GL G +G +G++G KG  G PGIPG+     VG +G  G+             G   +GK GK G  G  G  G  G  G  G +G  G  G+ G
Sbjct:  110 YPGAKGDPGAPGPQGARGAPGPSGSPGPAGISA---AGKPGAAGLPGAMGPRGEQGLKGHPGLPGIPGQKGERGVGFQGPQGETGATGPAGPAGAPGQPGVGKPGKPGYPGEPGKSGAPGQDGTPGAVGPQGPKGQTG 244          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col27a1b (collagen, type XXVII, alpha 1b [Source:NCBI gene;Acc:560145])

HSP 1 Score: 127.487 bits (319), Expect = 1.716e-29
Identity = 156/409 (38.14%), Postives = 199/409 (48.66%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDGPRG--------------TALPGIKG----VKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
             GE G  G  G PG +G               D G +G PG  GI+G    +G  G  G  G  G +G KG  GI GN G+LG  G  G  G  G  G  GEKG  G  G RGE G  G+P     IG +G+P   G +GF G  G SGP G  G PG+                         QG+PG  G  G +G  G KGEKG +G  GE G+ G+ G  GK+G  G+PG +G++G +G+ G+ GE+G  G KG  G +G  G  GE+G +G +G PG  G RGT G   P G  G+ G  G  G  G               A  G +G    ++G  G  GDIG  G RG +GE+G+PG PG++G+ G+ G  G    G  G  G  G  GPKG +G +GP+G
Sbjct:   23 EGEVGLPGEPGEPGFQG---------------DKGIQGLPGMPGIRGRPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEP---GARGFPGIQGPSGPPGAKGIPGEPI-----------------------QGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAP--GLPGNPGPRGTQGPKGSKGDQGPKG 388          

HSP 2 Score: 120.939 bits (302), Expect = 1.770e-27
Identity = 183/487 (37.58%), Postives = 228/487 (46.82%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIK-GVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG--LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGL---------PGILG---------KIGTSGKPGKQGIKGFKGNVGKSG------------PKGNSGT------PGKMAXXX---------XXXXXXXXXXXXXXNVNRGPQGD----PGLAGIPGENGNIGVKGEKGLMGISGEKGDIG---KSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGA---------------------------KGLPGIEGEPGDQG------EIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            GE G +G KGHPG  G+                  RG PG  GI    AV GE G  G++G PG +G  G  G  G PG  + G  G+ G+ G  G +G KGEKG++G +G  GE GEIGL         PG++G         KIG  GKPG++G KG +G++G +G            PKGN GT      PGKM ++G          +G +G  G  G     +G QGD     G AG PG+ G +G +G++G  G  G  G IG   + GK G  GL G PG  G QG KG  G  G KG KG                            +GLPG++G  G  G      E G  G +GLPG SG  G  GP G  G  G  G  G RG A  G  G  G+ G+ G +G +G +G  G  G PG PGE G  G +G  G    G  G +G  G  GPKG +G+ G  G IG VG +G  GY
Sbjct:  102 GETGLLGEKGHPGTPGE------------------RGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLA--GETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPK--GPPGDFGPSGIQGPKGPQGLMGREGTIGPVGIIGPSGY 566          

HSP 3 Score: 120.939 bits (302), Expect = 1.947e-27
Identity = 181/483 (37.47%), Postives = 246/483 (50.93%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPG--LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGL---------PGIL---------GKIGTSGKPGKQGIKGFKGNVGKS------------GPKGNSGT------PGKMAXX---------XXXXXXXXXXXXXXXNVNRGPQGD----PGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI---------------EGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGV------KGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +GE G +G+ G  G +G +G  G  G+ G  G+ G  G PGE G  G        AV GE G  G++G PG +G  G  G  G PG  + G  G+ G+ G  G +G KGEKG++G +G  GE GEIGL         PG++         GKIG  GKPG++G KG +G++G +            GPKGN GT      PGKM ++         G +G +G  G  G     +G QGD     G AG PG+ G +G +G++G  G  G  G IG  G+ GK G  G PG  G +G +G  G  G++G KG KG+PG                +G  G +G  G  G+ GL G+ G +G  G +G++G  G  G+ GP G T  PG++G       KGE GL G+ G  G RG  G  GN G  G+ G+KG+ GD G      ++G  G  G  G+ GP G++G +GP+G +G  G +G VG
Sbjct:   77 KGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGERGEPGPQGIPVSSAVIGETGEPGARGFPGIQGPSGPPGAKGIPGEPIQGEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVGREGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGPKGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQGLMGREGTIGPVG 559          

HSP 4 Score: 107.071 bits (266), Expect = 3.949e-23
Identity = 151/414 (36.47%), Postives = 192/414 (46.38%), Query Frame = 3
Query: 1131 GIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPG---------KQGIKGFKGNVGKSG---PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGI---PGEVGIKGEIGDKGLS--------------VIGKIGKYGTIGNT-GPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGT 2282
            G+  V  +GE G+ G  G PG++G+KG  G+ G PG+ G                        R G +G  G+IG PG  G  G  G+PG         ++G+ GF G VG++G    KG+ GTPG+                         +G+PG  GIP  +  IG  GE G  G  G +G    SG  G  G+ GEP + G  G  GE G+ G  G KG KG  G EGE G++GEIG  G  G PG+ GL G  GPEG  G  G  G  G +G+   G +G  G  G +GD+G  G  GPKG  G  G    PG++G++G+ G  G                   K G+ G  G   GP G  G  GP G  G  GE G  GY G  G  G+ G+ G  GLPG PG RGT
Sbjct:   16 GLAQVQFEGEVGLPGEPGEPGFQGDKGIQGLPGMPGIRG------------------------RPGPQGFPGDIGPPGQNGPEGPKGEPGIMGNVGMLGERGLVGFIGPVGETGLLGEKGHPGTPGE-------------------------RGEPGPQGIPVSSAVIGETGEPGARGFPGIQG---PSGPPGAKGIPGEPIQ-GEPGHDGEAGRSGPDGAKGEKGDLGAEGEHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSK--GHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGT 374          

HSP 5 Score: 106.686 bits (265), Expect = 5.715e-23
Identity = 147/387 (37.98%), Postives = 191/387 (49.35%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGN---------TGIGGNPGLLGF-----------------AXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK------------PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---PEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGN 2024
            + GEKG +G KG  G  GD G  G+ G +G+ G IG RG PGE G KG    + + GE G  G  G PG KG +G           G+ G+PGL G+                 A    +       G  G  G+IG  G+RG+ GE G PG  G+IG  G+            PG +G +G KG+ G  GPKG  G PG+   +G  G+ G  G +G      GP+G PG+ G+ G++G  G+ GE+G  G  G  G+ G  G+ G  GL G  G  G    KGE G  GE G  G +G+PG  G  G QG+ G  G  G PGE G  G  G   P+G  G  GP G  GP+G    G+ G +G +G +G IG  G  GP+G+ GN
Sbjct:  195 EHGEKGEIGLKGKEGPPGDPGLVGVRGPEGKPGKIGERGKPGEKGSKGHQGHLGMTGEVGDLGPVGFPGPKGNRGTIGFVVPPGKMGMQGDPGLSGYEGHQGPQGPIGPPGPKGAKQGEQGDDGKIEGPAGPPGDIGPVGHRGDRGESGDPGYPGQIGVDGQRGKAGAPGLPGNPGPRGTQGPKGSKGDQGPKGKKGVPGESGSRGSSGSVGLSGPKGVVG-REGPEGLPGMDGLSGKDGPKGIAGEQGNDGEVGLPGNSGPHGQTGPPGLRGSQGSFGP---KGERGLAGETGPIGKRGVPGGMGNQGKQGDTGVKGQPGDPGEQGFPGILGIFGPKGPPGDFGPSGIQGPKGPQ--GLMGREGTIGPVGIIGPSGYPGPQGDKGN 575          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col5a3b (collagen, type V, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-110728-4])

HSP 1 Score: 126.716 bits (317), Expect = 5.152e-29
Identity = 152/416 (36.54%), Postives = 196/416 (47.12%), Query Frame = 3
Query: 1143 VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILG-KIGTSGKPGKQGIKGFKGNV---GKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPG-LAGIPGENGNIGVKGEKGLMGISGEKG----DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE---------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNP---GIPGEVGIKGEIGDKGLS----------------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            +++KG  G  G  G PG  G  G TG+ G+ GL G                          G+RG  G  GLPG  G + G+ G+PG +G  G  G     G  G KGN G+PG+                       G QG+PG + G PG  G +G+ G+KG  G  G +G    D    G  G++G  GE G  G+ G++G +G PG +G KGA GL GI+G          PG +GE+G  G  G  G  G+RG  GPEG +G  GP+GD G       GI G KG++G+ G  G  G +GPKG +G P   G+ GE G KG  G  G++                  GK G  G+ G+ GP G  G RGP+GP G VGE+G  G +         G  G  GLPG PGQRG
Sbjct:  312 LSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPP------------------------GDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAP-------------------GQQGNPGIMQGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGVKGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSS-----GIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPS---------GPAGKDGLPGHPGQRG 670          

HSP 2 Score: 122.479 bits (306), Expect = 1.216e-27
Identity = 166/443 (37.47%), Postives = 200/443 (45.15%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGA---KGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG--------VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPK----GNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG---------------------PEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIP---GEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            KL  +G  G +G  G PG     G  G KG  G  G  GD GF G PG  G KG           +G+ G  G +G+ G +G KGN G  G PG  G                        +QGN G M   G PG  G +G  G  G QG KG +G  G  GP     G  G PG+  + G+ G +G  G  G   V +G  G  G+ G  GE G  G  G KG MG+ G+ GD G  G  G+DG  G  G+ G  G  G  G  GEKG  G  GLPG  G  G +G  G  G IG+ GE G +G PG                     P G  G  G  G DGP G +  G +G +G  G +G+IG KG  GP G++G PG P   GE G +G+ G  G S V+G  G  G  G  G +G  G  GP G  GL G  GK G
Sbjct:  311 KLSMKGPPGPLGLNGRPGPLGNPGPTGLKGDSGLPGPPGDRGFDGLPGLPGNKGHRQGSDGQPGPRGQPGEPGGRGVDGVQGSKGNLGSPGEPGAPG------------------------QQGNPGIM--QGFPGPQGLVGLPGDKGPQGKKGMRGLPGTDGPPQGHPGREGPPGEKGLPGLAGVQGPVGYPGARGV-KGADGLRGIKGSKGEKGEDGFPGAKGEMGVKGDGGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPS--GERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQGKTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEG 724          

HSP 3 Score: 120.168 bits (300), Expect = 6.080e-27
Identity = 206/736 (27.99%), Postives = 286/736 (38.86%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXX---XDIGFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEK------------GLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE---------------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGL---------------------IGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGP---------KGLE---------GIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVR--SSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVY--GDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGY 2960
             EK   +GEKG +G  G  G +G +G  G  G  G     GD G  G PG+ G KG        G  G QG +G PG  G  G +G  G  G+ G                     + G +G RG  G  G  G+ G  G  G+ G+ G  G  G  G+ GP+G  G  G       +     +          G  GDPG  GIPG NG  G +GEK            G  G SGE G  G SG +G  G  G PG+ G  G+ G  G  G+ G  G  G PG  GE               PG +G+ G  G  G PG  GL G  GP G +G  G  G  G     LPGI G  GE GL                      GD G KGD+G  G  G  G PGE G   E GD+G+   G  G  G  G+ GP          G           G +GP GP G    V +  ++                         + +   +  E      K +              +    +++ M+T ++ + + +    S    P  +C+++ +    +LP+  W+DPN G   D+FK  C      ++AE      TC++  S Y++  L  + K  +   TW S+ R      Y  +      H+ QL FL++ S  A Q   +LC+ S+ +  G    +K +LR    F+  +D  +  +    + P Y
Sbjct:  804 GEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYG---------------------QKGDEGLRGFKGATGPRGLQGMPGPPGEKGESGHSGLIGPPGQFGPRGPQGPSGGQQGPPGRPGVRGQPGGVGEKGEDGESGDPGPVGIPGSNGEKGDQGEKGDSGASGAGGIPGARGTSGEDGAKGNSGPIGLTGDPGPPGEAGTDGIDGAPGSKGDNGEPGKAGPPGASGEPGPPGRPGRRGHLGPPGKEGKPGMKGDKGAPGYEGLLGKTGPVGGQGNPGKAGPQG-----LPGIPGPAGEQGLNGPPGQTGPPGPMGPSGLPGLKGDHGRKGDKGHGGLIGLIGPPGEFG---EKGDRGMP--GNQGVQGPKGDPGPVGTSGPNGPPGPPGLSGPIGPRGDQGPAGPPGAPDGVRRRRHHSEVDGA-------------------SLVDGEMDVETEVEEDKGMQGDGAAGGAGEKDMEEVFASLASMRTEVEGLRTPQGTYHS----PARTCKELWM-WNPKLPDVYWIDPNHGCHRDAFKAFC-----NFTAEG----ETCLQPHSKYQSVKLAAWNK--EKPGTWFSKFRKGSQFSY-IDADGNDVHVVQLGFLKLLSATARQSFTYLCQNSVGWLDGATFSHKRALR----FRGSNDQELTHANAHYIQPSY 1468          

HSP 4 Score: 116.316 bits (290), Expect = 8.510e-26
Identity = 172/462 (37.23%), Postives = 224/462 (48.48%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA----------VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKP---GKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGL---PGIEGE--------PGDQGEIGAMGL---IGLPGESGLRGTPG-------PEGDEGLHGPIGDDGPRG----------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGI------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++GE G  G+KG  G KGD          G+ G +G RG  G  G KG +          + GE G  G  G+PGY G +G  G  G PG +G AG +G+KG  G  G  G++G  G +G RG  G  G  G  G  G  G P   G++G +G +G VG+ GPKG SG  GK  + G  G +G  G QG      GP G  G+ G  G  G  G  GE+G  G +G  G+ G  G  GK+G  G+PG  G+ G  G  G  G +G++GA G    PG++G         PG  GE G  GL   IG PG +G  G PG       P+G++G  GP G DG +G                      T  PG KG KG+ G  G  G  G +GP+G+ G PG+      PG+ G+ G+ GD+GL         G  G TGP+GL+G+ GP G  G  G  G +G
Sbjct:  497 EKGEDGFPGAKGEMGVKGD---------GGDTGPVGMRGEDGPEGPKGQSGPLGDPGSSGIAGEKGKLGVPGLPGYPGRQGPKGTDGFPGAIGVAGEKGRKGPPGQAGIAGQRGPNGARGARGARGPTGKSGDKGSAGHDGPPGPSGERGPQGPQGRVGEIGPKGPSGPAGKDGLPGHPGQRGEPGFQG----KTGPPGPSGVVGPQGNAGETGPMGERGHPGSAGPPGEQGLPGAAGKEGAKGDPGSTGVSGKNGPTGLKGFRGSRGAPGTMGPPGLKGSWGPVGSSGPGATGERGPPGLAGAIGQPGRTGTAGGPGPMGEKGEPQGEKGPIGPAGQDGEQGPVGLPGATGPPGPPGEDGDKGETGGPGQKGSKGDKGEPGPAGPTGTQGPEGQPGIPGVDGESGPPGQQGMYGQKGDEGL--------RGFKGATGPRGLQGMPGPPGEKGESGHSGLIG 937          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col11a2 (collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-000208-23])

HSP 1 Score: 126.716 bits (317), Expect = 6.423e-29
Identity = 149/370 (40.27%), Postives = 186/370 (50.27%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGK---IGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN-----RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G RG PGE GI     KG+ G  G  G+PG KG +GN G  G  G  G                     E G +G+ G++G  GLPG  G    +G  G PG  G +G +G+ G  GPKGN G  G+    G +G  G++G+ G          +GP G PGL G+PG +G  G  G++   G SG KG+ G SG  G    IG PG  GI+G++G  G  G KG KG  G PGI+G+ G +GE G +G+       G RG  GPEG +G  GP G+ G  G       G KG++G+ G  G  G +GPKG  G PG P   G  GE G +GL     IGK G  G  GP G  G RGPRG  G  G  G
Sbjct:  564 GARGMPGETGI-----KGDRGFDGLPGLPGDKGYRGNNGAMGPVGPPG---------------------EDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGSQGVRGSDGPPGPKGNLGPQGEPGPPGQQGGPGTQGMPGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKE---GPSGTKGNQGPSGPQGS---IGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGV------PGPRGEDGPEGPKGRVGPPGEIGSLGPV-----GEKGKLGVPGLPGYPGRQGPKGSLGFPGFP---GTNGEKGGRGL-----IGKTGPRGQRGPTGPRGQRGPRGSTGKSGAKG 882          

HSP 2 Score: 122.479 bits (306), Expect = 1.148e-27
Identity = 142/347 (40.92%), Postives = 176/347 (50.72%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGES------GLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGEN 2018
            RG  G +G  G PG  G+         +G+ GD+G RG PGE G +G+   KG  G+ GSQG+   +G  G  G  GN G  G  G  G++G  G  G  G +G  G  G +G  G+ GLPG+ G  G  G PGK+G  G KGN G SGP+G+ G PG   I                   +G QG  GL G  GE G  G  G KG  G+ GE+G++G  G  G+DG  G  G++G     GEIG  G  G KG  G+PG+ G PG QG  G++G  G PG +      GL G  GP G  G  GP G  GPRG T   G KG  G  G  G  GE+G  GP+G N
Sbjct:  593 RGNNGAMGPVGPPGEDGE---------RGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGSQGV---RGSDGPPGPKGNLGPQGEPGPPGQQGGPGTQGMPGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGI-------------------KGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEGPKGRVGP---PGEIGSLGPVGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGTNGEKGGRGLIGKTGPRGQRGPTGPRGQRGPRGSTGKSGAKGSSGGDGPAGPPGERGLPGPQGAN 905          

HSP 3 Score: 95.9005 bits (237), Expect = 1.614e-19
Identity = 112/337 (33.23%), Postives = 147/337 (43.62%), Query Frame = 3
Query: 1350 IGLPGILGKIGTSGKPGKQGIKGFKGN-------VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKG---------------DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAK---------GLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----------------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            +G PG  G  G +G PG  G+ G  G         G+SG  G+ G             + ++     S      +G PG  G  G  G +G  G  GL G SG+ G                 G+ G+ G DG  G PG+ GI+G +G  G PG  G KG +         G PG +GE GD G++G  GL G PG  GL G  GP G  G  G  G DGP G                        +PG +G  G  G  G  G+ G  G  G +G PG PG+ G  G  G++G S     G  G+IG  GP+G++G++G RG  G  GE G+ G+
Sbjct:  442 VGDPGERGPPGKAGLPGADGVPGPPGTSVMLPFRFGQSG--GDKGP--------AVSAQEAQAQAILSQARLALKGPPGPMGFTGRPGPLGTPGSNGLKGESGDPGAQGPRGPQGMPGPPGKAGRRGRAGADGARGMPGETGIKGDRGFDGLPGLPGDKGYRGNNGAMGPVGPPGEDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGSQGVRGSDGPPGPKGNLGPQGEPGPPGQQGGPGTQGMPGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPS-----GPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGF 763          

HSP 4 Score: 92.4337 bits (228), Expect = 1.808e-18
Identity = 127/374 (33.96%), Postives = 159/374 (42.51%), Query Frame = 3
Query: 1350 IGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDP---------------------------------GLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE------------------------------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            + L G  G +G +G+PG  G  G  G       KG SG PG    +G +G                    P                                 GL G+PG+ G  G  G  G +G  GE G+ G  G +G  GL GEPG  G+ G KG  G  G +G +G+ G PG +G                               PG++G  G  GL G+PG  G  G PG EG  G  G  G  GP+G+   PG +G+KG  G+ G  G KG+   KGE+G PGI G+ G+KGE G+     +G  G  G  G  GPKG  G  G  G +G VGE GK+G  G  G  G  G KG  G PG PG  G
Sbjct:  503 LALKGPPGPMGFTGRPGPLGTPGSNGL------KGESGDPGAQGPRGPQGM-------------------PGPPGKAGRRGRAGADGARGMPGETGIKGDRGFDGLPGLPGDKGYRGNNGAMGPVGPPGEDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGSQGVRGSDGPPGPKGNLGPQGEPGPPGQQGGPGTQGMPGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGE---KGEDGFPGIKGDFGVKGERGE-----VGVPGPRGEDGPEGPKGRVGPPGEIGSLGPVGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGTNG 843          

HSP 5 Score: 81.6481 bits (200), Expect = 3.635e-15
Identity = 121/476 (25.42%), Postives = 183/476 (38.45%), Query Frame = 3
Query: 1824 GLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTV--------------------LQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYP-HISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKP--DMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            GL GLPG  G +G+PGP G+                    KG  G +G  G  G +G+ G KGE G+PG+ G +G  GE G+KG       G  G  G++G KG  G+ G  GP+G  G  G  G  G KG  G  G  G KG      ++G              I    I I  +  + I+ +++  D  +   T                     L+           + + P  +CQD+ L    E  +  W+DPN+G + DSFK  C    +    ET      C+  S E  ++     P +   TW S       + Y      G P  + Q+ FL++ S  A Q + + C  S+ + D         Y  A      N  ++S            +   Y          +  L D C ++    + + +L  N P  + LP++D +I  F +N +   G  + P CF
Sbjct: 1386 GLRGLPGSVGQQGSPGPAGE--------------------KGPPGPIGPSGLPGLRGEAGAKGEKGHPGLIGLIGPPGEQGEKG-----DRGLPGPQGSSGSKGETGMPGGTGPLGPAGPAGVPGPRGIKGAKGAAGGAGPKG------EKGVQGPPGPPGPPGDVIQPLPIQIPKKSKRSIDASEILPDGKAMDDTTGTEFLNGNEGMEEVFGSLNSLRQEIEAMRFPLGTKDSPARTCQDLLLS-QPEYTDEYWIDPNQGCTRDSFKVYCN---FTAGGET------CLYPSKEVENVKMNSWPKEKPGTWYSRFAKGSKMSY--VDSNGEPVGVVQIGFLRLLSLQARQNLTYHCHHSVAWADSTSGNG---YQRALHFLGSNEEEIS-----------YETNPY----------IKALSDGCSYRK--GYDRTVLEINTPQVEQLPLLDMKITDFGENNQ-KFGFEVGPVCF 1791          

HSP 6 Score: 70.0922 bits (170), Expect = 1.405e-11
Identity = 145/399 (36.34%), Postives = 180/399 (45.11%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQG---------------DPGLAGIPGENGNIGVKGEK---------GLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGI----------------KGVKGEMGLIGDIGEKGDRGP---KGENGNPGIPGEVGIKGEIGD 2069
            +G KG  G  G PG KGD       G KGE+G++G  G  GE+G +G   KG  G  G  G  G  GEKG  G+ G PG  G                        RQG +G +G  G PG  G+ G  G  GK G +G +G  G  G +G  G+ GK   KG  G  G  G  G+  +  GPQG                 GL G PG+ G +G +G+          G  G SGE G +G+ G  G  G  GE G  G  G +G  G PG  G  G  G PG+ G PG++      GL G PG +GL+G  GP G  G  G  G+ G  GTA P                  KGV GE G +G  G  G +GP    G  G+PG+PGE G KGE+G+
Sbjct:  752 KGHKGEKGEDGFPGIKGDF------GVKGERGEVGVPGPRGEDGPEG--PKGRVGPPGEIGSLGPVGEKGKLGVPGLPGYPG------------------------RQGPKGSLGFPGFPGTNGEKGGRGLIGKTGPRGQRGPTGPRGQRGPRGSTGKSGAKGSSGGDGPAGPPGERGLP-GPQGANGFPGPKGPPGPPGKDGLPGHPGQRGEVGFQGKAGPPGPPGVVGPQGPSGETGPMGERGHSGPPGPPGEQGLSGPSGKEGTKGDPGPPGGPGKDGPPGLRGFPGER------GLPGTPGGAGLKGNEGPAGPPGTAGSPGERGLAGTAGPIGPPGRPGPQGPPGSSGEKGVPGEKGPVGPAGRDGIQGPVGLPGPAGSPGVPGEDGDKGEVGE 1111          

HSP 7 Score: 51.2174 bits (121), Expect = 7.498e-6
Identity = 47/104 (45.19%), Postives = 56/104 (53.85%), Query Frame = 3
Query: 1563 GLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP 1874
            GL G  G+ G+ G  GEKG  G  G  G  G  G+ G  G  G PG IG+      IG PGE+G KG +GLPG +G  G +GE G  G  G  G +G  G PGP
Sbjct: 1389 GLPGSVGQQGSPGPAGEKGPPGPIGPSGLPGLRGEAGAKGEKGHPGLIGL------IGPPGEQGEKGDRGLPGPQGSSGSKGETGMPGGTGPLGPAGPAGVPGP 1486          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.984 bits (380), Expect = 3.525e-38
Identity = 192/669 (28.70%), Postives = 271/669 (40.51%), Query Frame = 3
Query: 1335 GEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV---KGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGT---------------KGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPG-EVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXX--------XLPGVPGQRGT------FILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYD--SETTWQSE-LRVDGLVLYPPNLRKGYPHIS-------------QLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLS--TNKPDMLPIVDYRIKYFNDNG-KCMLGANIYPACFV 3185
            G  G+ G  G  G  GT G+PG+ G  G  GN G+ G +G SGT                         RG  G PG +G  G +G  G+   +GE+G+ G++G  G +GKSG  G+ G  G PG +G  GL G  G+ G +G+               +G +G PG  G PG+ G +G  GL G  G+ G RG  GP+GD G+ G  G  GP G      +G  G  G  GD GE+G +G +G +G  G+PG       + G       G  G  G  G  G  G  G  GP GP G  G  G+ G  G  G  G  G  G           LP +  ++G       +      KE  + +  +L ++ N+   I++    K D                         P  SC+D+ L  +       W+DPNEG+  D+ K  C                     + E G+   Y KP +  S+  W ++  R    V +   +  G+ H S             QLNFL++ +  A Q + +LC  S+ Y D      SLR A                  +G G       + L  +G++ F  ++L D C  K  G + K +L   TNKP  LPIVD  I   +  G +   G  I P CF+
Sbjct:   47 GAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGT-------------------------RGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGP-----QGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGSAGPAGSPGIPGPPGPPGPAANGYGQLPLIGMEKGPDPYPYRYRADEALKEHDAEVDVTLKSLTNQLENIMSPEGTKTD-------------------------PARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWC---------------------NMETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGF-HFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAA---GSLRKAVRL---------------MGSG------ELELRADGKNRFTYSMLEDGCA-KHTGEWGKTVLQYKTNKPSRLPIVD--IAPLDIGGPEQEFGVEIGPVCFL 611          

HSP 2 Score: 85.1149 bits (209), Expect = 3.779e-17
Identity = 111/305 (36.39%), Postives = 137/305 (44.92%), Query Frame = 3
Query: 1167 VQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENG------NIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHG------------PIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGN 2024
              G+QG  G  G +G+TG  G PG  G                    G +G QG RGE G  G  G  G  G+SG  G  GI+G  G  G+ G  G +G  G +   G  G +G +G  G  NV     G PGL G PGE+G        G  G  GL G+ G++G+ G  G+ G  G +G PG  G  G  G  G+ G +G  G  G PG  G  G QG  GA G  G  GE G++G  G  G +GL G              G  GPRG   P G +G  G  G  G +G  G RG  GE G+
Sbjct:   45 ASGAQGKDGSMGPRGDTGTPGEPGEPG------------------PTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPG--NV-----GSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAGS 324          

HSP 3 Score: 83.1889 bits (204), Expect = 1.236e-16
Identity = 97/252 (38.49%), Postives = 115/252 (45.63%), Query Frame = 3
Query: 1572 GIPGENGNIGVKGEKGLMGISGEKG------DIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE---------------PGDQGEIGAMGLIGLPGESGLRGTP---GPEGDEGLHGPIGDDGPRGT----ALPGIKGVKGEMGLIGDIGEKGDRGP------KGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGI---------RGPRGPIGLVGEVGKVG 2198
            G  GE G  G  GE G MG++G  G        G  G +G  G  G  GK G  G +G+ G PGE G  G  GL G +GE               PG  G +G+ G+ GL G+ G RG P   GP G  G  GP G+ G RG       PG+ G  GE G  G  G  G  G       +G+ G PG PG  G  G +G+ GLS  G  GK G  G TGP+G  GI          GP+GP G  GE G  G
Sbjct:    2 GPSGEGGPKGALGEVGGMGMTGFPGAPGESGTGGPPGGIGPQGASGAQGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLS--GANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSG 251          

HSP 4 Score: 78.5666 bits (192), Expect = 4.410e-15
Identity = 106/323 (32.82%), Postives = 133/323 (41.18%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMG 1967
            +RGE+G  G++G  GA G                    GF G +GI+G+     +G +G +G+PG  G  G+ G  G  G                            QG RG  G +G PG+ G  G SG+ G  G  G  G  G +G +G+ G PG                             PG  G PG  GN G+ G  G  G  GE G  G SG +G+ G  G  G  G  G  GE G  GE+G KG +G  G +G PG  G  G  G  G+ G SG RG  GP G  G  G  G  GP G +  G +G  GE G
Sbjct:   81 ERGERGPSGTRGTAGAPGS------------------SGFLGSHGIQGL-----SGQRGERGVPGLNGPTGSLGKSGPTG---------------------------EQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGT----------------------------PGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPS--GHRGRPGEAG 323          

HSP 5 Score: 71.633 bits (174), Expect = 6.082e-13
Identity = 105/300 (35.00%), Postives = 137/300 (45.67%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGS---QGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK---------PGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPG---KIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESG 1853
            RG+ GT G  G PG  G +G            + G RG  G +G +G A   G +G  GS   QG+ G +GE+G  G+ G  G LG +G  G                   QG RG  G +G PG+ G  G SG+          G+ G+ G +G+ G+ G  G  G PG M   G+ G  G  G +G++    GPQGD G+ G PG  G +G +G  G  G  G+ G+ G  G  G  G  G PG     G QG  G  G  G +G  G  G  G +G  G  G +G  G  G PGE+G
Sbjct:   58 RGDTGTPGEPGEPGPTGLLG------------NQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTG------------------EQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGET----GPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGPLGPSGHRGRPGEAG 323          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.831e-28
Identity = 225/774 (29.07%), Postives = 311/774 (40.18%), Query Frame = 3
Query: 1107 FRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPG---KQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLA----------------GIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIG---------------IQGLKGE---IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLI------------------GLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGD---------------------RGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPG----------------QRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYL--KPYDSETTWQSELRVDGLVLY--PPNLRKGYPHISQLNFLQMRS--EY---AEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLS--TNKPDMLPIVD 3113
             +G PGE G  G++  KG+ G  G +G  G  G+ G  G+ G  G  G AG  G KG  G  G  G  G  G  G RGE G  G  G  G  G+ G+PG   +QG  G KG+ G  GP+G SG PG     G+ G KG+          RG QG P  A                G PG  G  G  G+ G  GI G+ G +G++G+ G  G IG PG+ G                QGL G+   +G PG++G +G  GLPG  GEPG QG  GA G                    G  G +G  G PG +G  G  G  G+ G  G    PG  G  G +G  G  G +GD                     +GP+G+ G  G  GE GIKG  G  GL      G  G  G++G +GL G  GP GP GL G  G  G +G  G+ G IG  G +G  G  G                      L  +A    ++ +   +  +  +  +    Q   +  + +K+ L        +   +   P  +C+D++L          W+DPN+G + D+ K  C       + ET +   TCV ++ +      +   K  D +  W  E    GL       NL      I Q+ FL++ S   Y   A   + + C+ SI Y D  +   +L+ A   Q  +D                     + +   G S F   +L D C  K  G + + ++   T K   LP VD
Sbjct:  147 LQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGA----------RGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQ-----GLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNGQSGPIGPPGPRGRTGETGPAGPSGPAGLPGPPGPPGPGIDLSAIAGIGQTDKAPDPLRYYRSDQALPELRQHDAEVDASIKS-LSGQIEGLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFC-------NMETGE---TCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAI-QMTFLRLLSMEAYDLPAAANITYHCKNSIAYMD--EETGNLKKALLLQGSND---------------------MEIRAEGNSRFTYNVLEDSC-TKHTGEWGRTVVEYRTQKTSRLPFVD 869          

HSP 2 Score: 80.4925 bits (197), Expect = 1.406e-15
Identity = 161/484 (33.26%), Postives = 205/484 (42.36%), Query Frame = 3
Query:  999 KRGEKGTVGS---KGHPGAKGDIXXXXXXXXXXXXXDIGF---------------------RGFPGENGIKGVAVK-GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGK------PGKQGIKGF---------------KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGL--PGIEGEP----GDQGEIGAMGLIGLPGESGLRGTPGP---EGDEGLHGPIGDDGPRGTA----------LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-------------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            K GEKG  G+   +G PG  G+ G +G PG  G  G+ G                       G PG  G+ G A K G +G +G +G PG +G  G  G+ G  GL G  G  G KG  G  G  G +G  G QG  GE G  G+ G  G  G SG+      PGK G +G                KG+ G +GP G SG  G    +G                  GP G  G AG PG +G  G KGE+G    +G+KGD G  G  G  G  G  G  G+ G KG  G  G     GA+ L  P ++  P    G+ G  G  G  G  G  G+RG  GP    G+ GL GPIG  G +G A           PG +G+ G+ G++G  G++G+R      G PG+PG  G  G+ G  G S                     G+ G  G+ G  G  G  G +G RG  G  G+ G  G
Sbjct:   15 KPGEKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERG----------------ETGPPGPAGFAGPPGSDGQPGAKGEQGE---TGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGP--PPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGER------GFPGLPGPAGEPGKQGSTGASGERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPGAPG 471          

HSP 3 Score: 79.7221 bits (195), Expect = 2.326e-15
Identity = 118/363 (32.51%), Postives = 144/363 (39.67%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGK---IGTSGKPGKQGIKGFKGNVGKSG------------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLI---------------GEPGKIGIQGLKGEIGQPGEKGTKGA------KGLPGIEGEP---GDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-----AL---------------PGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDK----------GLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            QG  GE G++G+ G  G+    G  G PG QG++G +G  G  G            P G  G                                PGL G+PGE G  G+ G KG  G SGEKG  G  GK G  G+                G+ G  G  G  G  G PGE+G  G        G PG +G+P   G+QGE G  G  G PG  G  G PGP+G  G+ GP G  G +G      AL               PG  G  G  G  G  G +GD GP G  G PG+ G +G  GE GD                G  G+ G +G  G +G  G  G  GP G  G+ G  G +
Sbjct:   82 QGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGP-------------------------------PGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGAS 413          

HSP 4 Score: 78.5666 bits (192), Expect = 4.641e-15
Identity = 125/348 (35.92%), Postives = 158/348 (45.40%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGF----PGENGIKGVAV-------------KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGE---SGLRGTPGP---EGDEGLHGPIGDDGPRG----TALPGIKGVKGE 1961
            ++GE G  G  G PG +G  G  G  G  G  G  G RG     PG   + G AV              G AG  G  G  G +G+ G  G  G PGL G  G  G+KG  G +G  G  G  G QG  G+ G +GLPG  G+ G  G PG  G  G +G+ G S              +                  +G +G+ G  G PG +G  G KGE+G  G +G+ G     G  G  G +G  GK G +G +G  G  G  G  GA+GLPG +G  GD+GE G  G  G+ G    +GL+G PGP    GD+GL G +G  GPRG    T  PG  G  G+
Sbjct:  249 EQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGPPPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKGIRGDSGPVGRAGEPGLQGPIGAPGEKGDAGEDGPPGPDGPPGAQGLSGQRGIVGLPGQRGERGFPGLPGPAGEPGKQGSTGAS-------------GERGPPGPVGPPGLSGPPGEQGREGNAGSDGAPGRDGAAGAKGERGEAGAAGQPG---APGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQGLAGSVGPSGPRGLSGPTGPPGKDGNNGQ 580          

HSP 5 Score: 78.5666 bits (192), Expect = 5.011e-15
Identity = 104/314 (33.12%), Postives = 124/314 (39.49%), Query Frame = 3
Query: 1431 VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGV------------------------------------KGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGT---------------KGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGL------------HGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVG 2180
            +G  GPKG  G PGK                      +G  G PGL G+PG++G  G                                      G+ G  G+ GE G +G SG  G+ G  GE G  G QGL+G  G PG  GT               +G  GL G+ GE G  G  GA G  G  GE G  G PG +G  G+            HG  GD GP G   P G +G  GE G  G  G  G  GP G +G PG  GE G  G+ GD G       G  G  G  GP+G  G+ GP+G  G  G
Sbjct:    1 MGFPGPKGAGGEPGKPG-------------------EKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAP-----GPQGPSGAPGPQGPNGVSGPKGARGAQG 290          

HSP 6 Score: 49.6766 bits (117), Expect = 4.401e-6
Identity = 79/245 (32.24%), Postives = 92/245 (37.55%), Query Frame = 3
Query: 1707 GIQGLKGEIGQPGEKGTKGA---KGLPGIEGE------------------------------------------PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPG------------------------IKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKG------------EIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  GE G+PGEKG  GA   +GLPG +GE                                          PG QG  G  G +G+ G  G RG P   G+ G  GP G  G RG  LPG                        ++G+ GE G  G  G KGDRG  GE G  G PG+ G +G              GDKG +  G  G  G  G  G  G  G  GP GP G  G  G  G
Sbjct:    5 GPKGAGGEPGKPGEKGIPGAPGLRGLPGKDGETGAQGPPGPAGPAGERGEGGPPGPPGFQGLPGPSGPPGEAGKPGAQGVPGEAGKVGVSGARGERGFP---GERGAPGPQGLQGARG--LPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDA--GPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDG 242          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005957.1 (pep scaffold:Pmarinus_7.0:GL476764:306565:325487:-1 gene:ENSPMAG00000005260.1 transcript:ENSPMAT00000005957.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 2.217e-28
Identity = 134/335 (40.00%), Postives = 170/335 (50.75%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGI------SGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGL------EGIRGPRGPIGL---VGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGT 2282
             GN G+ G +G PGI G +G  G  G  G+KG KG  G+SG KG SG PG+  + G                 +G  G  G  G  G+NG++G KG  G  GI       G+KGD G+ G  G  GL G  G+ G+ G  G  G+PG +G KG  G  G  G+ G +G++G  G  G  G  G +G  GP+G  GL G  G+ G  G   PG  GV+G  G  G  GE G  G  GE G  G  G  G+KG+ G  G+   G  G+ GT G++G KGL       G  GP+GP G+    GE G  G +G  G+ G  G KG  GLPG+PG  GT
Sbjct:  251 SGNPGDDGAMGDPGIEGPLGFPGPKGMAGLKGEKGEYGESGKKGESGLPGRNGLDGA----------------KGKTGRIGSPGCKGDNGDLGPKGGLGNAGIRGTPGDEGDKGDPGRQGSSGPRGLNGTEGEKGVPGYPGNPGRPGARGVKGKPGAKGSAGDKGYRGDLGTFGPPGPDGGKGEKGDAGPDGSRGLPGERGNSGEIGD--PGFPGVRGPTGGNGTKGETGSGGDPGEPGLRGGVGPEGVKGDPGRDGIGFPGPRGESGTPGDSGTKGLPQTQGARGFSGPKGPPGMKGIPGEKGDPGPSGETGDRGLRGPKGPVGLPGMPGSPGT 567          

HSP 2 Score: 120.939 bits (302), Expect = 4.836e-28
Identity = 150/413 (36.32%), Postives = 187/413 (45.28%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVK----GEAGVQGSQGMP---GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK---GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKG---DRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            ++GEKG  G  G+PG  G +G+ G+          G  GFPG  G+ G+  +    GE+G +G  G+P   G  G KG TG  G+PG                               +G+ G++G  G LG  G  G PG +G KG  G  G SGP+G +GT G+                         +G PG  G PG  G  GVKG+ G  G +G+K   GD+G  G  G DG  GE G  G  G +G  G+ G  G  G  G PG+ G  G  G  G  G  G PGE GLRG  GPEG +      GD G  G   P   G +GE G  GD G KG    +G +G +G  G PG  GI GE GD G S           G TG +GL   RGP+GP+GL G  G  G
Sbjct:  241 RKGEKGNRGDSGNPGDDGAMGDPGIE---------GPLGFPGPKGMAGLKGEKGEYGESGKKGESGLPGRNGLDGAKGKTGRIGSPGC------------------------------KGDNGDLGPKGGLGNAGIRGTPGDEGDKGDPGRQGSSGPRGLNGTEGE-------------------------KGVPGYPGNPGRPGARGVKGKPGAKGSAGDKGYRGDLGTFGPPGPDGGKGEKGDAGPDGSRGLPGERGNSGEIGDPGFPGVRGPTGGNGTKGETGSGGDPGEPGLRGGVGPEGVK------GDPGRDGIGFP---GPRGESGTPGDSGTKGLPQTQGARGFSGPKGPPGMKGIPGEKGDPGPS-----------GETGDRGL---RGPKGPVGLPGMPGSPG 566          

HSP 3 Score: 90.5077 bits (223), Expect = 1.281e-18
Identity = 116/297 (39.06%), Postives = 138/297 (46.46%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-------VAVKGEAGVQGSQGMPGYKGEKGN---TGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGT 1865
            G KG  G  G PG KGD    G  G KG  G+ G RG PG+ G KG          +G  G +G +G+PGY G  G     G+ G PG  G AG++G +G  G  G  G  G  G +G+ G  G  GLPG  G  G  G PG  G++G         P G +GT G+                       G  GDPG  G+ G  G  GVKG+ G  GI G  G  G+SG  G  G  G P   G +G  G  G PG KG  G KG PG  GE GD+G  G  G +GLPG  G  GT
Sbjct:  306 GAKGKTGRIGSPGCKGD---NGDLGPKGGLGNAGIRGTPGDEGDKGDPGRQGSSGPRGLNGTEGEKGVPGYPGNPGRPGARGVKGKPGAKGSAGDKGYRGDLGTFGPPGPDGGKGEKGDAGPDGSRGLPGERGNSGEIGDPGFPGVRG---------PTGGNGTKGET----------------------GSGGDPGEPGLRGGVGPEGVKGDPGRDGI-GFPGPRGESGTPGDSGTKGLPQTQGARGFSGPKGPPGMKGIPGEKGDPGPSGETGDRGLRGPKGPVGLPGMPGSPGT 567          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 2.312e-27
Identity = 198/691 (28.65%), Postives = 273/691 (39.51%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNI------------------------GVKGEKGLMGISGE---------KGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPG------------ESGLRGTPGPEGDEGLHGPIGDDGPRGTAL----------------------------PGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIG---------------DKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLIT---IFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQL---QITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHIS-QLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNK 2873
             G +G PGE G  G+      +GEAG  G  G PG  G +G +G  G  G  G  G RG+ G  G  G  G +G  G +G  G  G  G PG  G  G  G  G+ G  G +G  G++GP GNS                       +  +RGP G PG  G PG  G +                        G++GE G  G SGE          G+ G SG  G  G  G PG  G+ G +G +G PG++G +G  GLPG  GEPG QG  G  G  G  G            ESG  G PG +G  G  G  G+ G RG                               PG  G  G  G  G  G  G  GP+G+ G+ G  GE GIKG  G               D+G++ V G  G  G  G TGP G +GI G  GP G  G  G+ G  G  G  G  G  G  G  G     G +    +A+ ++ + +  ++    + +   K +N    ++++++      +               P  SC+D+ L   +   +  E  W+DPNEG   D+ K  C     +       P L   R ++         +  D +  W  E    G          G P++  QL FL++ S  A Q++ + C+ S+ Y   LD++
Sbjct:  544 AGLQGMPGERGASGLPGAKGERGEAGPVGIAGGPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNS----------GPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQRGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGLPGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARGLPGPTGPSGKDGISGNPGPAGPAGPRGRTGETGPPGPPGSPGPPGPPGSSGAGYDMGAYAGL-MARRKMGDQATDMLPYGLVLDASIKALN---AQVESITSPDGSRK--------------HPARSCRDLMLCHPEYKSDTGE-YWIDPNEGCRADAIKVWCNMETGESCVNPGMPSLP--RKNW------WRSQAADKKHVWLGETMSPGSQF---TYGDGSPNMEVQLTFLRLLSTDASQKITYHCKNSVAY---LDSR 1191          

HSP 2 Score: 82.4185 bits (202), Expect = 3.679e-16
Identity = 136/434 (31.34%), Postives = 165/434 (38.02%), Query Frame = 3
Query: 1149 VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMG---------------ISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGE---------------------------------IGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIG------------------------EKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGN------------TGPKGLEGIRGPRGPIGLVGEVGKV 2195
              G  G  G  G PG KG  G  G  G  G  G                          G+ G  GE GLPG  G  G+ G        G  G  G  GP GN G+PG     G +G  G+ G  G     +GP G+   +G PGE G++G  G  GL G                 GE+G+ G  G  G  GL G PG  G  G  GE G PGE G  G  G  G  G PG++GE                                 +GA GL G+PGE G  G PG +G+ G  GP+G  G  G    G +G+ G +G  G  G                        E+G+ GP G  G PG PG  G+ G  G+ G     G+ G+ G  GN            TG KG  G  GP G  G  G  G+V
Sbjct:  309 APGSRGAPGGDGSPGAKGPPGERGATGPAGAKG------------------------NSGDPGRPGEAGLPGPRGSTGSPGH------AGSDGKTGPPGPAGNDGSPGSPGAAGARGAPGAMGFPGA----KGPSGE---SGKPGEKGSVGPVGPIGLPGKDGDAGPAGPAGPAGPGGERGEAGPVGAPGFQGLPGAPGAPGESGKAGEPGLPGENGMPGGAGPRGERGAPGERGESGAGGPPGPRGSNGAPGQDGSRGAAGPPGPAGTVGAAGLQGMPGERGASGLPGAKGERGEAGPVGIAG--GPGKDGPRGLSGPVGPAGPTGSNGERGEGGPPGPAGPAGGRGAPGERGEPGPPGSAGFPGAPGADGMPGARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRV 703          

HSP 3 Score: 60.4622 bits (145), Expect = 1.904e-9
Identity = 133/425 (31.29%), Postives = 163/425 (38.35%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYK------------------GEKGNTGIGGNPGLLGF---AXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKI------------GTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS---------GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEI------------------------------GQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPG------------PEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENG 2021
            +RGE G  GS G PGA                        PG +G+ G   +GEAG  G++G PG                    G KG+ G  G PG  GF   AG  G  G  G  G  G  G  G+ G+RG  GE G PG  G++            G+SG  G  G +G  G+ G +G +G  G PG+                      RG +G  GL G PGE G  G  G  G  G S         G  G+ G+ G  G DGL   PG+ GIQG KG+                               G+PG  G  GA G  G  G  G  G  G  G  G  GE G++G  G              GD G+ G  G  G RG  LPG  G  G+ G+ G+ G  G  GP+G  G
Sbjct:  621 ERGEPGPPGSAGFPGA------------------------PGADGMPG--ARGEAGETGARGEPGQAGPPGNSGPSGPVGPPGATGAKGDRGPAGPPGATGFPGAAGRVGPPGSAGGPGAPGPAGPDGKDGSRGMRGETGPPGKSGEVGAAGPAGPPGEKGSSGSDGPAGPQGAPGSAGLAGSRGLVGMPGQ----------------------RGERGFSGLPGAPGEPGRQGPPGPAGERGASGPAGPPGIPGPSGESGRDGNPGSDGL---PGRDGIQGNKGDRGPGGNAGPPGSPGPAGPPGAPGPAGNNGNKGEPGPAGPSGASGTTGARGPAGPAGPRGDKGDAGSAGEGGIKGHRGFSGLPGLPGPPGAPGDRGIAGVFGSAGARG--LPGPTGPSGKDGISGNPGPAGPAGPRGRTG 992          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003566.1 (pep scaffold:Pmarinus_7.0:GL476944:532:45496:-1 gene:ENSPMAG00000003220.1 transcript:ENSPMAT00000003566.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 6.838e-27
Identity = 168/486 (34.57%), Postives = 218/486 (44.86%), Query Frame = 3
Query:  876 NEMEKCVIDKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPG------LLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTS--------GKPGKQGIKG--------FKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENG--NIGVKGEKG--------------LMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGT-----------IGNTGPKGLEGIRGPRGPIGLVGE 2183
            N  +  V+DK L +MS             S      A+   ++GE+G  G +G PGA G+                   G PG  G KG A + G  G  G +G PGYKG+KG+ G  G PG        G AG RG +G +G  G  GE+G  G QG +G+ G +G PG+ G+ G          G PG+ G  G          G  G SGP G  G PG+                       GP+GD G  G  G  G    GVKG+KG               +GI GEKG+ G  G  G  G  GE    G+ G KG+ G  G+ G +G  G+    GEPG +GEIG+ GL G+PG  G  G+PG +G+ G  GP G +G  G  + G KG  G  G  G  G  G  G  G  G PG+PG +G+ G     G S++G  G++G            +G  GPKG  G+ G  GP+G  GE
Sbjct:  176 NMRDSGVMDKLLKEMSL----------LASEGCAAPAKCACEKGERGPAGLQGKPGAAGE------------------DGIPGVKGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETGIGLHGPKGDLGPPGRAGPAGPPGVGEPGLPGPQGPSGPSGERGLPGEGLP--------------------GPKGDRGFDGPRGARGLQGSGVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGE----GLVGPKGDRGLTGDSGPQGPSGI----GEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAGIGVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGS---PGRSIVGPKGEHGPPGPAGFVGEPGMGLPGPKGDRGLPGAPGPVGSKGE 602          

HSP 2 Score: 101.679 bits (252), Expect = 3.658e-22
Identity = 140/415 (33.73%), Postives = 178/415 (42.89%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGL--------------------------------------EGIRGPRGPI-----------GLVGEVGKVG 2198
            +G  G PG  G  G +  GE G+ G +G+PG KG++G  G  G  GL G      K  +                G +GE GE G  G+ G  G  G+ G  G KG +G  G SGP+G SG                                    G PG  G IG  G  G+ GI GE G  G+ G++G  G  G  G  GI G++GE G PG +G +G  G  GI G PG +GE G  G +GLPG  G R   GP+G+ G  GP G  G  G  LPG KG +G  G  G +G KG+  P G  G PG+PG    +GE+G +G+ + G  G  G+ G  GP GL                                      +G+ GPRGP            GL GE G+ G
Sbjct:  347 VGEPGLPGPQGPSGPS--GERGLPG-EGLPGPKGDRGFDGPRGARGLQGSGVKGDKGDIGLLGLPGPLGLPGV--GIQGEKGEHGPRGMTGPRGPPGE-GLVGPKGDRGLTGDSGPQGPSGI-----------------------------------GEPGPKGEIGSPGLSGIPGILGEDGSPGQKGEIGSPGPRGPEGSAGI-GVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPG-RSIVGPKGEHGPPGPAGFVGEPGMGLPGPKGDRGLPGAPGPVGSKGEGYP-GPAGQPGLPGP---QGELGPEGVGLPGPKGDLGSRGLPGPPGLTGEGLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTGEGLTGPKGDRGLPGERGRKG 714          

HSP 3 Score: 97.8265 bits (242), Expect = 6.865e-21
Identity = 132/346 (38.15%), Postives = 168/346 (48.55%), Query Frame = 3
Query: 1101 IGFRGFPGEN--GIKG-VAVKGEAGVQGSQGM--PGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSG--------KPGKQGIKGFKGNVGKSG---PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE--IGQPGEKGTKGAKGLPGI-----EGEPGDQGEIGAMGLIGLPGESGLRGTPGP-EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIG 2066
             G RG PGE   G KG   + G++G QG  G+  PG KGE G+ G+ G PG+LG                          G+ G+ GEIG PG  G  G++G         PG +G +G  G VG SG    KG  G PG++ + G  G              +G  G PG AG  GE G +G+ G KG  G+ G  G +G  G+ G  G  G+PG  G QG  G   +G PG KG  G++GLPG      EG PG +G IG  G  G        G  GP +G++G  G +G  GP G    G+ G KG+ GL G+ G KGDRG +G+ G  G PG  G KGE G
Sbjct:  431 TGPRGPPGEGLVGPKGDRGLTGDSGPQGPSGIGEPGPKGEIGSPGLSGIPGILG------------------------EDGSPGQKGEIGSPGPRGPEGSAGIGVQGEKGDPGPRGPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRSIVGP--------KGEHGPPGPAGFVGEPG-MGLPGPKGDRGLPGAPGPVGSKGE-GYPGPAGQPGLPGPQGELGPEGVGLPGPKGDLGSRGLPGPPGLTGEGLPGPKGSIGRQGPSGP-PGPQGEGIQGPKKGEQGFQGMVGPRGPTGE---GLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAG 738          

HSP 4 Score: 90.8929 bits (224), Expect = 8.852e-19
Identity = 99/256 (38.67%), Postives = 131/256 (51.17%), Query Frame = 3
Query: 1551 QGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLP------------------GIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVK------GEMGLIGD--IGEKGDRGPKGENGNPGIPGEVGIKGEIGD------------KGLSVIGKIGKYGTIGNTGPKGL--EGIRGPRGPIGLVGEVGKVG 2198
            +G+ G AG+    G  G  GE G+ G+ G KGD G +G  G  GL G PG  G +G +GE G PG+KG +G +G                    GIEG  G +G+ G +G  GL GE+G+ G  GP+GD G  G  G  GP G   PG+ G +      GE GL G+   G KGDRG  G  G  G+ G  G+KG+ GD             G+ + G+ G++G  G TGP+G   EG+ GP+G  GL G+ G  G
Sbjct:  208 KGERGPAGL---QGKPGAAGEDGIPGVKGSKGDAGLNGSPGASGLEGRPGYKGDKGDRGECGAPGDKGDRGPEGPAGPRGMRGPQGPPGPTGEQGIEGIQGPKGDRGPVGPPGLQGETGI-GLHGPKGDLGPPGRAGPAGPPGVGEPGLPGPQGPSGPSGERGLPGEGLPGPKGDRGFDGPRGARGLQGS-GVKGDKGDIGLLGLPGPLGLPGVGIQGEKGEHGPRGMTGPRGPPGEGLVGPKGDRGLTGDSGPQG 458          

HSP 5 Score: 59.3066 bits (142), Expect = 4.513e-9
Identity = 91/273 (33.33%), Postives = 109/273 (39.93%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEK--GNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGE-----KGDIG------------------KSGKLGKDGLIGEPGKIG--IQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGL 1838
            G RG PG  GI G+   KGE GV G  G+PG  G    G  G  G PG  GF                            GE G +GLPG  G  G  G PG  G KG     G  GP G  G PG                        GP+G     G+PG  G++G +G  G  G++GE     KG IG                  K G+ G  G++G  G  G  + G KG+ G PGE+G KG +G  G  G  GD G  G+ G  GL
Sbjct:  522 GPRGVPGPVGISGLPGAKGEPGVPGRLGLPGSPGRSIVGPKGEHGPPGPAGFV---------------------------GEPG-MGLPGPKGDRGLPGAPGPVGSKG----EGYPGPAGQPGLPGPQG-------------------ELGPEG----VGLPGPKGDLGSRGLPGPPGLTGEGLPGPKGSIGRQGPSGPPGPQGEGIQGPKKGEQGFQGMVGPRGPTGEGLTGPKGDRGLPGERGRKGDRGDQGDTGPSGDPGRAGSKGEAGL 739          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 159.073 bits (401), Expect = 1.509e-39
Identity = 233/786 (29.64%), Postives = 339/786 (43.13%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKG------------LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGP---------------------------------RGTALP-GIKGVKGEMGLIGDIGEKGD---RGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKI---DAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGY-----PHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTF--TKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            G KG +G+KG  G +GD GE+G  G KG  G++G +G PG+ G   V V+G  G  GS+G+PG  G+         PG +G+ G                     R+G +G  G  GLPG  G  G+ G  G  G+KG KG +G  G +G  GTPG +   G +     K        ++GP G+ G  G  GE G +G++G++G     G++G IG+  K G+ GL GE G IG QGL+G  G  G+ G +G +G             PG  G+ GD G  G  G IG  GE G +G+PG  G  G  G +GD GP                                 RG   P GIKG++G  G IGD G KG     GP+G +GNPG+ G  G +GE G  G   +G+ GK G  G  G  G  G  GP G  G +G++G  G+ G+                G  G+RG         +    ++   + +  + T +I   +  +   +   + KT L S ++           P  +C +++    I+  E  W+DPN+G S D+ K  CK   +K   E      +CVR +         LK    E TW +             L +GY      +  QLNFL++ +    Q++   C+  +V+     +  S  Y+  F  F+ +                     + + + RS  NV  L D CK+   G +  T++L  T K   LPIVD+   + +       G  I P CF+
Sbjct:  440 GTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGE--VGVRGPNGELGSEGVPGEVGK---------PGPIGYQG---------------------REGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQG---SRGDRGPIGERAKDGEKGLKGETGPIGGQGLEGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAYGPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGR--LGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSL---------------GSKGRRGKLGPPGEPGKPGEILN---LHLLKQNTHLIVNDKKSLYLSEMDDKSKTPLGSRAN-----------PALTCHELKHVNGIKDGE-YWIDPNQGCSSDAIKVYCK---FKTGGE------SCVRPA---------LKMIPKE-TWNNATTAGWYQFS--KLERGYKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVW--FHRHSKSYDYSWKFHGFNGHQ--------------------FTYNSSRSSLNV--LRDACKYDD-GRWRRTELLFETTKLRTLPIVDFTYYHRSLTTPEEFGVKIEPVCFL 1112          

HSP 2 Score: 111.309 bits (277), Expect = 9.660e-25
Identity = 112/281 (39.86%), Postives = 144/281 (51.25%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGL-IGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRG 2162
            QG  G+ G IG PG+ G  G  G  G+ G++G +G  G  GPKG  G  G                      ++GP GD G  G+ G NG +G +G  G +G  G  G  G+ G  G +GL G PGK G++G +G  G  G KG KG  G+PG  G+ G  G+IG  G   G+PG++GLRG  G +G +G  G +G            +G KG MGL GD G +GDRGP GE       GE G+KGE         G IG  G  G TG +G +GIRGP+G
Sbjct:  424 QGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMG----------------------SKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGK-----------RGEKGFMGLQGDQGSRGDRGPIGERAK---DGEKGLKGE--------TGPIGGQGLEGRTGVQGDDGIRGPQG 660          

HSP 3 Score: 100.523 bits (249), Expect = 2.173e-21
Identity = 121/303 (39.93%), Postives = 146/303 (48.18%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEG---LHGPIGDDGPRGT-------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G++G  G  G+ G+LG  G  G PG+QG  G KG VG  G  G  G  GK    G+KG              RG +G  GL G  G  G  G  G KG +GI      IGKSG  GKDG  G  G+ G  G  G  GQ G  G+ G  GL G +G  G +G+ G  G+ G  G +G  G PGP+G  G     G +GD G  G           G++G +G MGL GD G  G  G KG  GN GIPG  G  G IG KG+     +G  G  G  G +GL G RGP G +G  G  G  G+ 
Sbjct:   11 GDQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKG-------------ERGSKGKSGLPGDKGPVGPPGHPGHKGAIGI------IGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGI-----LGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQ 289          

HSP 4 Score: 93.5893 bits (231), Expect = 2.719e-19
Identity = 133/372 (35.75%), Postives = 174/372 (46.77%), Query Frame = 3
Query: 1014 GTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNP---------------GLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIG---LPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEV 2045
            G +GS+G PG   D G +G  G +G  GD G RG PGE G  GV            KGE G +G  G+ G +G KG +G+ G+                G++G +G+ GK G +G  G+ G  G +G +G +G +G IG   L G  G++G  G  G  G+ GFKG+ G +G  G  GT G +                     +G  GD G  G+PG  G+IG  G +G  G  G KGD G  G  G  G  G  G  G QG  G IG  G  G  GA G+PG  G  G +G  G +G  GLPG  G +G PG                     PGI+G +G  G+ G  G  GD G  G+ GN G+PG++
Sbjct:    2 GLMGSRGTPG---DQGGRGPQGVQGLLGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGA-------------------KGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPG--------------------KPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDI 331          

HSP 5 Score: 84.7297 bits (208), Expect = 1.234e-16
Identity = 96/244 (39.34%), Postives = 123/244 (50.41%), Query Frame = 3
Query: 1545 GPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGP------KGENGNP----------GIPGEVGIKGEIGDKGLS-VIGKIGKYGTIGNTGPKGLEGIRGPRGPI---------GLVGEVGKVG 2198
            GP G  G  G PG  G  G +G  G  G+SG KG+IG  G++G  G  GE G  G +G  GE          G+KG PG  GE G +G  G +G  G+PGE G  G  G +G EG  GP G  G     LPG +G++G  G  G  G KG +GP      +G++G P          G+PG+ G++G +G KG     G +GK G  G  G +G +G RG RGPI         GL GE G +G
Sbjct:  410 GPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGE---------MGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPG-----LPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRGEKGFMGLQGDQGSRGDRGPIGERAKDGEKGLKGETGPIG 639          

HSP 6 Score: 76.6406 bits (187), Expect = 4.423e-14
Identity = 109/288 (37.85%), Postives = 142/288 (49.31%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRG 1862
            KRGEKG +G +G  G++GD            +G IG R   GE G+KG     E G  G QG+      +G TG+ G+ G+ G  G +G  G  G +G  G  G+ G  G++G+ G+IG  G  G+ G+ G  G  G KGF G+VG  G KG  G       +         G       +RGPQG  G+ GI G +G IG  G KG  G+ G +G  G  G LG+ G  GE G  G  G +G+ G  GE G  G +G  G  G PG  G++GA G  G  G  G RG
Sbjct:  598 KRGEKGFMGLQGDQGSRGD------------RGPIGERAKDGEKGLKG-----ETGPIGGQGL------EGRTGVQGDDGIRGPQGKQGGVGPTGGHGPPGPMGDDGDAGSKGKAGKIGTKGEPGRKGSPGDIGYVGPKGFLGDVGPLGEKGGQGAY-GPLGEPGGPGPKGGGGPKGKLGDRGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGDMGAKGHPGSLGSKGRRG 861          

HSP 7 Score: 68.1662 bits (165), Expect = 1.551e-11
Identity = 94/280 (33.57%), Postives = 120/280 (42.86%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKS------GPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEI 1814
            L  +G+KG VGS G                       G +GF G  G+KG A        G  G+ G+KG  GNTGI G  G +G  G                      +G  G++G  G+PG +G IG SG  G QG  G KG+ G        G  GN+G PG                       +G  G  G  GI G+ G  G+ G +GL G  G +GD+G SG  G  G  G+PGK GI+G +G  G  G+ G+ G  G PG EG  G  G+I
Sbjct:  124 LGAKGQKGGVGSIG---------------------PSGLQGFQGRMGLKGDA--------GYDGVDGFKGHAGNTGIPGPQGTMGPIGA---------------------KGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGP----------------------QGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEGLPGDI 331          

HSP 8 Score: 56.6102 bits (135), Expect = 5.670e-8
Identity = 58/137 (42.34%), Postives = 72/137 (52.55%), Query Frame = 3
Query: 1821 MGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----------SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            MGL+G  G  G +G  GP+G +GL   +GD GPRG     G  GVKG +G  G IG KG++G +G +G  G  G  G  G  GDKG             IG IGK G+ G  G +G  G  GP G +G  G+ G VG
Sbjct:    1 MGLMGSRGTPGDQGGRGPQGVQGL---LGDRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVG 134          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO49368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG67])

HSP 1 Score: 152.91 bits (385), Expect = 1.851e-38
Identity = 210/770 (27.27%), Postives = 305/770 (39.61%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVA-VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTP---GPEGDEGLHGPIGDDGPRGTA--LPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG---------------------------------TFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKML-LSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            K G  G  GS+G PG KGD GE G          +G RG  GE G  G A  KG+AG  G  G PGY G KG  G  G  G  G +                     G +GN+G+ G  G  GI G  G  G PG QG +G  G  G +G KG +G PG+                     +RG QG  G  G  G  G  G+ G  G  G  GE+G+ GK G+ G+ G +GE   +G  G  G  GQPG  G  GA G P   GE G QG  GA GL G PG  G  G P   GP G++G  G  G  GP+G A   PG  G+ G  G+ G  G  GD GP GE+G PG+ G  G++G+ G  G     G+ G  G+ G  G  G  G  G +G  G++GE                        PG PG RG                                  +I+  +  +  +N      ++ + + ++I F  V + AV  +   L +       +  +   P  SC+++++    +     ++DPNEG+  D+ +  C   ++  +A  + P  T + +      L+      D+  T   ++++D  +            + Q+ FL++  + A+Q + + C  S  + D                                      + I L  +        +  +EC+ K       +L +ST + D LPI+D       D  +  +   + P CF 
Sbjct:    2 KSGAPGPQGSQGVPGTKGDRGEPGA---------VGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVS---------------------GEKGNQGKRGPAGA-GIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAG-------------------DRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGE---VGPTGSPGPAGQPGVSGEAGADGTP---GERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRGEKGAKGDRGSKGPKGGASGFPGKPGLPGNPGIPGIGGRDGDMGPAGEDGRPGLSGLPGLRGQSGPAGEKGANGEPGSAGSPGTPGAMGPPGDSGSKGAAGIIGE------------------------PGSPGPRGPIGPQGDPGPEGPPGPPGPPGPPVSVNKLSHCIPYIIFAITGDNNANKQMFEESVSSTKQQLICFLDVCLIAVINL---LINKIVTYKEQEGTKGKPARSCRNLKIDNPDKKSGYYYIDPNEGSPSDAEEVWC---DFTTNATCVFPKNTEIITR----SLVVNSNGEDTWITENDDVKIDYKL-----------DVVQMKFLRLMHKTAKQNMTYHCYNSRAWED-------------------------------------SRTIKLLGDNEEEITAKLRLNECQNKDNQWHKTVLDISTKQKDKLPIIDVAPYDLQDGAQFKI--ELGPVCFA 631          

HSP 2 Score: 106.301 bits (264), Expect = 1.549e-23
Identity = 109/290 (37.59%), Postives = 131/290 (45.17%), Query Frame = 3
Query: 1371 GKIGTSGKPGKQGIKGFKGNVGKS---GPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGL------MGISGEKGDIGKSGKLGK-----DGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GK G  G  G QG+ G KG+ G+    GP+G  G  G                        GP+GD G  G  G  G  G KGE+G        G+SGEKG+ GK G  G      DG  G PG  G +G+ G  G  G+KG  GA G  G  G  G QG+ G  G  G  G  G+ GTPGP+G+ G  G  G+ G RG          GE+G  G  G  G  G  GE G  G PGE G +G  G  GL         G  G+ GP G  G++GPRG  G  G+ G  G
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPA-------------------GPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAV--------GEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLP--------GRPGSPGPAGAPGLKGPRGEKGAKGDRGSKG 255          

HSP 3 Score: 78.9518 bits (193), Expect = 5.931e-15
Identity = 89/223 (39.91%), Postives = 109/223 (48.88%), Query Frame = 3
Query: 1680 GLIGEPGKIGIQGL---KGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGL---RGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGP------KGENGNPGIPGEVGIKGEIGDK----GLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNL 2300
            G  G PG  G QG+   KG+ G+PG  G +G +G  G  G  G +G+ G  G  G PG  G    RG PG +G +G+ G  G+ G RG A  GI G  G  G  G  G +G  GP      KG NG PG  G+ G +G  G K    G    G  G  GT G  G +G +G  G +G  G VGEVG  G  G  G+ G  GE G  G PG  GQ+G+     L
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGL 223          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO33050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC3])

HSP 1 Score: 135.191 bits (339), Expect = 2.240e-32
Identity = 180/451 (39.91%), Postives = 236/451 (52.33%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNP---------------GLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIG---LPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPG------ENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGN------PGIPGEVGIKGEIGDKG-LSVIGKIGKYGTIGNTGPKG----------LEGIRGPRGPIGLVGEVGKVG 2198
            G  G++G  G  G  GD G +G  G +G  GD G RG PGE G +GV            KGE G +G  G+ G +G KG +G+ G+                G++G +G+ GK G +G  G+ G  G +G +G +G +G IG   L G  G++G  G  G  G+ GFKG+ G +G  G  GT G +  KGI G  G+ G+ G   +N  RGP+GD G +G+PG      + G  G++G +GL G+SG+ G IG  GK G    IGE G  G QG+KG+ G  G +G  G  G+ G++G PG  G+ G  G  G  G  G  G PGP+G EG  GPIG  G  GT   G  G KG +GL GD GE+G  GPKG  G+      PG  G  G+ G  G KG + V G  G++GT G+ GP G          L G  G +GP G  G VGK G
Sbjct:  357 GSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGN---IGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTK--GNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSESGVPGKTGLRGPMGHKGPDGEKGYVGKRG 802          

HSP 2 Score: 128.642 bits (322), Expect = 2.555e-30
Identity = 160/404 (39.60%), Postives = 208/404 (51.49%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGN---VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIG------LPGESGLRGTPGPEGD---EGLHGPIGDDGPRG----TALPGIKGVKGEMGLIGDIGEKG---DRGPKGENG---------NPGIPGEVGIKGEIGDKGLS-------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G RG PGE G  G    V + G  G+QG  G  G++G KG  G  G+PG +G  G+RG  G +G  G +G +G +G +G RG  GE G  G+ G +G+ G  G++G KG +G     G+ G KG SG PG     G  G             ++G  G  G +G PG++G+ G  GE G  G  G KG  G  G +G  GL G  G++G   LKG+ G  G  G KG  G  GI G  G  G IGA G++G      +PG  GL GT GPEGD    GL GP G  G  G        G++GV G+ G IGD G+KG   ++GP GE G         N G+PG++GI G  G  G++         G  G  G +G+ GP+GLEG RGP G  G+ G  G +G
Sbjct:  312 GKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGH----------PGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMG---LKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIG 702          

HSP 3 Score: 117.857 bits (294), Expect = 5.553e-27
Identity = 140/386 (36.27%), Postives = 188/386 (48.70%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGN------IGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEG 2144
            G  G +G+KG  G  G IG              G +GF G  G+KG A        G  G+ G+KG  GNTGI G  G +G  G +G  G  G  G  G +G  G +G  G++G  GLPG  G  G  GKPG +G +G +G  GK+G  G+ G  G +                     +GP G+ G+ G PG+ GN      IG+ G +G  G++G+ G  G +G  G  G +G PG  G++G +G IG+PG  GTKG  G  G  G  GD+GE G  G  G  G+ G +G PG EG  G++G  G  GP      G+ G +G+ G  GDIG  G           G+PG+ G++G +G KG       G+ G +G  G KG  G
Sbjct:  480 GPTGALGAKGQKGGVGSIGPS------------GLQGFQGRMGLKGDA--------GYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGKKGNIG-------------------EKGPSGEQGMKGDPGDEGNEGLPGDIGIIGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPI-----GVPGFRGQHGTPGDIGPPGSES--------GVPGKTGLRGPMGHKGPD-----GEKGYVGKRGEKGFMG 808          

HSP 4 Score: 87.4261 bits (215), Expect = 1.549e-17
Identity = 99/286 (34.62%), Postives = 128/286 (44.76%), Query Frame = 3
Query: 1539 NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGI------EGEPGDQ------GEIGAMGLI------------------------GLPGES---------------GLRGTPGPEGDEGLHGPIGDDGPRGT-------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            ++G QG  G  G+PGE G+ G+ G  GL G  G +GD G+ G  G  G+ G PG  G  GL G  G PG++G +G +G+ G+       G PG+Q      G +G+ GLI                        GLPG+                G+ G  G  G +G  GP G+ GP G                 G++G +G MGL GD G  G  G KG  GN GIPG  G  G IG KG+     +G  G  G  G +GL G RGP G +G  G  G  G+ 
Sbjct:  304 HQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGRGPQGVQGLLGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGI-----LGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQ 584          

HSP 5 Score: 77.411 bits (189), Expect = 2.307e-14
Identity = 108/294 (36.73%), Postives = 133/294 (45.24%), Query Frame = 3
Query: 1431 VGKSGPKG------NSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG------------------VKGEKGLMGISGEKGDIGKSGKLGKDGLIGE---PGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----------VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            VG  GP G      +               +            RGP+G+PG  G PG    IG                  +KG +GL G  G  G  G  G  GK GL GE   PG +G  GL G  G  G+ G KG +G  GI+G PG  G +G MG  G PG+ G R   GP+G +GL   +GD GPRG     G +GVKG +G  G IG KG++G +G +G  G  G  G  G  GDKG             IG IGK G+ G  G +G  G  GP G +G  G+ G VG
Sbjct:  221 VGSKGPDGLRGPHGDP-------------GRPGGPGMPGPRGYRGPKGEPGPKGEPGYKVCIGLYRESHSYQKAIEIAYQLIKGPQGLKGRPGYAGHQGVQGAKGKRGLPGEAGSPGLVGPVGLPGPEGIQGDPGQKGFEGAKGIKGFPGSPGSMGLMGSRGTPGDQGGR---GPQGVQGL---LGDRGPRGPPGEQGFRGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVG 495          

HSP 6 Score: 51.2174 bits (121), Expect = 2.115e-6
Identity = 87/232 (37.50%), Postives = 112/232 (48.28%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIG---FRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG 1682
            +G  G  GS G PG KG+IGEKG  G++G KGD G     G PG+ GI  + ++G  GV G  G  G  G  G  G  G+PG  G                         +G+RG +G+ G+ G  G IG  G+ G QG +G +G  G  G  G+ G+ G    +G  G  G KG++G   V   RG  G PG  G PG     GV G+ GL G  G KG  G+ G +GK G
Sbjct:  599 QGVSGKAGSIGDPGKKGNIGEKGPSGEQGMKGDPGDEGNEGLPGDIGI--IGMQGPPGVTGKDGQQGAAGPSGPRGALGHPGPQGL------------------------EGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGDMGSKGPPGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE--SGVPGKTGLRGPMGHKGPDGEKGYVGKRG 802          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO44697 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV65])

HSP 1 Score: 118.627 bits (296), Expect = 6.100e-27
Identity = 151/400 (37.75%), Postives = 185/400 (46.25%), Query Frame = 3
Query: 1110 RGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVG---KSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDP---------GLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---------KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGL---------RGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            +G  G  G+ G    KG +GV G+QGMPG +G  G+ G  G PG  G                  ++GE GRQG  G  G+ G PG  G  G  G+ G QG +G  G VG   K+GPKG +G PG+         +  +     +N  RG  G           G AG+PG  G  G +G  G+ G SG KG  G  G  GK G  GE G+ G +G+KG  G  G          KG  G  GL G  G  G QGE G+ G  G PGE GL         RG PGP+G  G+ G  G DGP G    G  G KG  G  G+ G  G  G  G NG  G PG  G +G  G +G +    + G  GK G +G TGP+G  G  G  GP G  GE G  G +
Sbjct:  251 KGATGNTGLMGAPGAKGSSGVPGAQGMPGPRGSTGDAGAEGQPGPAG------------------QRGEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGR-------DGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKGSRGIAGEAGPDGPAGAQ--GKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGEPGPQGPEGEAGANGVS 623          

HSP 2 Score: 93.2041 bits (230), Expect = 4.025e-19
Identity = 131/375 (34.93%), Postives = 165/375 (44.00%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGEN---------GNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQ---GLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP----GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS 2081
            G++G  G +G PGA GD                  RG PG  G +G    GE G QGS+G  G  G  G TG  G  G+ G                        R G +GE    G  G  G  G SG PG  G++G  G  G +GPKG+ G+PG ++                    RG  G+ G  GI G +         G  G KG  G  G+ G +G  G  G+ G DG  G PG+ G+Q   GL+G+ G PG KG++G  G  G +G  G QG+ GA G  G  GE G  G  G  G  G  G  G DG +G   P    G +G+ G  G  G +G  G RGP G+NG    PG  G +GE G  G+S
Sbjct:  297 GQRGEAGRQGPPGANGD------------------RGQPGAPGAEGAM--GEKGNQGSRGPTGRVGPDGKTGPKGQNGIPG------------------------RDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPG-VSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKGSRGIAGEAGPDGPAGAQGKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGE---PGPQGPEGEAGANGVS 623          

HSP 3 Score: 89.3521 bits (220), Expect = 5.875e-18
Identity = 140/357 (39.22%), Postives = 165/357 (46.22%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKG---------------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN-----RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPK 2009
            RG  G  G++G PG  G  GE G  G  G  GD G  G PG  G       GE G QGS+G  G  G  G TG  G  G+ G  G +G++   G NGQ+G  G  G  G  G  G  G+PG  G  G  G PG  G  G KG                 G+ GP+G  G  G     G++G  G KG  G + +       GPQG+ G  G  G  G  G++G  GL G  G  G  G  G  G+ G  G  G  G  G KG  G  GEKG  G  G  GI GE G  G  GA G  G  G +G RG PGP+G  G  GP G  GP G    PG +G +GE G  G  G KG+ GP+
Sbjct:  281 RGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEG-----AMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKGSRGIAGEAGPDGPAGAQGKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGEPGPQGPEGEAGANGVSGPKGEMGPE 632          

HSP 4 Score: 88.1965 bits (217), Expect = 1.360e-17
Identity = 108/316 (34.18%), Postives = 132/316 (41.77%), Query Frame = 3
Query: 1389 GKPGKQGIKGFKGN---VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIG------------LPGESGLRGTPGPEGDEGLHGPIGDDGPRG----------------TALPGIKGVKGEM---------------GLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GKPG    KG  GN   +G  G KG+SG PG   +                    GP+G  G AG  G+ G  G +GE G  G  G  GD G+ G  G +G +GE G  G +G  G +G  G+ G KG  G+PG +G  G++   GA G  G            L G +G+ G  GP+GD G  G  G  G +G                T   G +G+KG                 G IG  G +G RG  G  G  G  G  G  GE G     + G IG  G  G  GPKG  GI G  GP G  G  GK G
Sbjct:  243 GKPGMDRAKGATGNTGLMGAPGAKGSSGVPGAQGMP-------------------GPRGSTGDAGAEGQPGPAGQRGEAGRQGPPGANGDRGQPGAPGAEGAMGEKGNQGSRGPTGRVGPDGKTGPKGQNGIPGRDGRKGERAPDGANGQRGVTGPSGSPGPGGLQGAAGMPGPAGPKGDRGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGG-----LQGPIGLQGQRGPPGPKGSRGIAGEAGPDGPAGAQGKAG 534          

HSP 5 Score: 65.855 bits (159), Expect = 8.225e-11
Identity = 93/230 (40.43%), Postives = 108/230 (46.96%), Query Frame = 3
Query: 1545 GPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGE------------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GP G  GLAG  GE G  G  G KG  G  G  G  G SG  G +GL   PG  G +G KGE            +G  G+ G  G  G PG +G PG  G  G  G  GLPG    RG PG  G  GL G  G DG  G   PG  G +G  G  G++G  G  G +G  G  G+ G+ G+KGE G+         G  G  GN G  G  G  G +G  G+ GEVGK G
Sbjct:  760 GPDGPAGLAGSQGEQGPQGPVGMKGDNGPQGGAGAPGPSGGRGANGL---PGPRGSRGTKGEAGPPGPNGPKGNVGPAGQVGNNGQDGTPGKDGVPGTNGGKGQPGPQGLPGP---RGHPGGVGKVGLRGDRGKDGRDGE--PGALGPRGPTGNKGELGRAGRTGDQGVAGRRGVTGQPGLKGEKGES--------GNRGAPGNVGATGAMGETGDQGATGITGEVGKEG 973          

HSP 6 Score: 59.6918 bits (143), Expect = 7.677e-9
Identity = 106/304 (34.87%), Postives = 132/304 (43.42%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKG---------NTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGK---IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGP---------------EGDEGLHGPIGDDGPRGTAL 1934
            G  G PG  G KG   +G  GV G+ G  G KG +G          TG  G  G+ G +G +G  G++G  G KG  G  G QG RG  G  G  G  G  G  G+ G QG  G +G  G  GPKG+ G  G+                       GP G  G  G  G  G  G  GEKG  G+ G+ G  G+ G  G DG  G PG     G +G+ G  G+ G+ G  G +G  G  GEPG QG  G  G  G+   SG +G  GP                G +G  G  G+ GP+G A+
Sbjct:  390 GAAGMPGPAGPKGD--RGSPGVSGASGAKGAKGHEGGRGKRGQRGETGEQGPRGIKGASGLQGGPGLQGPGGFKGPIGPTGLQGARGITGPQGETGSDGAQGAPGEGGLQGPIGLQGQRGPPGPKGSRGIAGEA----------------------GPDGPAGAQGKAGAKGTTGPNGEKGPAGLDGKNGINGEDGAPGSDGAQGNPGPQGPTGTRGIPGPQGKNGKMGPTGPRGPSGKNGEPGPQGPEGEAGANGV---SGPKGEMGPEGEAGQPGPPGPPGPNGVDGNAGRQGEPGPKGNAV 666          

HSP 7 Score: 58.5362 bits (140), Expect = 1.448e-8
Identity = 96/257 (37.35%), Postives = 131/257 (50.97%), Query Frame = 3
Query: 1341 MGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-VIGKIGKYG 2108
             GE+G  G  G  G+ G+ G QG  G KG+   +GP+G +G PG    +                         G  G+PG  G+ G KGE G  G +G KG++G +G++G +G  G PGK G+ G  G  GQPG +G  G +G PG  G+ G +G+ G  G  G PG  G RG  G +G+ G  G  GD G     + G +GV G+ GL G+ GE G+R      G PG  G  G  GE GD+G + + G++GK G
Sbjct:  756 AGEMGPDGPAGLAGSQGEQGPQGPVGMKGD---NGPQGGAGAPGPSGGR-------------------------GANGLPGPRGSRGTKGEAGPPGPNGPKGNVGPAGQVGNNGQDGTPGKDGVPGTNGGKGQPGPQGLPGPRGHPGGVGKVGLRGDRGKDGRDGEPGALGPRGPTGNKGELGRAGRTGDQG-----VAGRRGVTGQPGLKGEKGESGNR------GAPGNVGATGAMGETGDQGATGITGEVGKEG 973          

HSP 8 Score: 51.6026 bits (122), Expect = 1.923e-6
Identity = 68/204 (33.33%), Postives = 86/204 (42.16%), Query Frame = 3
Query: 1743 GEKGTKGAKGLPGIEGEPGDQGEIG------------------AMGLIGLPGESGLRGTPGPEGDE---------GLHGPIGDDGPRGT----ALPG------------IKGVKGEMGLIGDIGEKGDRGPKGENGNPGI---------PGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE G  G  GL G +GE G QG +G                    G  GLPG  G RGT G  G           G  G +G++G  GT     +PG            + G +G  G +G +G +GDRG  G +G PG           GE+G  G  GD+G  V G+ G  G  G  G KG  G RG  G +G  G +G+ G
Sbjct:  757 GEMGPDGPAGLAGSQGEQGPQGPVGMKGDNGPQGGAGAPGPSGGRGANGLPGPRGSRGTKGEAGPPGPNGPKGNVGPAGQVGNNGQDGTPGKDGVPGTNGGKGQPGPQGLPGPRGHPGGVGKVGLRGDRGKDGRDGEPGALGPRGPTGNKGELGRAGRTGDQG--VAGRRGVTGQPGLKGEKGESGNRGAPGNVGATGAMGETG 958          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 112.464 bits (280), Expect = 4.531e-25
Identity = 176/472 (37.29%), Postives = 211/472 (44.70%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVK-------------------GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGE---NGNIGVKGEKGLMGISGEKGD------------------IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLR---------------GTPGPEGDEG------------LHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGEN------GNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            RG++G VG    PG  G  G +G  G  G  G  GF G PGE G KG A                     GE G+ G  G PG+ G  G  G  G  G +G  G  G +G  G  G +G +G  G +G RG  G  GL G  G  G+ G PG QG +G  G  G  G  G  G PG+  + G KG  G  G  GQ  + RGP G PG+ G PG    NG+ G  G  G +G  GEKG                    GK G++G  G IG+PG  G  G +G  G  G  G KG +G PG  G PG +G+ G+ G  G PG  GLR               G PG +G +G            L G  G  GP G A  G KG  GE G  GD G +G  G KGE+      G PG+ G+ G  GE G++G   +G  G  G  G  GP GL G  G  GP G  G  GK G
Sbjct:  173 RGQRGEVG---LPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGI-RGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVA--GAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERG--PVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPG 636          

HSP 2 Score: 112.464 bits (280), Expect = 4.531e-25
Identity = 157/440 (35.68%), Postives = 198/440 (45.00%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHP------------GAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGK------QGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE----------------GDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIG-DKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            K+  +GEKG+ G  G P            G  G +G  G  G  G +G  G RGFPG  G  G   KGE G  G+ G PG KG+KG++G  G PG +G  G  G+ G  G                    G+ GLPG  G+ G  G PGK      QG+ G  G  G +G KG +G PGK                   + + GPQ   G AG  GE+G  G +G  G+ G +G  G+ G+ G +G  G  G PG  G  GL G+ G+ G +G +G  G PG  GE G QGE G  GL G  G+ G RG+ G +                G+ G  GP G+ G      PG +G+ G  G  G  G KG RG +G  G PGI G+ G  G  G +      G  G+ G  G  G  G  G  G +GP GL G  G  G N
Sbjct:  397 KIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNG--RKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPG------------------REGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGK-------------------DGDTGPQ---GPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPG-----TPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRN 789          

HSP 3 Score: 109.383 bits (272), Expect = 4.140e-24
Identity = 187/625 (29.92%), Postives = 252/625 (40.32%), Query Frame = 3
Query: 1104 GFRGFPGENGIKGVA-------------VKGEAGVQGSQGMPG------YKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXX------XXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKG------------NVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAG---IPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIIN-FTQVKIDAVS-RMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVY 2852
            G  G PG NG +G +             +KG  GV GS G PG       +G  G+ G  G PG  G  G  G  G  G  G  G  G        GR G +G  GE G PG  G+ G  G PG+ G  G  G             +G+ G KG SG PG                      NRGP G PG+ G    PG++G  G  G  GL G +G+ G+ G  G+ GK G+ G  G+ GI GLKGE G PGE G  G +G PG  G  G  GE G  G  G  G+ G  G  GP G +G +GP GD G RG                   GEKGD+G  G +G+PG PG+ G +                       GP G+ G  GP GP G VG +G +G  G  G  G  G  G  GL  V G      ++     +L   SK      N     +    +++ID  + R  T +++              P  +C+D+++     +    W+DPNEG+  D+ +  C  S         K  L  +R          +L        ++ E ++D                SQ+ FL++ S+ A Q V + C+    +
Sbjct:  781 GTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITG-------------------NRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGP-----------------RGEKGDKGFTGSDGSPGAPGQQGEQ-----------------------GPPGVAGTDGPPGPRGNVGPMGPMGDPGLPGPPGPPGPPGYTGLSPVGGYLSVGTVEKGPGYRLYAGSKDAKKPDNPSVSFMTALEKMEIDVNTIRKPTGMKNN-------------PAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDFSCISPTKAKLLNLRVQANVNKKDKWL-----SEAFEEESQIDYSA-----------EQSQIAFLRVFSKRAYQNVTYNCQNYKAW 1317          

HSP 4 Score: 103.605 bits (257), Expect = 2.625e-22
Identity = 123/326 (37.73%), Postives = 158/326 (48.47%), Query Frame = 3
Query: 1326 GNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXX-XXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGK---DGLIGEPGKIG---------------IQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL----------------SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G++G  GE G PG LG    +G+PG QG++G  G  G  GP+G  G   + A                 SN   GP+G PGL G  G +G  G +GE GL G SG  G  G SG  G    DG  G PG+ G               ++G KGE G  GE+G  G  G PG +G PG  G  GA G +GL G++G RG  GP G +G+ G  G++G RG  LPG  G+KG+ G  G  G  G++GP+G +G  G  G+ GI G  G+ GL                 + G  G  G  GN G  G+ G RG  G  G +G  G+ G
Sbjct:   85 GDQGPSGEAGKPGPLG---YNGQPGNQGMRGDPGPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNEGARG--LPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKG 405          

HSP 5 Score: 99.3673 bits (246), Expect = 4.681e-21
Identity = 156/463 (33.69%), Postives = 193/463 (41.68%), Query Frame = 3
Query: 1023 GSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMP--------------------GYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLP---GILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT-ALPGIKGVKGEMGLIGD------------------------IGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG----------------------LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            G +G  G  GDIG++G  G+ G+ G +G+ G PG  G++G    G  G QG QG P                    G KG  G  G  G+PGL G                       G  G RG+ GE+GLP   G  G+ G SG PG  GI GF            SG PG+                         QG+ G AG  G  G  G+KG+KG  G  GE+G +G+ G+ G DG  G PG  G +G  G  GQ G +G  G  GL G+ G PG++   GA GL G PG  G RG  G  G  G  GP G  GP+G+    GI G  GE GL GD                         G  G  G  G+ G PG PG++G KGE G +G                      +  +G IG  G+ G TGP+G  G  GP G  G  G  G  G+
Sbjct:   73 GQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGDP--GPQGDQGPQGPPGGSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPG---------------------PRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGF------------SGAPGE-------------------------QGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTGQTGPRGPTGPPGLQGVRGAPGNE---GARGLPGNPGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGKRGKIGRVGPMGPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGF 472          

HSP 6 Score: 95.1301 bits (235), Expect = 9.151e-20
Identity = 140/445 (31.46%), Postives = 181/445 (40.67%), Query Frame = 3
Query: 1104 GFRGFPGENGIKG----VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNR-------------GPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGL---------KGEIGQPG------EKGTKGAKGLPGIEGEPGDQGEIGAM------------------GLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----------------------------TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            G  G PG++G  G       KGE+G+ GS+GMPG  G+ GN G  G  G +G                         QG +G  G  G PG+ GK G SG  G++G  G  G +G+ GP+G +G P  +     K           + V++             G QG  G  G PG  G  G  G +G  G  G +G+ G+ G  G DG  G PG  G+ G          KGE GQPG      + G +G +GLPG  G PG  GE GA                   G++G  G  G+ GT G  G  G  G  G  G +G                                G+KG  GE G  G  GE G+ G  G +G PGIPG      +         G+IG+ G  G +GP G+ G RGP G  G+ GE G  G +
Sbjct:  549 GANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGP------------------------QGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETG-PTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGKNGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGP-----DGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKD 963          

HSP 7 Score: 93.9745 bits (232), Expect = 2.068e-19
Identity = 170/536 (31.72%), Postives = 207/536 (38.62%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVK-----------GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIG---------------VKGEKGLMGISGEKG---DIGKSGKLGKDGLIGEP---------------------------------GKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPG---------------DQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG----PRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-------------------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
            K  + G +G  G+ G PGA G+ G +G  G  G  G  G  G  G NG  G  V            GE G QG  G PG  G +G  G  G  G  G                         +G+RGE G +G PGI GK    G PG  G+ G  G  G +G KG +G PG     G              N ++GP+G PG  G PG NG  G               +KG KG+MG SG  G    +G+ G+LG  G  G P                                 G+ G++G  GE G+PG  G  G  G PG +GEPG               + G  G  G  G PG +G RG PG  G +G  G  G DG    P    L G  G  GE GL G+ G+ G  G  G  G PG+ GE G  GE G  G                             GK GK G  G  GP G +G +G RGP G  G+ G  G +G+               PG PGQ+G
Sbjct:  619 KTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGA------------------------KGSRGERGRVGPPGIDGK---DGAPGSDGLNGPPGPQGPAGEKGEAGQPGTNGFNGK-------------NGDQGPRGLPGTPGAPGRNGEQGASGPTGPVGPRGPGGIKGAKGVMGSSGRPGITGTLGQRGRLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGSTGEGGRPGRDGEPGEPGTPGRDGEPGIPGPDGRPGERGPGGEIGRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGLRGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGS---------------PGAPGQQG 1099          

HSP 8 Score: 82.8037 bits (203), Expect = 5.536e-16
Identity = 84/222 (37.84%), Postives = 107/222 (48.20%), Query Frame = 3
Query: 1602 VKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLP-------GESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            VKG++G  G  G+ GD G SG+ GK G +G  G+ G QG++G+   PG +G +G +G PG        G   A G I  P       G  G  G PGP G  GL GP G DGPRG         +GE+GL G+ G  G RG  G  G+PGI G  G  GE G+KG +                  G +G+ G +G  G  G +G  G  G  G  G+VG  G
Sbjct:   71 VKGQRGPDGPPGDIGDQGPSGEAGKPGPLGYNGQPGNQGMRGD---PGPQGDQGPQGPPG--------GSTQAAGGIKGPDPNDLAAGIKGSNGAPGPRGSPGLPGPRGSDGPRGQ--------RGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPGLKGQKGEEGNLGERGMVGRPGRPGFDGAPGAPGSPGAEGKVGLTG 273          

HSP 9 Score: 75.8702 bits (185), Expect = 6.778e-14
Identity = 121/337 (35.91%), Postives = 154/337 (45.70%), Query Frame = 3
Query:  990 KLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG------------LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM 1964
            +L  +G +GT GS+G PG  G  G  G PG  G  G  G  G  G NG+KG    GE G  G  G P   GE G  G  G PG+ G  G  G++G  G              G +GE G  G PGI G  G  G PG +G +G+ G  G++G  G  G                          RGP G PG  G+PGE G  G+ G  G  GI G KG+ G  G+ GK G              GEPG  G +G +G+ G+ G++G  G +G  G +G+ G++G  G  G  G  G  G  G PG +G++G  G  G DGP     PG +G  G M
Sbjct:  833 RLGSKGGEGTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGST--GEGGRPGRDGEP---GEPGTPGRDGEPGIPGPDGRPGERGPGGEI------------GRKGEKGPSGPPGITGNRGPPGSPGIKGERGYPGKDGRAGEPGAVGL-------------------------RGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQGPPGVAGTDGP-----PGPRGNVGPM 1122          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1 (collagen type I alpha 1 [Source:NCBI gene;Acc:100144368])

HSP 1 Score: 144.821 bits (364), Expect = 1.344e-34
Identity = 149/416 (35.82%), Postives = 185/416 (44.47%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSG---------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            KRG +G  G+ G  GA G+ G  G  G  G  G  G +G PGE G  G V  KG  G  G  G PG  G KG TG  G+PG  G                        + G  G  G+ G PG  G +G  G+PG  G  G KG  G +G         P G +G PGK                   + + GPQG  G +G  GE G  G  G  G  G+ G +G IG+ GK G+ GL G+ G  G+ G +G+ G PGE+G  G  G  G  G PG  G  GA G  G PG  G +G PG +G  G  G  G        LPG++G +G+ G  G  G  G  G +G  G  G+PG  G  G+ G+ G +      G  G  G  G +GP G  G  GP G  G  G  G+ G N
Sbjct:  357 KRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDG------------------------KTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGK-------------------DGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAG--------LPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGEN 721          

HSP 2 Score: 134.035 bits (336), Expect = 2.630e-31
Identity = 154/401 (38.40%), Postives = 186/401 (46.38%), Query Frame = 3
Query: 1041 GAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLI------GEPGK---IGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLI---GLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI-GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G KG+             G++G  G  GE G      KGEAG  G+QG PG  GE+G  G  G PG                             G RG  GE G PG  G  G+ G  G +G  G +G  G  GPKG++G PG+    G+ G KG  G  G    +   GP G PG  G PG  G++G +G+ G+MG  G KG  G +GK G+ G++      G PGK    G QG  G  G  GE+G +G  G PG +G PG QG IG  G     GLPG++G  G  G  GD G  G  G  GP G A     G +G  G  G+ G KGD G  G  G  G PG  G+ GE G  GL  + G  G  G  G  G  G +G RG  GPIGL G  G  G
Sbjct:  317 GPKGN------------NGEVGAPGAKGEPG-----AKGEAGAPGAQGPPGAHGEEGKRGARGEPGA---------------------------PGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPA-----GARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPG 668          

HSP 3 Score: 116.701 bits (291), Expect = 6.585e-26
Identity = 149/435 (34.25%), Postives = 172/435 (39.54%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGE---------------------MGLIGDIGEKGDRGPKGENGNPGIPGEVG-------IKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            A K  +RG  G  G  G PG  GD G +G  G  G  G+ G +G  G  G +G+      G QG+ G PG  GE+G  G  G PGL G                         +G+RG  GE G PG +G  G  G PG  G  G KG+ G  G  G                                QG PGL G+PGE      +G  GL G+ G++GD       G  G  G PGK G +GL G IG PG  G       PG +GEPG  G +G  G  G PGE G  G PGP    G  GP G DG      PG KG  GE                      G +G+ G KG RGP G  G  G PG  G                    GK G  G  G TGP G  G  G  GP G  GE G  G +
Sbjct:  481 AGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGL-----PGPQGAIGEPGKPGEQGLPGDAGAPGLTGA------------------------RGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGA-------------------------------QGPPGLQGMPGE------RGAAGLPGLRGDRGD------QGAKGADGAPGKDGARGLTGPIGLPGPAGA------PGDKGEPGAAGPVGPAGARGAPGERGESGPPGP---AGFAGPPGSDG-----QPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAGRPGEVGAAGPPGPSGEKGSPGAD 829          

HSP 4 Score: 103.605 bits (257), Expect = 7.290e-22
Identity = 129/380 (33.95%), Postives = 160/380 (42.11%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPG-----ILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPG-KMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS--------------------------------------GEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG----TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS-------VIGKIGKYGTIGNTGPKGL------EGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRG 2279
             G  G  GE G PG     + G  G  G PG  GIKG +G  G  G KG++G  G K++                +    GPQG  G  G  G  G  G  G  G  G S                                      G  G++G  G  G+ G  GE G  G QG  G  G+ G++G +G  G PG  G PG++G  G  G  G  G +G +G PG  G  GL GP G  G  G      LPG KG+ G  G  G  G+ G  G  G++G PG PG VG +G+ G  G           GK G+ G +G TGP G        G +GP GP G  GE G+ G  G  G  G  G +G  G PG PG++G
Sbjct:  172 SGKPGRAGERGPPGPQVDCVQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKVSGPTGPAGPPGFPGGPGAKGEIGPQGARGPEGPAGARGEPGNPGPAGPAGPSVSMKLECFGAPGAAGAPGFPGPRGPPGPQGAGGAPGPKGNNGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQG 551          

HSP 5 Score: 89.3521 bits (220), Expect = 1.490e-17
Identity = 138/360 (38.33%), Postives = 163/360 (45.28%), Query Frame = 3
Query:  999 KRGEKGTVGSKGH---PGAKGDIXXXXXXXXXXXXXDIGF---------RGFPGENGIKGV----------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--------------------------------RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDG 1916
            +RGE+G  G+ G    PG +G IGE G PG++G  GD G          RGFPGE G  G              G  G +G  G PG  G +G  G+ G PG  G AG  G +G +G+ G KG  G  G+ G RG  G IGLPG  G  G  G+PG  G  G  G  G  G +G SG PG     G  G+ G  G +G+S  N                                RGP G PG  G PG  G +G  G  G  G  G  G  GK G  G  G  G  G+ G  G  G  G  GEKG+ GA G PG  G PG QG  G  G++GLPG+ G RG P      GL GP G+ G
Sbjct:  519 ERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAGRPGEVGAAGPPGPSGEKGSPGADGAPGSAGLPGPQGIAGQRGIVGLPGQRGERGFP------GLPGPAGEVG 872          

HSP 6 Score: 65.855 bits (159), Expect = 2.138e-10
Identity = 108/367 (29.43%), Postives = 136/367 (37.06%), Query Frame = 3
Query: 1356 LPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGK--------------------LGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAK--------------------------------------------GLPGIEGEPGDQGEIGAMGLIGLPGES---------------GLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-------LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +PG +G +G+ G PG  G  G  G  G++G +G  G                     Q +  +G +G PG  G+P      G+KG +G  G+ G KGD G +G                      G+ G  G  G  G  G +GE G PG  G  G                                              G PG +GEPG +GE GA G  G PG                 G RG PG  G  G  G  G DGP G      KG  GE G  G +G KG  G  G  G PG+PG  G+ G  G  G           G+ G+ G  G+ G +G  G+ G  GP G  G+ GK G
Sbjct:  150 VPGPMGPMGSRGPPGPPGASGESGKPGRAGERGPPGP--------------------QVDCVQGARGFPGTPGLP------GIKGHRGFSGLDGAKGDTGPAGPKVSGPTGPAGPPGFPGGPGAKGEIGPQGARGPEGPAGARGEPGNPGPAGPAGPSVSMKLECFGAPGAAGAPGFPGPRGPPGPQGAGGAPGPKGNNGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGA-----KGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPG 485          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1 (collagen type I alpha 1 [Source:NCBI gene;Acc:100144368])

HSP 1 Score: 142.51 bits (358), Expect = 8.004e-34
Identity = 149/416 (35.82%), Postives = 185/416 (44.47%), Query Frame = 3
Query:  999 KRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSG---------PKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLS----VIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            KRG +G  G+ G  GA G+ G  G  G  G  G  G +G PGE G  G V  KG  G  G  G PG  G KG TG  G+PG  G                        + G  G  G+ G PG  G +G  G+PG  G  G KG  G +G         P G +G PGK                   + + GPQG  G +G  GE G  G  G  G  G+ G +G IG+ GK G+ GL G+ G  G+ G +G+ G PGE+G  G  G  G  G PG  G  GA G  G PG  G +G PG +G  G  G  G        LPG++G +G+ G  G  G  G  G +G  G  G+PG  G  G+ G+ G +      G  G  G  G +GP G  G  GP G  G  G  G+ G N
Sbjct:  451 KRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPAGAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDG------------------------KTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPGERGVMGPTGPAGAPGK-------------------DGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAG--------LPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGEN 815          

HSP 2 Score: 115.161 bits (287), Expect = 1.929e-25
Identity = 149/435 (34.25%), Postives = 172/435 (39.54%), Query Frame = 3
Query:  984 AEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGE---------------------MGLIGDIGEKGDRGPKGENGNPGIPGEVG-------IKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYN 2204
            A K  +RG  G  G  G PG  GD G +G  G  G  G+ G +G  G  G +G+      G QG+ G PG  GE+G  G  G PGL G                         +G+RG  GE G PG +G  G  G PG  G  G KG+ G  G  G                                QG PGL G+PGE      +G  GL G+ G++GD       G  G  G PGK G +GL G IG PG  G       PG +GEPG  G +G  G  G PGE G  G PGP    G  GP G DG      PG KG  GE                      G +G+ G KG RGP G  G  G PG  G                    GK G  G  G TGP G  G  G  GP G  GE G  G +
Sbjct:  575 AGKPGERGVMGPTGPAGAPGKDGDSGPQGPSGPSGPAGERGEQGPAGAPGFQGL-----PGPQGAIGEPGKPGEQGLPGDAGAPGLTGA------------------------RGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGA-------------------------------QGPPGLQGMPGE------RGAAGLPGLRGDRGD------QGAKGADGAPGKDGARGLTGPIGLPGPAGA------PGDKGEPGAAGPVGPAGARGAPGERGESGPPGP---AGFAGPPGSDG-----QPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAGRPGEVGAAGPPGPSGEKGSPGAD 923          

HSP 3 Score: 88.5817 bits (218), Expect = 2.619e-17
Identity = 254/891 (28.51%), Postives = 338/891 (37.93%), Query Frame = 3
Query:  999 KRGEKGTVGSKGH---PGAKGDIXXXXXXXXXXXXXDIGF---------RGFPGENGIKGV----------AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVN--------------------------------RGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRG---TPGP------------------------------------EGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLI---------------------GDIGEKGDRGPKGEN---------------GNPGIPGEVGIKGEIGDKGLSVIGK-------------IGKYGTIGNTGPKGLEGI------------RGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSY-EAGDLLTYLKP--YDSETTWQSELRVDGLVL-YPPNLRKGYPHIS--QLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLS--TNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            +RGE+G  G+ G    PG +G IGE G PG++G  GD G          RGFPGE G  G              G  G +G  G PG  G +G  G+ G PG  G AG  G +G +G+ G KG  G  G+ G RG  G IGLPG  G  G  G+PG  G  G  G  G  G +G SG PG     G  G+ G  G +G+S  N                                RGP G PG  G PG  G +G  G  G  G  G  G  GK G  G  G  G  G+ G  G  G  G  GEKG+ GA G PG  G PG QG  G  G++GLPG+ G RG    PGP                                    EG  G  G  G DG      PG KG +GE G                       GD GE G  GP G +               G+ G  GE G +G  G +G + +                G  G  G  GP G  G+             GP GP G  GE+G  G  G  G  G  G  G             F L  +A+ Q             ++  ++    +++D  S +K++ Q +   RS  G+  N P  +C+D+++          W+DP++G + D+ K  C       + ET +   TCV  +  E      Y+     + +  W  E   DG    Y        P     QL FL++ S  A Q + + C+ S+ Y D      +L+ A   Q  ++                     I +   G S F  ++L D C     GT+ K ++   T+K   LPI+D          +   G  + P CF+
Sbjct:  613 ERGEQGPAGAPGFQGLPGPQGAIGEPGKPGEQGLPGDAGAPGLTGARGDRGFPGERGAPGPVGPAGARGSPGSAGNDGAKGDAGAPGAPGAQGPPGLQGMPGERGAAGLPGLRGDRGDQGAKGADGAPGKDGARGLTGPIGLPGPAGAPGDKGEPGAAGPVGPAGARGAPGERGESGPPGPAGFAGPPGSDGQPGAKGESGENGAKGDAGPPGPAGPTGAPGPQGPVGNTGAKGARGPAGPPGATGFPGGAGRVGPPGPAGNPGPPGPTGQAGKEGPKGNRGETGPAGRPGEVGAAGPPGPSGEKGSPGADGAPGSAGLPGPQGIAGQRGIVGLPGQRGERGFPGLPGPAGEVGKQGPVGPGGERGPPGPSGPPGLAGPPGEPGREGTPGNEGSAGRDG-----APGPKGDRGESGPSGAPGAPGPPGAPGPVGPAGKSGDRGETGPAGPAGASGPAGPRGPAGPPGLRGDKGETGEAGERGMKGHRGFTGMQGPPGPSGPPGEQGPAGSAGPAGPRGPAGSAGVPGKDGMSGLPGPTGPPGPRGRSGEMGPAGPPGPPGPAGAPGAPGG-----------GFDLGFIAQPQ-EKAPDPFRMFRADDANVLRDRDLEVD--STLKSLSQQIEQIRSPDGTRKN-PARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYC-------NMETGE---TCVSPTQREVAQKNWYISKNIKEKKHVWFGETMNDGFQFEY--GSEGSLPEDVNIQLTFLRLMSTEASQNLTYHCKNSVAYMDAAAG--NLKKALLLQGSNE---------------------IEIRAEGNSRFTYSVLEDGCTSHT-GTWGKTVIDYKTSKTSRLPIIDIAPMDIGAPDQ-EFGLEVGPVCFL 1446          

HSP 4 Score: 87.0409 bits (214), Expect = 7.692e-17
Identity = 71/168 (42.26%), Postives = 82/168 (48.81%), Query Frame = 3
Query: 1725 GEIGQPGEKGTKGAKG---LPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKG-------LSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            GE+G PG KG  GAKG    PG +G PG  GE G  G  G PG  G RG PG  G  G  G  G DGP      G KG  GE G  G +G KG  G  G  G PG+PG  G+ G  G  G           G+ G+ G  G+ G +G  G+ G  GP G  G+ GK G
Sbjct:  417 GEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGEPGAPGARGAPGERGAPGGRGFPGSDGPA-----GAKGAPGERGAPGLVGPKGSTGEPGRTGEPGLPGAKGMTGSPGSPGPDGKTGPAGAPGQDGRPGPPGSVGARGQPGVMGFPGPKGAAGDAGKPG 579          

HSP 5 Score: 51.2174 bits (121), Expect = 8.070e-6
Identity = 83/272 (30.51%), Postives = 95/272 (34.93%), Query Frame = 3
Query: 1653 GKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGL----------------------IGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----------------------------------------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGT 2282
            G+ G+ GK G  GE G  G QG +G  G PG  G KG +G  G++G  GD G  G  G  G PGE+   GTPG  G  GL G  G  GP G A                                   IG  G +G  GP G  G PG PG  G  G  G+ G                                            G++G  G  G  G KG  G  G +GP G  GE GK G  G                PG PG RG 
Sbjct:  213 GEDGESGKPGRAGERGPPGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDTGPAGPKGEAGTPGEN---GTPGAMGPRGLPGERGRAGPSGAAGARGNDGAAGAAGPPGPTGPAGPPGFPGGPGAKGEIGPQGARGPEGPAGARGEPGNPGPAGPAGPSGNPGADGAAGAKGAPGAPGAAGAPGFPGPRGPPGPQGAGGAPGPKGNNGEVGAPGAKGEPGAKGEAGAPGAQGPPGAHGEEGKRGARGE---------------PGAPGARGA 466          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000017411.2 (pep primary_assembly:ASM223467v1:12:26266454:26296084:1 gene:ENSORLG00000013882.2 transcript:ENSORLT00000017411.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 3.526e-33
Identity = 211/693 (30.45%), Postives = 296/693 (42.71%), Query Frame = 3
Query: 1101 IGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGN---------------TGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGI---------------LGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS---------------GEKGDIGK------------------SGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGL---IGLPGESGL------------------RGTPGPEGDEGLHGPIGDDGP---------------RGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMK-----TVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIEL----PE----AVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHIS--QLNFLQMRSEYAEQEVEFLCE 2837
            IG  G PG  G +G A  G  G+QG  G+PG  G+KG                +G  G PGL G       +G  G  G +G++G  G+QG RG MG  GL GI               +G+ G SG PG +G KG  G VG SG +G  G  G+                   N NRGP+G+ G  G  GE G +G  G  GL+G                 GEKG+ G                    G  G  G +G PG +G+ G +G+ G  GE GT+G KG  G  G PGDQG+ G  G+    GLPG  GL                  +G PG EG +G+ G  GDDG                RG A  GI+G++G+    G  GEKGD GP G  G PG+ G  G++GE GDKG    G+ G+ G  G TGP G +G++G RGP+G  G VGK G  G  G  G  G  G  GLPG+ G +G    +    +           +     K +N T  ++  +  M      +++Q++             P +  +       +EL    PE      ++DPN+G+  D+    C      +S+ + +   TC+        +  +++ +  E ++Q   ++D    +       YP  S  Q+ FL++ S  A Q V + C 
Sbjct:   77 IGSIGTPGPQGPQGPA--GIPGLQGDSGLPGTTGDKGQRGLPGPPGSDGPPGQSGPQGLPGLTG------TEGPPGKKGDQGDQGPFGKQGPRGIMGPRGLEGIKGLQGPPGPPGKQGDVGRPGGSGDPGPRGDKGEVGPVGLSGREGPWGAVGE-------------------NGNRGPKGEKGFIGFMGEPGPVGDLGPAGLVGFQGTSGPPGHPGPDGPPGEKGEFGSLGVTGPPGPPGPQGASGLPGVRGDPGKLGPPGSVGLAGPQGDQGAKGEPGTQGPKGEMGAVGLPGDQGDDGPPGIQGPAGLPGSEGLSGEMGFIGPPGPEGTPGKQGGPGSEGKQGMKGEKGDDGQVGPSGKKGHIGRRGKRGKA--GIRGIRGD---TGPKGEKGDVGPAGLPGWPGVLGLPGLQGEPGDKGEP--GQEGQKGDAGLTGPPGQDGLKGIRGPVGAPGPVGKKGEQGNIGPPGPRGSLGMPGLPGLFGLKGLKGYQGPPGQPGRKGLPGPPGVPGPPGKSLNMTLTQLKDLIYMSDMPKYSLIQTLLDSLQLELRLLLDPPDGSRKHPATTCLELWLCHPEYSSGMYYIDPNQGSPADALLAYC-----SFSSSSKE---TCLHPENPQLPMKAWMEGFPEEESFQWLSKMDQGYQF------SYPDASVVQMRFLRLHSVTAVQRVTYSCH 721          

HSP 2 Score: 91.6633 bits (226), Expect = 2.080e-18
Identity = 132/411 (32.12%), Postives = 162/411 (39.42%), Query Frame = 3
Query: 1332 RGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNV--------------------NRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKG------------------------DIGKSGKLGKDGLIGEPGKIGIQGLKGE------IGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLI------------------------------------------GLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKG------------------------------ENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G+ GL GI G  G  G PG  G        GK GP G+ GTPG    +G  G  G +G  G                          GPQG PGL G  G  G  G +G++G  G  G +G                        D+G+ G  G  G  G+ G++G  GL G       +G+ G +G KG KG  G  GEPG  G++G  GL+                                          GLPG  G  G  GP G  GL GP GD G +G   PG +G KGEMG +G  G++GD GP G                              + G PG  G+ G+KGE GD G   +G  GK G IG  G +G  GIRG RG  G  GE G VG
Sbjct:   44 QGRPGDDGLKGINGPTGLPGLPGPNGA------TGKHGPIGSIGTPGPQGPQGPAGIPGLQGDSGLPGTTGDKGQRGLPGPPGSDGPPGQSGPQGLPGLTGTEGPPGKKGDQGDQGPFGKQGPRGIMGPRGLEGIKGLQGPPGPPGKQGDVGRPGGSGDPGPRGDKGEVGPVGLSGREGPWGAVGENGNRGPKGEKGFIGFMGEPGPVGDLGPAGLVGFQGTSGPPGHPGPDGPPGEKGEFGSLGVTGPPGPPGPQGASGLPGVRGDPGKLGPPGSVGLAGPQGDQGAKGE--PGTQGPKGEMGAVGLPGDQGDDGPPGIQGPAGLPGSEGLSGEMGFIGPPGPEGTPGKQGGPGSEGKQGMKGEKGDDG--QVGPSGKKGHIGRRGKRGKAGIRGIRGDTGPKGEKGDVG 444          

HSP 3 Score: 81.2629 bits (199), Expect = 3.388e-15
Identity = 98/268 (36.57%), Postives = 134/268 (50.00%), Query Frame = 3
Query: 1098 DIGFRGFPGENGIKG-VAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHG 1898
            D G +G PG  G KG +   G  G QG  G PG +G  G  G  G  G +GF G  G +G  G  G  G +G+ G +G +G+ G++G  G  G IG  GK GK GI+G +G+   +GPKG                                +GD G AG+PG  G +G+ G   L G  G+KG+ G+ G+ G  GL G PG+ G++G++G +G PG  G KG       +G  G  G  G++G+ GLPG  GL+G  G +G  G  G
Sbjct:  322 DQGAKGEPGTQGPKGEMGAVGLPGDQGDDGPPGIQGPAGLPGSEGLSGEMGFIGPPGPEGTPGKQGGPGSEGKQGMKGEKGDDGQVGPSGKKGHIGRRGKRGKAGIRGIRGD---TGPKGE-------------------------------KGDVGPAGLPGWPGVLGLPG---LQGEPGDKGEPGQEGQKGDAGLTGPPGQDGLKGIRGPVGAPGPVGKKGE------QGNIGPPGPRGSLGMPGLPGLFGLKGLKGYQGPPGQPG 546          

HSP 4 Score: 79.7221 bits (195), Expect = 1.121e-14
Identity = 96/221 (43.44%), Postives = 124/221 (56.11%), Query Frame = 3
Query: 1572 GIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGK---DGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTI---GNTGPKGLE---GIRGPRGPIGLVGEVGKVGYN 2204
            G PG++G  G+ G  GL G+ G  G  GK G +G     G  G  G  GI GL+G+ G PG  G KG +GLPG  G  G  G+ G  GL GL   +G  G PG +GD+G  GP G  GPRG   P G++G+KG  G  G  G++GD G  G +G+PG  G+   KGE+G  GLS  G+ G +G +   GN GPKG +   G  G  GP+G +G  G VG+ 
Sbjct:   45 GRPGDDGLKGINGPTGLPGLPGPNGATGKHGPIGSIGTPGPQGPQGPAGIPGLQGDSGLPGTTGDKGQRGLPGPPGSDGPPGQSGPQGLPGL---TGTEGPPGKKGDQGDQGPFGKQGPRGIMGPRGLEGIKGLQGPPGPPGKQGDVGRPGGSGDPGPRGD---KGEVGPVGLS--GREGPWGAVGENGNRGPKGEKGFIGFMGEPGPVGDLGPAGLVGFQ 257          

HSP 5 Score: 52.7582 bits (125), Expect = 2.350e-6
Identity = 74/213 (34.74%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 1008 EKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKG 1646
            ++G  GS+G  G KG+ G+ G  G  G+KG IG RG  G+ GI+G+        +G  G  G KG+ G  G+ G PG+LG  G                      QG  G+ GE G  G  G  G +G PG+ G+KG +G VG  GP G  G  G                      N GP G  G  G+PG  G  G+KG KG  G  G+ G
Sbjct:  385 KQGGPGSEGKQGMKGEKGDDGQVGPSGKKGHIGRRGKRGKAGIRGI--------RGDTGPKGEKGDVGPAGLPGWPGVLGLPGL---------------------QGEPGDKGEPGQEGQKGDAGLTGPPGQDGLKGIRGPVGAPGPVGKKGEQG----------------------NIGPPGPRGSLGMPGLPGLFGLKGLKGYQGPPGQPG 546          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col11a2 (collagen alpha-1(XI) chain [Source:NCBI gene;Acc:101154880])

HSP 1 Score: 132.88 bits (333), Expect = 6.787e-31
Identity = 151/425 (35.53%), Postives = 191/425 (44.94%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVK----GEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGK--MAXXXXXXXXXXXXXXXXXNVNRGPQGD-----------------PGLAGIPGENGNIGVKGEKGLM---GISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGL---IGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALP-GIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVG 2189
            G  G +GS G PG KG+             GD G +G  G  G+ G   K    G AG  G++GMPG  G KG+ G  G PGL G                         +G+RG+ G +            G PG QG  G +G+ G  GP+G  G PG   +                 ++   GP+G+                 PG  G+PG  G IG  GEKG     G+ G  G  G  G  GK+G  G  G  G  G +G IG PG +G KGA+G+ G++G  G++GE G  G+    G+ GE G  G PGP G++G  GP G  GP G   P G  G KG++G+ G  G  G +GPKG  G PG PG     GE G +G+S     GK G  G  GP G  G RGPRG  G  G  G
Sbjct:  402 GRPGPLGSPGSPGLKGE------------GGDPGPQGPRGPQGVMGPPGKSGRRGRAGADGARGMPGEPGTKGDRGFDGLPGLPG------------------------DKGHRGDSGPL------------GPPGSQGEDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGPPGVRGNDGPHGPKGNLFQGPQGEPGPPGQQGTPGTQGMPGPQGAIGPHGEKGPTGKPGLPGMPGADGPPGHPGKEGPPGTKGNQGPNGPQGAIGYPGPRGIKGAQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEAGLPGPRGEDGPEGPKGRVGPPGEIGPIGTVGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGS---NGEKGTRGVS-----GKQGPRGQRGPTGPRGQRGPRGATGKAGAKG 770          

HSP 2 Score: 101.679 bits (252), Expect = 2.533e-21
Identity = 98/250 (39.20%), Postives = 128/250 (51.20%), Query Frame = 3
Query: 1545 GPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDG---LIGEPGKIGIQGLKGEIGQPGEKGTKGAKGL---PGIEGEPGDQGEIGAMGLIGLPGESGLRG------------TPGPEGDEGLHGPIGD---------DGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVI----GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGY 2201
            GP G PG  G+ GE G+ G +G +G  G+ G  G  G+ G+ G DG   + GEPG  G +G  G  G PG+KG +G  G    PG +GE G++G+ G +G  GLPGE G RG             PG  G++G HGP G+           P     PG +G+ G  G IG  GEK   GP G+ G PG+PG  G  G  G +G        G  G  G IG  GP+G++G +G RG  G  GE G+ G+
Sbjct:  405 GPLGSPGSPGLKGEGGDPGPQGPRGPQGVMGPPGKSGRRGRAGADGARGMPGEPGTKGDRGFDGLPGLPGDKGHRGDSGPLGPPGSQGEDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGPPGVRGNDGPHGPKGNLFQGPQGEPGPPGQQGTPGTQGMPGPQGAIGPHGEK---GPTGKPGLPGMPGADGPPGHPGKEGPPGTKGNQGPNGPQGAIGYPGPRGIKGAQGIRGLKGHKGEKGEDGF 651          

HSP 3 Score: 82.0333 bits (201), Expect = 3.118e-15
Identity = 100/243 (41.15%), Postives = 124/243 (51.03%), Query Frame = 3
Query: 1332 RGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGE 2060
            +GE GE G PG++G+      PGK+G +G +G       KG +G PG     G +G  G  G +G    N GP G PG  G  GE G  G  G KG  G  GE+G+ G  G  G++G  G  GK G  G +G  G+ GEKGTKG    PG  G PG  G +G  G  G PG  GLRG PG  G++G  G  G  GP            G +GL+G  GE+G+   KG+ G PG  G  G KGE
Sbjct: 1120 KGEPGESGPPGVVGE------PGKKGPRGERGE------KGEAGQPGTPGPAGGRGRPGDDGPKG----NPGPVGFPGDPGPTGEVGPRGQDGAKGERGEDGEQGEAGSPGPPGENGPPGPLGKRGPAGTRGPEGRQGEKGTKGD---PGAVGPPGKTGPVGPQGQPGKPGTEGLRGLPGSVGEQGSPGAAGQKGP-----------PGPVGLVGAPGEQGE---KGDRGLPGPQGSTGAKGE 1329          

HSP 4 Score: 75.8702 bits (185), Expect = 2.116e-13
Identity = 84/257 (32.68%), Postives = 113/257 (43.97%), Query Frame = 3
Query: 1623 MGISGEKGDIGKSGKLGKDGLIGEPG----------------------------------KIGIQGLKGEI---GQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRG-TALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGL-------------SVIGKIGKYGTIGN--------------TGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  GE+G  G++G  G DG+ G PG                                  ++ ++G  G +   G+PG  G+ G+ GL G  G+PG QG  G  G++G PG+SG RG  G +G  G+ G  G  G RG   LPG+ G KG  G  G +G  G +G  GE G+ G  G  G+ GE G +GL              V G  G +G  GN               G  G +G+ GP+G IG  GE G  G
Sbjct:  328 VGDPGERGPPGRAGLPGADGVPGPPGTSVMLPFRFGQSGGDKGPVVSAQEAQAAAILSQARMALKGPPGPMGFTGRPGPLGSPGSPGLKGEGGDPGPQGPRGPQGVMGPPGKSGRRGRAGADGARGMPGEPGTKGDRGFDGLPGLPGDKGHRGDSGPLGPPGSQGEDGERGDDGDVGPRGLPGEPGPRGLLGPKGPPGIAGPPGVRGNDGPHGPKGNLFQGPQGEPGPPGQQGTPGTQGMPGPQGAIGPHGEKGPTG 584          

HSP 5 Score: 73.1738 bits (178), Expect = 1.340e-12
Identity = 58/243 (23.87%), Postives = 101/243 (41.56%), Query Frame = 3
Query: 2469 PLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSET--TWQSELRVDGLVLYPPNLRKGYP-HISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKP--DMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            P  +CQD+ L    +L +  W+DPN+G S DSFK  C  ++ +          TC+  S         +  +D+ET  +W S+        Y      G P  + QL FL++ S  A Q + + C  S+ + D    K++ + A  F+  +D  +               +   Y          +  L D C ++    F + +L  N P  + LP++D ++  F ++ +   G  + P CF
Sbjct: 1456 PARTCQDLHLS-QPDLKDEYWIDPNQGCSRDSFKVFCNFTKGE----------TCLHPSK------VKMSSWDTETPGSWYSQFVTGSKFSY--VDASGEPVGVVQLGFLRLLSVQARQNLTYHCHRSVAWAD-RSAKNNHKRALHFRGANDEELSY-------------ETNPY----------IKALKDGCSYRK--GFDRTILEINTPQVEHLPLLDIQVSDFGESNQ-QFGFEVGPVCF 1652          

HSP 6 Score: 65.0846 bits (157), Expect = 4.719e-10
Identity = 84/213 (39.44%), Postives = 100/213 (46.95%), Query Frame = 3
Query: 1323 QGNRGEMGEIGLPGILGKIGTS---------GKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPE---GDEGLHGPIGDDGPRG 1925
            +G RGE GE G PG  G  G           G PG  G  G  G  G+ GP+G  G  G+                       G QG+ G  G PGENG  G  G++G  G  G +G  G+ G  G  G +G PGK G  G +   GQPG+ GT+G +GLPG  GE   QG  GA G  G PG  GL G PG +   GD GL GP G  G +G
Sbjct: 1141 RGERGEKGEAGQPGTPGPAGGRGRPGDDGPKGNPGPVGFPGDPGPTGEVGPRGQDGAKGERG-------------------EDGEQGEAGSPGPPGENGPPGPLGKRGPAGTRGPEGRQGEKGTKGDPGAVGPPGKTGPVGPQ---GQPGKPGTEGLRGLPGSVGE---QGSPGAAGQKGPPGPVGLVGAPGEQGEKGDRGLPGPQGSTGAKG 1328          

HSP 7 Score: 53.9138 bits (128), Expect = 1.239e-6
Identity = 80/226 (35.40%), Postives = 102/226 (45.13%), Query Frame = 3
Query: 1617 GLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---------------------------KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHG-PIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIG----KYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +G  G++G  G  G  G  G  G PG IG+QGL G  G+ GE                           +G  G  G PG  GE G+ GE G  G++G PG+ G RG  G +G+ G  G P    G       G KG  G +G  GD G  G+ GP+G++G  G  GE G +GE G  G            K G  G  GP+G +G +G +G  G VG  GK G
Sbjct: 1034 GELGPRGQQGPFGAKGDEGSRGFPGAPGPIGLQGLPGPSGEKGETGDVGPLGPPGPPGPRGPAGPNGADGPQGPPGGLGNPGPIGEKGEPGESGPPGVVGEPGKKGPRGERGEKGEAGQPGTPGPAGGRGRPGDDGPKGNPGPVGFPGDPGPTGEVGPRGQDGAKGERGEDGEQGEAGSPGPPGENGPPGPLGKRGPAGTRGPEGRQGEKGTKGDPGAVGPPGKTG 1259          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020576.2 (collagen alpha-2(VI) chain [Source:NCBI gene;Acc:101170800])

HSP 1 Score: 126.716 bits (317), Expect = 4.083e-29
Identity = 140/357 (39.22%), Postives = 184/357 (51.54%), Query Frame = 3
Query: 1113 GFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGE---KGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDK-GLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIG 2171
            G PG  G KG+  KG  G +G  G  G KG +G+ GI G  G LG  G  G KG KG  G  G KG  G  G  G  G+ G  G +G  G  G PG +G +G++G  G++GP+G++G       +        K      +  +GP+G+ G+ G PG  GN G+KG++G  GI G+ G  G  G  G  G +G+ G+ G QG +GE G+PGE   KG+KG +GLPG  G+ G+ G+ G  G++G P      G PGP G+ G  GP GD G  G + PG +G  GE            RG  G  G  G  GE G KGE G+K      G+ G+ G  G  GP+G  G  G  GP G
Sbjct:  273 GSPGRGGPKGL--KGAKGARGQTGPKGRKGAQGDPGIEGQIGRLGPKGEVGFKGDKGEVGVGGAKGVAGVPGKNGVHGQKGTMGRIGAPGCKGDPGNEGPEGYQGEAGETGPQGSNG-------EKGGPGLPGKPGPWGPDGEQGPKGEIGIPGNPGVPGNKGLKGQRGNPGIKGDLGRRGDRGPPGAKGAVGKKGEKGEQGPEGERGRPGEDGFKGSKGEQGLPGPRGQAGETGDPGKNGVVGDP------GYPGPRGNPGRRGPRGDKGRPGFSYPGPRGPPGE------------RGEPGRRGPRGSRGECGAKGEAGNKGPPGTPGEPGQLGEPGQRGPRGNPGADGSPGPTG 602          

HSP 2 Score: 88.1965 bits (217), Expect = 2.916e-17
Identity = 91/237 (38.40%), Postives = 119/237 (50.21%), Query Frame = 3
Query: 1590 GNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLP---GIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGT----------------ALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGP---------------KGLEGIRGPRGPIGLVGEVGKVG 2198
            G+ G  G KGL G  G +G  G  G+ G  G  G  G+IG  G KGE+G  G+KG  G  G     G+ G+ G  G+ G MG IG P   G +G PG EG EG  G  G+ GP+G+                   G +G KGE+G+ G+ G  G++G KG+ GNPGI G++G +G+ G  G    G +GK G  G  GP               KG +G+ GPRG  G  G+ GK G
Sbjct:  273 GSPGRGGPKGLKGAKGARGQTGPKGRKGAQGDPGIEGQIGRLGPKGEVGFKGDKGEVGVGGAKGVAGVPGKNGVHGQKGTMGRIGAP---GCKGDPGNEGPEGYQGEAGETGPQGSNGEKGGPGLPGKPGPWGPDGEQGPKGEIGIPGNPGVPGNKGLKGQRGNPGIKGDLGRRGDRGPPGAK--GAVGKKGEKGEQGPEGERGRPGEDGFKGSKGEQGLPGPRGQAGETGDPGKNG 504          

HSP 3 Score: 62.3882 bits (150), Expect = 2.712e-9
Identity = 108/305 (35.41%), Postives = 138/305 (45.25%), Query Frame = 3
Query: 1002 RGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAV-------------KGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRG------EMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGN---SGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGIS--------GEKGD---IGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIG 1817
             G+KGT+G  G PG KGD G +G  G +GE G+ G +G  GE G  G+               KGE G+ G+ G+PG KG KG  G   NPG+ G                     ++GR+G+RG       +G+ G  G  G  G  G+PG+ G KG KG  G  GP+G    +G PGK                       G  GDPG  G  G  G  G +G+KG  G S        GE+G+    G  G  G+ G  GE G  G  G  GE GQ GE G +G +G PG +G PG  G+ G
Sbjct:  347 HGQKGTMGRIGAPGCKGDPGNEGPEGYQGEAGETGPQGSNGEKGGPGLPGKPGPWGPDGEQGPKGEIGIPGNPGVPGNKGLKGQRG---NPGIKG---------------------DLGRRGDRGPPGAKGAVGKKGEKGEQGPEGERGRPGEDGFKGSKGEQGLPGPRGQAGETGDPGK----------------------NGVVGDPGYPGPRGNPGRRGPRGDKGRPGFSYPGPRGPPGERGEPGRRGPRGSRGECGAKGEAGNKGPPGTPGEPGQLGEPGQRGPRGNPGADGSPGPTGDPG 605          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077977.1 (SMESG000077977.1)

HSP 1 Score: 1847.02 bits (4783), Expect = 0.000e+0
Identity = 1049/1050 (99.90%), Postives = 1050/1050 (100.00%), Query Frame = 3
Query:   36 RWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            +WTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV
Sbjct: 1445 KWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 2494          

HSP 2 Score: 53.5286 bits (127), Expect = 1.002e-6
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  372 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 572          

HSP 3 Score: 53.5286 bits (127), Expect = 1.002e-6
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  853 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 1053          

HSP 4 Score: 53.5286 bits (127), Expect = 1.206e-6
Identity = 57/245 (23.27%), Postives = 113/245 (46.12%), Query Frame = 3
Query:   27 FNFRWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILN-SENNHFLGYIANILISPL--LINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSD---LLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQE 743
             +FRW KV IQ+S  EI+ ++NC +      D   +   + +L+ +++ S N +F+G I+ + + PL  L + + L    C++  C  +  K   +       I +  S  L + +L   +I C+ K I  +     D T  + PI +  +   L +  +I FY++L     +   +  +L   +      ++     N+ I +  +GN L   + K+  L++ W K++I +      L +NC++
Sbjct:    8 LHFRWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHLT---CTIDQCFTESGKAGTA-----NSIANAISNQLMK-ELTVKHINCDEKTIEILSKPDQDLTGSMEPIKINLNDPQLELGLHIGFYMEL-----RSDEDATILYFSSSTALDHSIKFRVRNNYIDLSINGNNLKFENMKI--LKSKWYKMDIFVNESATVLTVNCEQ 236          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077977.1 (SMESG000077977.1)

HSP 1 Score: 1846.63 bits (4782), Expect = 0.000e+0
Identity = 1049/1050 (99.90%), Postives = 1050/1050 (100.00%), Query Frame = 3
Query:   36 RWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 3185
            +WTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV
Sbjct: 1450 KWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACFV 2499          

HSP 2 Score: 53.9138 bits (128), Expect = 8.753e-7
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  377 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 577          

HSP 3 Score: 53.9138 bits (128), Expect = 8.753e-7
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  858 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 1058          

HSP 4 Score: 53.5286 bits (127), Expect = 1.186e-6
Identity = 57/245 (23.27%), Postives = 113/245 (46.12%), Query Frame = 3
Query:   27 FNFRWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILN-SENNHFLGYIANILISPL--LINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSD---LLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQE 743
             +FRW KV IQ+S  EI+ ++NC +      D   +   + +L+ +++ S N +F+G I+ + + PL  L + + L    C++  C  +  K   +       I +  S  L + +L   +I C+ K I  +     D T  + PI +  +   L +  +I FY++L     +   +  +L   +      ++     N+ I +  +GN L   + K+  L++ W K++I +      L +NC++
Sbjct:   13 LHFRWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHLT---CTIDQCFTESGKAGTA-----NSIANAISNQLMK-ELTVKHINCDEKTIEILSKPDQDLTGSMEPIKINLNDPQLELGLHIGFYMEL-----RSDEDATILYFSSSTALDHSIKFRVRNNYIDLSINGNNLKFENMKI--LKSKWYKMDIFVNESATVLTVNCEQ 241          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077977.1 (SMESG000077977.1)

HSP 1 Score: 1821.59 bits (4717), Expect = 0.000e+0
Identity = 1039/1049 (99.05%), Postives = 1041/1049 (99.24%), Query Frame = 3
Query:   36 RWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            +WTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKC   +   P C 
Sbjct: 1450 KWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCSPSS---PKCL 2495          

HSP 2 Score: 53.1434 bits (126), Expect = 1.497e-6
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  377 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 577          

HSP 3 Score: 53.1434 bits (126), Expect = 1.497e-6
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  858 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 1058          

HSP 4 Score: 52.373 bits (124), Expect = 2.526e-6
Identity = 57/245 (23.27%), Postives = 113/245 (46.12%), Query Frame = 3
Query:   27 FNFRWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILN-SENNHFLGYIANILISPL--LINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSD---LLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQE 743
             +FRW KV IQ+S  EI+ ++NC +      D   +   + +L+ +++ S N +F+G I+ + + PL  L + + L    C++  C  +  K   +       I +  S  L + +L   +I C+ K I  +     D T  + PI +  +   L +  +I FY++L     +   +  +L   +      ++     N+ I +  +GN L   + K+  L++ W K++I +      L +NC++
Sbjct:   13 LHFRWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHLT---CTIDQCFTESGKAGTA-----NSIANAISNQLMK-ELTVKHINCDEKTIEILSKPDQDLTGSMEPIKINLNDPQLELGLHIGFYMEL-----RSDEDATILYFSSSTALDHSIKFRVRNNYIDLSINGNNLKFENMKI--LKSKWYKMDIFVNESATVLTVNCEQ 241          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077977.1 (SMESG000077977.1)

HSP 1 Score: 1816.2 bits (4703), Expect = 0.000e+0
Identity = 1039/1049 (99.05%), Postives = 1041/1049 (99.24%), Query Frame = 3
Query:   36 RWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            +WTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKC   +   P C 
Sbjct:  969 KWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIELSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPGAKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGIKGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKGDKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCSPSS---PKCL 2014          

HSP 2 Score: 54.6842 bits (130), Expect = 5.170e-7
Identity = 59/253 (23.32%), Postives = 115/253 (45.45%), Query Frame = 3
Query:   27 FNFRWTKVSIQVSVIEITAKVNCNQTQTFQNDALAEWLLMSRLNIILN-SENNHFLGYIANILISPL--LINHNGLVTNECSLMICLVKDFKNDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSD---LLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQE 767
             +FRW KV IQ+S  EI+ ++NC +      D   +   + +L+ +++ S N +F+G I+ + + PL  L + + L    C++  C  +  K   +       I +  S  L + +L   +I C+ K I  +     D T  + PI +  +   L +  +I FY++L     +   +  +L   +      ++     N+ I +  +GN L   + K+  L++ W K++I +      L +NC++     N E
Sbjct:   13 LHFRWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHLT---CTIDQCFTESGKAGTA-----NSIANAISNQLMK-ELTVKHINCDEKTIEILSKPDQDLTGSMEPIKINLNDPQLELGLHIGFYMEL-----RSDEDATILYFSSSTALDKSIKFRVRNNYIDLSINGNNLKFENMKI--LKSKWYKMDIFVNESATVLTVNCEQTYSSVNAE 249          

HSP 3 Score: 54.299 bits (129), Expect = 6.224e-7
Identity = 57/206 (27.67%), Postives = 100/206 (48.54%), Query Frame = 3
Query:  324 GILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKMLNPISLQSDLLVEK---YISFYIDL-TQTRYKLTSENPLLSLFNYDKXXXXXXXXXXXXXXXXXXDGNRLF-NFDFKVPKLETG-WNKIEIAIVSDKIGLRINCQEIEFI---RNQELKDIKRYTKVLI-LGNLWNFKSFYKARLAQLNIKSNSNEMEKCVIDKCL 911
             I+S+  +    TKL    + C+++NI  +   QT++ K+  PI++Q    +      I FYI L T+      +E  ++ L++ DK+   +I L  +S   I       F  + F+  +L+   WNK+EI I   +I LR+NC EI  I    N +L D+++   ++    N +   S  K  L  L+  ++ + +  C ID+C 
Sbjct:  377 SIVSQNILKFFSTKL----LRCQSENIIILSKPQTNNDKIFQPITIQPKSFISNQGFIIQFYIRLPTEIITSDINEETIIRLYSKDKNKILIIHLVKSSHFRIQLIHKSNFKEWIFEEHQLKKNKWNKVEIQISFAEISLRMNCGEISAIPIDENMKLNDLRKLDFLIDESSNEYFMGSISKLSLIPLSSLTDVSHL-TCTIDQCF 577          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000077782.1 (SMESG000077782.1)

HSP 1 Score: 308.916 bits (790), Expect = 5.107e-87
Identity = 281/758 (37.07%), Postives = 383/758 (50.53%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGD---------IGKSGKLGKD------------------GLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKIDAVSRMKTVLQXXXXXXXXXXXXXXFPLNSCQDMQLQITIELPEAVWLDPNEGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSETTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEESIVYGDV-LDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFENGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNGKCMLGANIYPACF 3182
            G KG+VG  G  G KGD+G  G  G KG +G++G +G  G+ G+ G      V GE G  G  G+ G KGE+G  G  G  G +G  G  G+ G +G  G KG+ G IG  G  G +GE G PG   K G SG  G+ G+KG KG+ G  GP+G  G  G +   G KG              +G +G PG  G  G +G  GV+GE G+ G  G KG+         +G SG  GKD                  G  G PGK G+QG  G  G  GE G +G +G PGI G  G +G  G +G++G            P+G  G  GPIG  GP G   PG KG +G  G +G+ G+KG+R  KG  G+PG  G VG KGE G  GL+     G  G  GN GPKG  G+ GP GP+G  GE G  G  G  G  G  G++G  G  G  G +G        K  + N  +     +   T+  +F  +      ++  +   +   R   G + +    +C D++LQ         ++DPNEG+  DS +  C  +E          + TC+ S  + G L  Y KP   ET WQ+ LR++G +    +L   Y   +Q+NFL+ ++  + QE+EFLC++S++YGD  L  ++  +YAT   T D   IDLSKG+ LGP  G+MDKR+Y  E GR IFNVTI YD C ++ PG+ +K  L T    MLPI+D++I  +N+ G   LG N+   CF
Sbjct:  911 GRKGSVGPIGPDGEKGDVGPLGKTGLKGTRGEVGIKGSEGKTGLMGSRGPQGVSGEPGSPGDAGVNGEKGEQGKQGSQGPTGPVGVQGIPGQPGPRGEKGVKGDIGLIGPTGAPGRIGEAGPPG---KTGASGAEGQPGVKGTKGDTGILGPRGEQGLDGPIGPIGSKGL-------------KGGRGKPGRQGSTGNSGPQGVEGELGIQGPPGRKGELGPIGLPGPVGTSGPSGKDGAPGPPGGSGQAGDDGPVGSPGLPGKAGLQGPAGGSGTQGEAGERGDRGPPGIAGNMGQRGPNGPIGIVG------------PDGPRGQPGPIGPMGPIGN--PGPKGSRGLDGKVGEPGQKGERYLKGIKGSPGTIGAVGSKGEPGPPGLT-----GPQGKRGNPGPKGETGLMGPIGPVGEDGESGAAGPLGPYGPPGPPGDRGLPGDSGDRGGQGRPGPPGQVK--IRNPPEGSSGRYKRSTRAQSFVDINDALFDKVDKITNKIKRIRFPTGHNKDSAARTCADIKLQRKQSTDGQYYIDPNEGSGKDSIEVECVFNEE---------VKTCISSVKQQGGLYNYKKPMKGETNWQNSLRLEGAISRASDLHSMYVDHTQMNFLRNQNSKSYQEIEFLCDQSVIYGDSELSEENKFKYATVLMTHDFKSIDLSKGERLGPNEGYMDKRVYKDEFGRPIFNVTIEYDGCMYRTPGSSSKFKLETTDLSMLPIIDFQINDYNNKGISTLGLNVLSMCF 1622          

HSP 2 Score: 121.709 bits (304), Expect = 1.661e-27
Identity = 159/438 (36.30%), Postives = 208/438 (47.49%), Query Frame = 3
Query: 1005 GEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV-AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGF------------KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGI--PGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEK---GDRGPKGENGNPGIPGEVGIKGEIGDKGL----------------------SVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            G +GT+G  G  G  G  G  G PG  GE+G+ G  G PGENG  G+    G+ G QGS G  G  G +G +G+ G PG+                               G+ G IG  G LG  G SG PG QGI+G             KG+ GK GP+G +G  G+    G +G  G  G  G   V   P    G   +  PG  G IG   EKG+ G+ G KG +G  G  G+ G +G  GK G++G +GE+G  G +G  G  G  G +G  G+ G  G  G+ G  GE G +G+ GP G  G+ G  G  GPRG      KGVKG++GLIG  G     G+ GP G+ G  G  G+ G+KG  GD G+                         GK G+ G+ GN+GP+G+EG  G +GP G  GE+G +G
Sbjct:  719 GPRGTIGFIGVSGPPGTSGRPGPPGYPGERGETGEPGAPGENGPVGMQGSPGQPGEQGSMGERGPPGTRGPSGLPGKPGI------------------------------DGKEGSIGPKGDLGPRGQSGNPGPQGIRGARGQSGPTGELGSKGDRGKFGPQGPTGDKGERGDPGSQGPPGPAGPNGPIGVAGSPGDKGGKGVVGNPGPQGPIG---EKGVRGLLGRKGSVGPIGPDGEKGDVGPLGKTGLKGTRGEVGIKGSEGKTGLMGSRGPQGVSGEPGSPGDAGVNGEKGEQGKQGSQGPTGPVGVQGIPGQPGPRGE-----KGVKGDIGLIGPTGAPGRIGEAGPPGKTGASGAEGQPGVKGTKGDTGILGPRGEQGLDGPIGPIGSKGLKGGRGKPGRQGSTGNSGPQGVEGELGIQGPPGRKGELGPIG 1118          

HSP 3 Score: 112.464 bits (280), Expect = 1.120e-24
Identity = 183/468 (39.10%), Postives = 235/468 (50.21%), Query Frame = 3
Query:  993 LLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKG----------VAVKGEAGVQGSQGMPGYKGEK---------------GNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEM---GEIGLPGILGKIGTSGKPGKQGIKGFKGN---VGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTK---------GAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDE---GLHGPIG---------------------DDGPRGT-ALPGIKGVKGEM---GLIGDIGEKGDRGPKGENGN---PGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGE 2183
            + +RG  GT G  G PG  G  G++G  G KG+ G  G  G PG  GI+G          +  KG+ G  G QG  G KGE+               G  G+ G+PG  G  G  G  G +G  G+KG +G +GR+G+ G +   GE G  G LGK G  G  G+ GIKG +G    +G  GP+G SG PG     G+ G KG +G QG      GP G  G+ G PG  G  GVKG+ GL+G +G  G IG++G  GK G  G  G+ G++G KG+ G  G +G +         G+KGL G  G+PG QG  G  G  G+ GE G++G PG +G+    GL GP+G                     DDGP G+  LPG  G++G     G  G+ GE+GDRGP G  GN    G  G +GI G  G +G    G IG  G IGN GPKG  G+ G  G  G  GE
Sbjct:  778 MGERGPPGTRGPSGLPGKPGIDGKEGSIGPKGDLGPRGQSGNPGPQGIRGARGQSGPTGELGSKGDRGKFGPQGPTGDKGERGDPGSQGPPGPAGPNGPIGVAGSPGDKGGKGVVGNPGPQGPIGEKGVRGLLGRKGSVGPIGPDGEKGDVGPLGKTGLKGTRGEVGIKGSEGKTGLMGSRGPQGVSGEPGSPGDAGVNGEKGEQGKQGSQGPT-GPVGVQGIPGQPGPRGEKGVKGDIGLIGPTGAPGRIGEAGPPGKTGASGAEGQPGVKGTKGDTGILGPRGEQGLDGPIGPIGSKGLKGGRGKPGRQGSTGNSGPQGVEGELGIQGPPGRKGELGPIGLPGPVGTSGPSGKDGAPGPPGGSGQAGDDGPVGSPGLPGKAGLQGPAGGSGTQGEAGERGDRGPPGIAGNMGQRGPNGPIGIVGPDGPRGQP--GPIGPMGPIGNPGPKGSRGLDGKVGEPGQKGE 1242          

HSP 4 Score: 111.694 bits (278), Expect = 1.946e-24
Identity = 177/543 (32.60%), Postives = 245/543 (45.12%), Query Frame = 3
Query:  639 LFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQEIEFIRNQELKDIKRYTK--VLILGNLWNFKSFYKARLAQLNIKSNSNEMEKCVI---------DKCLMKMS--YKEXXXXXXXXXXXXXXXXXAEKLLKRGEKGTVGSKGHPGAKGDIXXXXXXXXXXXXXD--IGFRGFPGENGIKGVA--VKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGF------KGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
              N  F+    +  W++I  ++    + L I+CQ I  ++     D    +   + +L +     SF     + L +   S   ++C I         +  +M      KE                   +  K G  G  G+ G PGA G I    +P  +         FR       IK  A  +KG  G QG  G+PG++G  G  G+ G+PG  G AG  G +G++G  G  G  G  G  G RG  G  G  G  G IG  G PG +G KG+      KG++G+ G  G SG PG +   G  G  G +G +G             + G+ G NG  G KGE   +G  GE G  G  G  G  G +G  G  G+ G  G  G PG +G +G+ GLPG  G+ GD GE G  G  G PGE G  G PG +G  G+ G  G  G  G +  G  G +GE+G+ G  GE G +GP+G  G  G+ G++GI+GE G +G    G  G  G++G  G  G  GI+G RGP+G  G  G+ G
Sbjct:  142 FMNLPFEFDLTDGQWHRIAFSVDKSSVSLLIDCQFIGSMKLNRTSDPLDISGGFLYVLQDHNGDASFTGILDSLLLVGGASEAFKQCQIYNPDCNNDFNDVMMNQGPVKKEETGGQQGPPGPKGPKGPKGQEGKNGRDGLPGTPGVPGAPGHIFVLPIPDSEENSNRRVAQFR-----TSIKRTASLLKGNRGPQGMTGLPGFQGPIGYRGVKGDPGSNGDAGFIGPRGLRGMRGIPGPPGRSGTDGERGSNGLTGPKGRSGDIGMQGLPGNKGEKGYRGGRGSKGSLGRRGELGASGRPGDVGPPGENGPPGFQGPRGPPGPQG-------IRGLSGINGPPGPKGE---IGEPGEIGSFGPGGPNGIQGPMGPQGGRGLSGPSGPRGIPGPQGVQGSAGLPGNPGQQGDMGEKGDGGPSGPPGEMGTTGPPGYKGARGIRGSSGAKGDHGPS--GQVGTRGEVGMKGVKGEYGIQGPRGPEGIAGVKGDIGIQGETGPRGKD--GNKGDEGSVGPPGYAGNPGIKGSRGPVGNQGRDGEKG 665          

HSP 5 Score: 108.612 bits (270), Expect = 1.641e-23
Identity = 172/509 (33.79%), Postives = 222/509 (43.61%), Query Frame = 3
Query: 1011 KGTVGSKGHPGAKGDIXXXXXXXXXXXXXDIGFRGFPGENGIKGV----AVKGEAGVQGSQGMPGYKGEKGNTGIGGNPGLLGFAXXXXXXXXXXXXXXXXXXXXXXRQGNRGEMGEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAXXXXXXXXXXXXXXXXXNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMG---ISGEKGDIGKSGKLGKDG---------------------------------------LIGEPGKIGIQGLKG------------------EIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTA----LPGIKGVKGEMGLIGDIGEKGDR---GPKGENG---------------------------------------NPGIP---GEVGIKGEIGDKGLSVIGKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVG 2198
            +G  G  G PG KG+IGE G         +IG  G  G NGI+G       +G +G  G +G+PG +G +G+ G+ GNPG  G  G +G  G  G  G+ G  G  G +G RG  G  G  G  G  G  G  G+ G+KG KG  G  GP+G  G  G     GI+G  G +G         G +GD G  G PG  GN G+KG +G +G     GEKGD G +G  G +G                                        +G  G IG  G+ G                  E G+PG  G  G  G+ G  G+PG+QG +G  G  G  G SGL G PG +G EG  GP GD GPRG +      GI+G +G+ G  G++G KGDR   GP+G  G                                       NPG     GE G++G +G KG   +G IG  G  G+ GP G  G++G RG +G+ G  GK G
Sbjct:  463 RGLSGINGPPGPKGEIGEPG---------EIGSFGPGGPNGIQGPMGPQGGRGLSGPSGPRGIPGPQGVQGSAGLPGNPGQQGDMGEKGDGGPSGPPGEMGTTGPPGYKGARGIRGSSGAKGDHGPSGQVGTRGEVGMKGVKGEYGIQGPRGPEGIAGVKGDIGIQGETGPRGKD-------GNKGDEGSVGPPGYAGNPGIKGSRGPVGNQGRDGEKGDPGIAGTPGGNGPVGPIGSPGPRGGPGPSGTLGSKGEQGPGGPTGMPGPVGPVGPRGTIGFIGVSGPPGTSGRPGPPGYPGERGETGEPGAPGENGPVGMQGSPGQPGEQGSMGERGPPGTRGPSGLPGKPGIDGKEGSIGPKGDLGPRGQSGNPGPQGIRGARGQSGPTGELGSKGDRGKFGPQGPTGDKGERGDPGSQGPPGPAGPNGPIGVAGSPGDKGGKGVVGNPGPQGPIGEKGVRGLLGRKG--SVGPIGPDGEKGDVGPLGKTGLKGTRGEVGIKGSEGKTG 953          

HSP 6 Score: 52.373 bits (124), Expect = 2.181e-6
Identity = 101/295 (34.24%), Postives = 120/295 (40.68%), Query Frame = 3
Query: 1596 IGVKGEKGLMGISGEKGDIGKSGKLGKDGLIGEPGKIGIQG-------------------------------LKGEIGQPGEKGTKGAKGLPGIEGEPGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGIKGVKGEM---GLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGD------------------------KGLSVI-------GKIGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNXXXXXXXXXXXXXXXXLPGVPGQRGTF 2285
             G KG++               GK G+DGL G PG  G  G                               LKG  G  G  G  G +G  G  G  GD G  G  G IG  G  G+RG PGP G  G  G  G +G     L G KG  G++   GL G+ GEKG RG +G  G+ G  GE+G  G  GD                        +GLS I       G+IG+ G IG+ GP G  GI+GP GP G  G  G  G     G  G  G +G  GLPG PGQ+G  
Sbjct:  267 KGPKGQE---------------GKNGRDGLPGTPGVPGAPGHIFVLPIPDSEENSNRRVAQFRTSIKRTASLLKGNRGPQGMTGLPGFQGPIGYRGVKGDPGSNGDAGFIGPRGLRGMRGIPGPPGRSGTDGERGSNG-----LTGPKGRSGDIGMQGLPGNKGEKGYRGGRGSKGSLGRRGELGASGRPGDVGPPGENGPPGFQGPRGPPGPQGIRGLSGINGPPGPKGEIGEPGEIGSFGPGGPNGIQGPMGPQGGRGLSGPSGPR---GIPGPQGVQGSAGLPGNPGQQGDM 538          
The following BLAST results are available for this feature:
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL21A16.715e-4033.08collagen type XXI alpha 1 chain [Source:HGNC Symbo... [more]
COL21A15.165e-3833.02collagen type XXI alpha 1 chain [Source:HGNC Symbo... [more]
COL24A15.949e-3830.50collagen type XXIV alpha 1 chain [Source:HGNC Symb... [more]
COL21A11.240e-3732.83collagen type XXI alpha 1 chain [Source:HGNC Symbo... [more]
COL6A32.517e-3232.99collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col-1356.495e-3241.57COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
col-1356.417e-3040.55COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
emb-97.416e-2435.18Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
emb-93.903e-2335.18Collagen alpha-1(IV) chain [Source:UniProtKB/Swis... [more]
let-25.623e-2336.59Collagen alpha-2(IV) chain [Source:UniProtKB/Swis... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vkg6.701e-2940.48gene:FBgn0016075 transcript:FBtr0333541[more]
vkg6.701e-2940.48gene:FBgn0016075 transcript:FBtr0079036[more]
vkg6.701e-2940.48gene:FBgn0016075 transcript:FBtr0333540[more]
Col4a19.262e-2839.04gene:FBgn0000299 transcript:FBtr0079003[more]
Col4a19.262e-2839.04gene:FBgn0000299 transcript:FBtr0079002[more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col6a35.246e-3638.64collagen, type VI, alpha 3 [Source:ZFIN;Acc:ZDB-GE... [more]
col1a21.336e-3428.77collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
col27a1b5.136e-3335.73collagen, type XXVII, alpha 1b [Source:NCBI gene;A... [more]
CR545476.36.637e-3338.08pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:23915065:2... [more]
col7a1l1.602e-3136.75collagen type VII alpha 1-like [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000017769.19.184e-3729.86collagen, type XXVII, alpha 1 [Source:NCBI gene;Ac... [more]
ENSXETT00000032329.11.053e-3629.86collagen, type XXVII, alpha 1 [Source:NCBI gene;Ac... [more]
col1a21.191e-3540.53collagen type I alpha 2 [Source:NCBI gene;Acc:7801... [more]
ENSXETT00000010623.11.762e-3437.65collagen type VII alpha 1 chain [Source:NCBI gene;... [more]
COL5A11.184e-3327.70collagen type V alpha 1 chain [Source:HGNC Symbol;... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col6a37.078e-3931.72collagen, type VI, alpha 3 [Source:MGI Symbol;Acc:... [more]
Col6a41.160e-3238.33collagen, type VI, alpha 4 [Source:MGI Symbol;Acc:... [more]
Col24a12.612e-3136.24collagen, type XXIV, alpha 1 [Source:MGI Symbol;Ac... [more]
Col27a13.008e-3139.52collagen, type XXVII, alpha 1 [Source:MGI Symbol;A... [more]
Col11a13.846e-2929.89collagen, type XI, alpha 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17RW2|COOA1_HUMAN2.857e-3730.50Collagen alpha-1(XXIV) chain OS=Homo sapiens OX=96... [more]
sp|Q96P44|COLA1_HUMAN5.954e-3732.83Collagen alpha-1(XXI) chain OS=Homo sapiens OX=960... [more]
sp|P18856|CAF1_EPHMU5.035e-3529.51Collagen EMF1-alpha (Fragment) OS=Ephydatia muelle... [more]
sp|Q5UPS7|COLL4_MIMIV2.067e-3240.44Collagen-like protein 4 OS=Acanthamoeba polyphaga ... [more]
sp|A2AX52|CO6A4_MOUSE7.977e-3238.33Collagen alpha-4(VI) chain OS=Mus musculus OX=1009... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DJH58.161e-7332.72Collagen alpha-1(V) chain isoform 2 OS=Schistosoma... [more]
A0A095AG661.137e-7134.29Collagen alpha-1(V) chain OS=Schistosoma haematobi... [more]
A0A4D6G2U32.093e-7096.23Collagen F-10 (Fragment) OS=Schmidtea mediterranea... [more]
A0A4Z2DJT02.723e-7034.97Collagen alpha-1(V) chain isoform 1 OS=Schistosoma... [more]
A0A3Q0KKN87.930e-7032.83Putative collagen alpha-1(V) chain OS=Schistosoma ... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col5a2a3.238e-3132.68collagen, type V, alpha 2a [Source:ZFIN;Acc:ZDB-GE... [more]
col10a1a5.882e-3135.68collagen alpha-1(X) chain [Source:NCBI gene;Acc:10... [more]
col27a1b1.716e-2938.14collagen, type XXVII, alpha 1b [Source:NCBI gene;A... [more]
col5a3b5.152e-2936.54collagen, type V, alpha 3b [Source:ZFIN;Acc:ZDB-GE... [more]
col11a26.423e-2940.27collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005318.13.525e-3828.70pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 ... [more]
ENSPMAT00000009617.11.831e-2829.07pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1... [more]
ENSPMAT00000005957.12.217e-2840.00pep scaffold:Pmarinus_7.0:GL476764:306565:325487:-... [more]
ENSPMAT00000001071.12.312e-2728.65pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gen... [more]
ENSPMAT00000003566.16.838e-2734.57pep scaffold:Pmarinus_7.0:GL476944:532:45496:-1 ge... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447291.509e-3929.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493681.851e-3827.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330502.240e-3239.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446976.100e-2737.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429534.531e-2537.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col11.344e-3435.82collagen type I alpha 1 [Source:NCBI gene;Acc:1001... [more]
col18.004e-3435.82collagen type I alpha 1 [Source:NCBI gene;Acc:1001... [more]
ENSORLT00000017411.23.526e-3330.45pep primary_assembly:ASM223467v1:12:26266454:26296... [more]
col11a26.787e-3135.53collagen alpha-1(XI) chain [Source:NCBI gene;Acc:1... [more]
ENSORLT00000020576.24.083e-2939.22collagen alpha-2(VI) chain [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077977.11.002e-699.90SMESG000077977.1[more]
SMESG000077977.18.753e-799.90SMESG000077977.1[more]
SMESG000077977.11.497e-699.05SMESG000077977.1[more]
SMESG000077977.15.170e-799.05SMESG000077977.1[more]
SMESG000077782.15.107e-8737.07SMESG000077782.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034772 ID=SMED30034772|Name=Fibrillar collagen NC1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3193bp
GATAAAACTAATGTAAAAATAATTATTTTAATTTCAGGTGGACAAAAGTA
TCAATTCAAGTATCAGTTATTGAGATAACTGCAAAGGTTAATTGTAACCA
GACCCAGACATTCCAGAACGATGCTCTTGCAGAGTGGCTATTGATGTCAC
GATTAAATATAATCTTAAATTCAGAAAACAATCATTTTCTTGGGTACATA
GCAAATATTTTAATATCTCCGTTACTGATAAATCATAACGGTTTGGTGAC
AAATGAATGCTCACTAATGATCTGTCTTGTGAAAGACTTCAAGAACGATT
TGTCAATCATTCGAATTGAGACTGGGATTCTTTCCGAATATTCAGTTTCT
CTCCATGAGACAAAATTGGAAGCCAGTTACATTACCTGTGAAAATAAAAA
TATTTTCACAGTTATGGTAAACCAAACCGATAGTACGAAGATGTTAAATC
CCATTTCATTACAGAGTGATCTGTTAGTTGAAAAGTATATTTCATTCTAC
ATAGATTTAACGCAGACGCGTTACAAGTTAACTTCGGAAAATCCGTTGCT
GAGTCTGTTTAACTATGATAAAAGTGCTTCTGCTCTTATTGAGCTTAGTG
CAAATTCAATAATTATTATAATATCCGATGGAAATCGGTTGTTTAATTTT
GATTTCAAGGTTCCAAAGCTAGAAACTGGATGGAATAAAATTGAAATCGC
GATTGTATCGGATAAAATAGGCTTGCGGATAAACTGTCAAGAAATAGAAT
TTATAAGAAATCAAGAACTGAAGGATATTAAACGGTATACAAAGGTTCTA
ATTCTTGGAAATCTGTGGAATTTTAAATCGTTTTACAAAGCACGACTTGC
ACAATTAAATATTAAATCAAATTCAAATGAAATGGAAAAATGCGTAATAG
ATAAGTGCTTGATGAAAATGTCATATAAAGAATCAAAAACAACAACAACA
TTCAGTACAACTTCATTTAAAATTACTACAACCGCTGAAAAACTTCTGAA
AAGAGGAGAGAAAGGAACAGTTGGTTCCAAAGGTCATCCTGGAGCAAAAG
GAGATATTGGTGAAAAAGGCCTTCCTGGCAAGAAAGGAGAAAAGGGTGAT
ATCGGTTTTAGAGGATTTCCTGGTGAAAATGGAATAAAAGGTGTTGCAGT
TAAAGGAGAGGCAGGAGTTCAAGGTAGTCAAGGAATGCCTGGATATAAAG
GAGAGAAAGGAAATACTGGTATTGGAGGAAACCCGGGATTATTAGGTTTT
GCTGGTAACAGAGGCAAAAAAGGAGTAAAAGGAAATAATGGCCAAAAAGG
AGAAAAAGGGGAAATTGGCAGGCAAGGAAATCGTGGAGAAATGGGAGAAA
TTGGTTTACCTGGAATTTTGGGTAAGATAGGAACTTCCGGAAAACCGGGG
AAACAAGGAATTAAAGGATTCAAAGGAAATGTTGGAAAGAGTGGTCCTAA
AGGCAATAGTGGTACTCCTGGAAAAATGGCTATAAAAGGAATAAAAGGAA
CAAAAGGTTCCAAGGGAATTCAAGGACAATCGAATGTCAATCGTGGTCCT
CAAGGTGATCCTGGTTTAGCTGGTATTCCAGGAGAAAATGGAAATATCGG
AGTAAAAGGAGAAAAGGGTCTAATGGGTATATCTGGTGAAAAAGGCGATA
TTGGAAAATCTGGAAAACTTGGAAAAGATGGATTAATTGGAGAGCCTGGG
AAAATTGGAATTCAAGGTTTAAAGGGTGAAATTGGACAGCCAGGAGAAAA
AGGCACTAAAGGCGCTAAAGGTTTGCCTGGTATAGAAGGCGAGCCAGGAG
ATCAAGGAGAAATTGGAGCGATGGGTTTAATTGGTTTACCTGGTGAATCA
GGATTAAGAGGTACTCCGGGACCTGAAGGAGATGAAGGTTTACATGGTCC
AATTGGTGACGATGGTCCAAGAGGAACTGCACTTCCTGGAATCAAGGGAG
TCAAAGGCGAAATGGGTCTCATTGGGGATATTGGAGAGAAAGGAGATAGA
GGACCGAAAGGTGAAAATGGAAATCCTGGTATTCCAGGGGAAGTTGGCAT
AAAGGGTGAAATTGGGGATAAAGGATTAAGTGTAATTGGAAAAATTGGAA
AATATGGAACAATAGGAAATACCGGCCCGAAAGGCTTGGAAGGAATAAGA
GGTCCAAGAGGCCCTATTGGATTAGTTGGGGAAGTTGGTAAAGTTGGATA
TAATGGGACTAAAGGTGAAATTGGTGAAATTGGTGAAAAGGGTGATAAGG
GATTACCTGGAGTCCCTGGACAAAGGGGTACTTTTATTTTGAAAAATTTA
GCAAAAGAACAACTATCAAATATAAGTAAATCGCTTATAACTATTTTCAA
TGAAGAAACAAAAATAATAAATTTTACACAAGTAAAGATAGATGCTGTAA
GTCGAATGAAAACGGTTCTCCAAAGTGTGAGCAGTTACCGAAGCAATAGA
GGAAGTTCTTCAAATTTCCCATTAAACAGCTGTCAAGATATGCAACTTCA
AATTACGATTGAACTACCTGAGGCCGTCTGGCTAGATCCAAATGAAGGAA
ATTCTGATGACTCTTTTAAAGGAGCTTGCAAAAAGAGTGAATATAAATAT
TCAGCAGAGACTATCAAGCCTTTGCTGACATGCGTCCGTTCATCATACGA
AGCTGGAGATTTATTGACCTATCTCAAACCGTATGATTCAGAAACCACCT
GGCAAAGTGAGTTAAGAGTTGATGGTTTAGTTTTATACCCTCCAAATTTA
AGGAAAGGTTATCCTCATATAAGTCAGTTAAATTTTCTACAGATGAGATC
AGAATATGCTGAACAAGAAGTGGAATTTTTATGTGAAGAGTCAATAGTTT
ATGGAGATGTTTTGGATAATAAAGATAGCTTACGATATGCGACCGCTTTT
CAGACATTTGATGATAATTACATAGACCTTTCAAAAGGGAAATCTCTGGG
TCCTGGTTATGGATTTATGGACAAACGCATTTATTTATTTGAAAATGGAC
GTAGTATTTTCAATGTCACAATTTTATATGATGAATGCAAGTTTAAAGCT
CCTGGAACATTTACCAAAATGTTGTTGAGTACAAATAAACCAGATATGCT
TCCTATTGTGGATTACAGAATCAAATATTTCAATGACAACGGAAAGTGTA
TGCTAGGGGCCAATATTTATCCAGCGTGTTTTGTTTGAATGAT
back to top

protein sequence of SMED30034772-orf-1

>SMED30034772-orf-1 ID=SMED30034772-orf-1|Name=SMED30034772-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1015bp
MSRLNIILNSENNHFLGYIANILISPLLINHNGLVTNECSLMICLVKDFK
NDLSIIRIETGILSEYSVSLHETKLEASYITCENKNIFTVMVNQTDSTKM
LNPISLQSDLLVEKYISFYIDLTQTRYKLTSENPLLSLFNYDKSASALIE
LSANSIIIIISDGNRLFNFDFKVPKLETGWNKIEIAIVSDKIGLRINCQE
IEFIRNQELKDIKRYTKVLILGNLWNFKSFYKARLAQLNIKSNSNEMEKC
VIDKCLMKMSYKESKTTTTFSTTSFKITTTAEKLLKRGEKGTVGSKGHPG
AKGDIGEKGLPGKKGEKGDIGFRGFPGENGIKGVAVKGEAGVQGSQGMPG
YKGEKGNTGIGGNPGLLGFAGNRGKKGVKGNNGQKGEKGEIGRQGNRGEM
GEIGLPGILGKIGTSGKPGKQGIKGFKGNVGKSGPKGNSGTPGKMAIKGI
KGTKGSKGIQGQSNVNRGPQGDPGLAGIPGENGNIGVKGEKGLMGISGEK
GDIGKSGKLGKDGLIGEPGKIGIQGLKGEIGQPGEKGTKGAKGLPGIEGE
PGDQGEIGAMGLIGLPGESGLRGTPGPEGDEGLHGPIGDDGPRGTALPGI
KGVKGEMGLIGDIGEKGDRGPKGENGNPGIPGEVGIKGEIGDKGLSVIGK
IGKYGTIGNTGPKGLEGIRGPRGPIGLVGEVGKVGYNGTKGEIGEIGEKG
DKGLPGVPGQRGTFILKNLAKEQLSNISKSLITIFNEETKIINFTQVKID
AVSRMKTVLQSVSSYRSNRGSSSNFPLNSCQDMQLQITIELPEAVWLDPN
EGNSDDSFKGACKKSEYKYSAETIKPLLTCVRSSYEAGDLLTYLKPYDSE
TTWQSELRVDGLVLYPPNLRKGYPHISQLNFLQMRSEYAEQEVEFLCEES
IVYGDVLDNKDSLRYATAFQTFDDNYIDLSKGKSLGPGYGFMDKRIYLFE
NGRSIFNVTILYDECKFKAPGTFTKMLLSTNKPDMLPIVDYRIKYFNDNG
KCMLGANIYPACFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000428musculature system
Vocabulary: INTERPRO
TermDefinition
IPR000885Fib_collagen_C
IPR008160Collagen
Vocabulary: molecular function
TermDefinition
GO:0005201extracellular matrix structural constituent
Vocabulary: cellular component
TermDefinition
GO:0005581collagen trimer
GO:0005578proteinaceous extracellular matrix
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000885Fibrillar collagen, C-terminalSMARTSM00038COLFI_2coord: 748..1014
e-value: 1.9E-6
score: -56.0
IPR000885Fibrillar collagen, C-terminalPFAMPF01410COLFIcoord: 752..929
e-value: 8.8E-15
score: 54.6
IPR000885Fibrillar collagen, C-terminalPROSITEPS51461NC1_FIBcoord: 749..1014
score: 15.443
IPR008160Collagen triple helix repeatPFAMPF01391Collagencoord: 337..392
e-value: 2.2E-8
score: 33.7
coord: 288..333
e-value: 7.0E-8
score: 32.1
coord: 658..711
e-value: 3.7E-8
score: 33.0
NoneNo IPR availableGENE3DG3DSA:2.60.120.1000coord: 752..1014
e-value: 2.6E-22
score: 81.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 453..481
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 289..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..444
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 468..655
coord: 368..555
coord: 287..462
NoneNo IPR availablePANTHERPTHR24023:SF972COLLAGEN ALPHA-1(IV) CHAINcoord: 522..712
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 522..712
NoneNo IPR availablePANTHERPTHR24023:SF972COLLAGEN ALPHA-1(IV) CHAINcoord: 468..655
coord: 368..555
coord: 287..462
NoneNo IPR availablePRODOMPD002078coord: 882..1013
e-value: 3.0E-4
score: 111.0