synaptotagmin-14

Overview
Namesynaptotagmin-14
Smed IDSMED30034767
Length (bp)1659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of synaptotagmin-14 (SMED30034767) t-SNE clustered cells

Violin plots show distribution of expression levels for synaptotagmin-14 (SMED30034767) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of synaptotagmin-14 (SMED30034767) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for synaptotagmin-14 (SMED30034767) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034767

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034767SMESG000051011.1 SMESG000046823.1 dd_Smed_v4_9164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of synaptotagmin-14 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 191.045 bits (484), Expect = 1.761e-53
Identity = 115/314 (36.62%), Postives = 182/314 (57.96%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L         ++  YN +    G D  +S  ++S + S   +   +++E H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEELNHW+E+ E    +V   H L
Sbjct:  222 KYGTLDVTFDYDSQEQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHS----GCDSQMSVSEMSCSES---TSSCQSLE-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 514          
BLAST of synaptotagmin-14 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 191.045 bits (484), Expect = 1.761e-53
Identity = 115/314 (36.62%), Postives = 182/314 (57.96%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L         ++  YN +    G D  +S  ++S + S   +   +++E H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEELNHW+E+ E    +V   H L
Sbjct:  222 KYGTLDVTFDYDSQEQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHS----GCDSQMSVSEMSCSES---TSSCQSLE-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 514          
BLAST of synaptotagmin-14 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 191.045 bits (484), Expect = 3.476e-53
Identity = 115/314 (36.62%), Postives = 182/314 (57.96%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L         ++  YN +    G D  +S  ++S + S   +   +++E H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEELNHW+E+ E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSQEQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHS----GCDSQMSVSEMSCSES---TSSCQSLE-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 552          
BLAST of synaptotagmin-14 vs. Ensembl Human
Match: SYT16 (synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:23142])

HSP 1 Score: 184.882 bits (468), Expect = 2.314e-50
Identity = 102/260 (39.23%), Postives = 154/260 (59.23%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTL-NMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S V S+Q+H  +LP KK R ++ I++G +P+F E     K+      +  +RFRLY ++  T   M+G+ L  LS +    + +  L +          +       S   S  S     H   PEL++GLS+N+ +GRL+VE+I+GS   +L+  +  D Y KL L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTLMISV  ++++ RKE++GW+ALG  SSGEEE +HW E+ E    ++   H L
Sbjct:  383 SGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTFAKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTL 642          
BLAST of synaptotagmin-14 vs. Ensembl Human
Match: SYT14 (synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:23143])

HSP 1 Score: 182.956 bits (463), Expect = 4.102e-50
Identity = 116/333 (34.83%), Postives = 183/333 (54.95%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKN-----------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L         ++  YN +    G D  +S  ++S + S   +   +++E H   PE++IGL +N+ +GRL+ E+I+GS     + ++  N                 +D YVKL+L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEELNHW+E+ E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSQEQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHS----GCDSQMSVSEMSCSES---TSSCQSLE-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 571          
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 83.9593 bits (206), Expect = 5.206e-17
Identity = 84/304 (27.63%), Postives = 141/304 (46.38%), Query Frame = 3
Query:  591 VRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN---KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMF-QVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            ++  L  D    +L + ++Q  DL G +          +S TS  Y   +   +LP KK + ++K+ R+  +P+FNE F + K+      + TL F +Y   + S  + IGQ L  L  IDL    E    I+ P +D                       E      ++   L +   +G+LTV I+   +L K       D YVKL +F  + + L   KT+I++ T++P F ESF+F ++ L +MK+V+LMI+V+    +   + +G   LG   +G  EL HW +++   +  +   H L
Sbjct:  163 IQYKLDYDFQQGQLTVTVIQAEDLPGMD----------MSGTSDPY---VKLYLLPEKKKKVETKVHRKTLNPVFNETF-IFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDK----------------------EAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNGTG-AELRHWMDMLASPRRPIAQWHTL 429          
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Match: snt-4 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:P91493])

HSP 1 Score: 80.1073 bits (196), Expect = 5.702e-16
Identity = 58/254 (22.83%), Postives = 119/254 (46.85%), Query Frame = 3
Query:  738 IHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNK---DFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +   +LP ++ R K++I R    P++ E F +  +  E  N  TL F++    + S   ++G+C+  L+  +L V  E  + +         +TD ++  G                  EL++ L++ +    LTV +++   L    +    D +VKL L   +G+ +   +T +R++T++PV+ ESF+F++   +++   + + V+    ++R +V+G   L  + S      H  E++E    +V   H L
Sbjct:  155 VKLQLLPEREHRVKTRIVRSTTSPVYEEQFAMYGVTHEQVNFATLHFQVVAFDRYSRDTVVGECVYRLADAELQVHNEMRVELPLLPR----ATDTVAARG------------------ELLLSLTYQAAFNNLTVVVLKARGLGGRNDAGTADPFVKLYLRKESGERIVKKRTHVRRSTLNPVYNESFVFELPDDRLEHSVIDLQVINHDRVNRNDVIGRALLNMEDS------HVVEVLENPGRQVAQWHHL 380          
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 78.5666 bits (192), Expect = 2.974e-15
Identity = 84/303 (27.72%), Postives = 138/303 (45.54%), Query Frame = 3
Query:  591 VRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN---KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            ++  L  D    +L + ++Q  DL G +          +S TS  Y   +   +LP KK + ++K+ R+  +P+FNE F + K+      + TL F +Y   + S  + IGQ L  L  IDL    E    I+ P +D                       E      ++   L +   +G+LTV I+   +L K       D YVK+ L    G+ L   KTSI+K T++P + ESF F+V   Q+++V+LMI+V+    +   + +G   LG   +G  EL HW +++   +  +   H L
Sbjct:  163 IQYKLDYDFQQGQLTVTVIQAEDLPGMD----------MSGTSDPY---VKLYLLPEKKKKVETKVHRKTLNPVFNETF-IFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEWKDIAPPPDDK----------------------EAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQG-GKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNGTG-AELRHWMDMLASPRRPIAQWHTL 427          
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 75.0998 bits (183), Expect = 2.592e-14
Identity = 86/349 (24.64%), Postives = 152/349 (43.55%), Query Frame = 3
Query:  495 TNKDILDTWEETTLEEVSKSGSIIRK-GNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVF-YVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEK---NKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNH-----WSEIMEGAKSEVMHSHRLHQNSSSKK 1508
            TN D  +     TL  +S SG++I++ GN    +   +  D   SKL + I+   DL              + R      Y +   VLP +K +F+++I R   +P +NE F +    NE  + ++ L    Y  + S  + +GQ    L SID  + T+    + +P +DD                      E   R  ++     +   +G +T+ I+   +L K     + D YVK+ L     + LS  KTS +  T++P + ESF F++    +++V L++SV     + + + +G V LG K     ++ H     W+E+M  ++  V+  H L +    +K
Sbjct:   59 TNSDYYEPVNNGTLP-LSSSGALIKQYGN----IHFRVEYDFEQSKLSVTIVSASDL------------PAMDRNGMSDPY-VKVYVLPERKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDY-DRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDD----------------------EKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGR-KLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMT-SRRPVVQWHTLQERMEKEK 364          
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 70.4774 bits (171), Expect = 9.755e-14
Identity = 49/152 (32.24%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1044 RSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQ--MKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            R  +S++  G     E+MI L +   SG++TV II+   L    + ++ D YVK+ +    G +L   KTS++ +T SP+F ESF F + + Q  + EV L+++ +    I   E +G V +G   S E    HWSE +   +  V   H+L
Sbjct:   49 RPTVSKDACG-----EIMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWMVQ-QGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGS-EHGQRHWSECVNHPEQPVAMWHKL 193          
BLAST of synaptotagmin-14 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0336485)

HSP 1 Score: 191.815 bits (486), Expect = 1.748e-53
Identity = 106/251 (42.23%), Postives = 158/251 (62.95%), Query Frame = 3
Query:  735 QIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT-STLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVI--STDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVM 1469
            Q+   +LP KK + K+KIR G +P + E F + ++N E  N++ LR RLYG +      +IG+     +++DL ++T   L +        +  ++D +S+  SE  S  S +   H    EL++GLS+N  +GRL+VEII+GS   SLS  K  D YVK+ + SS GQE+S  KTSIR+   +P+FKE+F FQVALFQ+ +VTLMISV AK+ + + E+VGW +LG  SSG EE+ HW+++ E  K E++
Sbjct:  329 QVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSE--SAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEML 577          
BLAST of synaptotagmin-14 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0078957)

HSP 1 Score: 191.815 bits (486), Expect = 1.748e-53
Identity = 106/251 (42.23%), Postives = 158/251 (62.95%), Query Frame = 3
Query:  735 QIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT-STLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVI--STDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVM 1469
            Q+   +LP KK + K+KIR G +P + E F + ++N E  N++ LR RLYG +      +IG+     +++DL ++T   L +        +  ++D +S+  SE  S  S +   H    EL++GLS+N  +GRL+VEII+GS   SLS  K  D YVK+ + SS GQE+S  KTSIR+   +P+FKE+F FQVALFQ+ +VTLMISV AK+ + + E+VGW +LG  SSG EE+ HW+++ E  K E++
Sbjct:  329 QVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSE--SAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEML 577          
BLAST of synaptotagmin-14 vs. Ensembl Fly
Match: Syt14 (gene:FBgn0261086 transcript:FBtr0339551)

HSP 1 Score: 191.43 bits (485), Expect = 5.381e-53
Identity = 106/251 (42.23%), Postives = 158/251 (62.95%), Query Frame = 3
Query:  735 QIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT-STLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVI--STDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVM 1469
            Q+   +LP KK + K+KIR G +P + E F + ++N E  N++ LR RLYG +      +IG+     +++DL ++T   L +        +  ++D +S+  SE  S  S +   H    EL++GLS+N  +GRL+VEII+GS   SLS  K  D YVK+ + SS GQE+S  KTSIR+   +P+FKE+F FQVALFQ+ +VTLMISV AK+ + + E+VGW +LG  SSG EE+ HW+++ E  K E++
Sbjct:  329 QVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSE--SAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEML 577          
BLAST of synaptotagmin-14 vs. Ensembl Fly
Match: Syt4 (gene:FBgn0028400 transcript:FBtr0081578)

HSP 1 Score: 98.9821 bits (245), Expect = 9.452e-22
Identity = 74/275 (26.91%), Postives = 141/275 (51.27%), Query Frame = 3
Query:  696 TNVLSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSK---EKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQV-----ALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQ 1490
            T +  RT +     +   +LP K+ + K+++ R   +P+++E F    +N     +++L F +    + S  ++IG+ +C L+SI++   ++  L+IS+          +I     +IR+      +G     EL+I L     +GRLTV +++  +L +       D YVK+ L   NGQ ++  KT ++K T+SPVF ESF F +     A   ++ V+L + ++    + + EV+G + LG  +S    LNHW+E+    + ++   H+L++
Sbjct:  220 TGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSIEIGDISKEALSISK----------EIQPRSLKIRA------QGRG---ELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLY-NGQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTALNHWNEVCNSPRRQIAEWHKLNE 474          
BLAST of synaptotagmin-14 vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 89.7373 bits (221), Expect = 9.691e-19
Identity = 77/276 (27.90%), Postives = 131/276 (47.46%), Query Frame = 3
Query:  705 LSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN---KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 1517
            +  TS  Y   +   +LP KK +F++K+ R+   P+FNE F    +    A + TL F ++   + S  + IG+    L +IDL+   E                        E R ++S   EG  +  ++   L +   +G+LTV I+   +L K       D YVK+++   NG+ L   KTSI+K T++P + ESF F+V   Q++++ L+++VV    I   E +G   LG   +G  EL HWS+++   +  +   H L     + + L+
Sbjct:  224 MGGTSDPY---VKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIE------------------------EWRDLVSVEGEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQ-NGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSDMLASPRRPIAQWHTLKDPEETDEILK 470          
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 188.734 bits (478), Expect = 1.334e-52
Identity = 112/291 (38.49%), Postives = 174/291 (59.79%), Query Frame = 3
Query:  651 VFDLFGTENRID---TKKTNV--LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDL----SVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD   ++ R+    T  T++  L RT ++ S+Q+H  +LP KK R K+ I++G  P+F E F+   I  E   +  +RFRLY   +      +G+ +  L+ ++L    SV    +   + PG D   S   +S   SE  S      +G    PE+++GL +N+ +GRL+VE+I+GS   +L+  K  + YVKL+L +S GQE+S  KTS+ +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+E+ E    +V   H L
Sbjct:  255 VFDYDSSDQRLSISITALTDIPSLKRTGNI-SWQVHLVLLPTKKQRAKTIIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGKMSVPIILDPYCNIPGSDSQASMSDVSC--SETASSYPSAAQG--SAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSL 540          
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 180.644 bits (457), Expect = 5.089e-50
Identity = 113/310 (36.45%), Postives = 175/310 (56.45%), Query Frame = 3
Query:  651 VFDLFGTENRID---TKKTNV--LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDL----SVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKN-----------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD   ++ R+    T  T++  L RT ++ S+Q+H  +LP KK R K+ I++G  P+F E F+   I  E   +  +RFRLY   +      +G+ +  L+ ++L    SV    +   + PG D   S   +S   SE  S      +G    PE+++GL +N+ +GRL+VE+I+GS     + +K  N                 +D YVKL+L +S GQE+S  KTS+ +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+E+ E    +V   H L
Sbjct:  193 VFDYDSSDQRLSISITALTDIPSLKRTGNI-SWQVHLVLLPTKKQRAKTIIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGKMSVPIILDPYCNIPGSDSQASMSDVSC--SETASSYPSAAQG--SAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSL 497          
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 180.644 bits (457), Expect = 1.497e-49
Identity = 114/319 (35.74%), Postives = 175/319 (54.86%), Query Frame = 3
Query:  651 VFDLFGTENRID---TKKTNV--LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT--------------STLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKN-----------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD   ++ R+    T  T++  L RT ++ S+Q+H  +LP KK R K+ I++G  P+F E F+   I  E   +  +RFRLY  +               + LN+ G+      S+ + +D   N+    PG D   S   +S   SE  S      +G    PE+++GL +N+ +GRL+VE+I+GS     + +K  N                 +D YVKL+L +S GQE+S  KTS+ +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+E+ E    +V   H L
Sbjct:  253 VFDYDSSDQRLSISITALTDIPSLKRTGNI-SWQVHLVLLPTKKQRAKTIIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGK-----MSVPIILDPYCNI----PGSDSQASMSDVSC--SETASSYPSAAQG--SAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSL 557          
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Match: syt14a (synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-090313-200])

HSP 1 Score: 181.03 bits (458), Expect = 1.543e-49
Identity = 114/319 (35.74%), Postives = 175/319 (54.86%), Query Frame = 3
Query:  651 VFDLFGTENRID---TKKTNV--LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT--------------STLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKN-----------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD   ++ R+    T  T++  L RT ++ S+Q+H  +LP KK R K+ I++G  P+F E F+   I  E   +  +RFRLY  +               + LN+ G+      S+ + +D   N+    PG D   S   +S   SE  S      +G    PE+++GL +N+ +GRL+VE+I+GS     + +K  N                 +D YVKL+L +S GQE+S  KTS+ +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+E+ E    +V   H L
Sbjct:  270 VFDYDSSDQRLSISITALTDIPSLKRTGNI-SWQVHLVLLPTKKQRAKTIIQRGPCPVFTETFHFSHIESEMIGNYAIRFRLYSVRRMKKEKALGEKVFYLTKLNLQGK-----MSVPIILDPYCNI----PGSDSQASMSDVSC--SETASSYPSAAQG--SAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTEMKESKGQQVCRWHSL 574          
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Match: syt14b (synaptotagmin XIVb [Source:ZFIN;Acc:ZDB-GENE-041014-36])

HSP 1 Score: 171.4 bits (433), Expect = 1.854e-46
Identity = 96/257 (37.35%), Postives = 153/257 (59.53%), Query Frame = 3
Query:  729 SYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKK-SIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S+Q+H  +LP KK R K+ +++G  P+F E F    + E+A     +RFRLY   +     ++G+ +  L+ ++L       +T+ EPG         +SV+ S     +S    G    PEL++GL +NS +GRL+ E+I+GS     + +K  + YVKL++  S G+E+S  KTS+ +   +P +KE+F+FQVALFQ+ EVTL +SV +++ S+ R+E VGWVALG  S+ EE+  HW+++ E    +V H H L
Sbjct:  273 SWQVHLVLLPTKKQRAKTGVQKGPCPVFTETFRFSCVEEDALGDYAVRFRLYSVRRMKKEKVLGEKVFYLTKLNLQGKLALPVTL-EPGTSVPGCGSVVSVSRSA--GALSCRSTGESSIPELLLGLLYNSTTGRLSAEVIKGSHFKNSASDKLPNTYVKLTMLDSKGKEMSKCKTSVCRGQPNPTYKETFVFQVALFQLSEVTLQVSVYSRRSSMKRRERVGWVALGLNSTTEEQEEHWTQMKESEGQQVCHWHTL 526          
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 191.815 bits (486), Expect = 7.780e-54
Identity = 118/316 (37.34%), Postives = 182/316 (57.59%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY-GSQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVT--GSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V DL  T NR           T +  S+Q+H  +LPVKK R K+ +++G  P F E F    I  E   +  +RFRLY   +     M+G+ +  L+ ++L         ++  Y+L+    G D  +S  ++S T   S  +S++      H   PE++IGL +N+ +GRL+ E+I+GS   +LS  +  + YVKL+L +S GQE+S  KTSIR+   +P++KE+F+FQVALFQ+ EVTL++SV  K+S+ RKE++GW++LG  SSG+E+LNHW+E+ E    +V   H L
Sbjct:  210 KYGTLDVTFDYDSQEQKLLVTVTAVTDL-PTHNR-----------TGNNNSWQVHLVLLPVKKQRAKTAVQRGPCPAFTETFKFNHIESEMIANYAVRFRLYLVRRMKKERMVGEKIFYLTKLNLQGKLSLPVVLEPAYSLS----GCDSQMSMSEMSCTESTSSCQSLV------HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTL 503          
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 192.2 bits (487), Expect = 8.346e-54
Identity = 118/316 (37.34%), Postives = 182/316 (57.59%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY-GSQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVT--GSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V DL  T NR           T +  S+Q+H  +LPVKK R K+ +++G  P F E F    I  E   +  +RFRLY   +     M+G+ +  L+ ++L         ++  Y+L+    G D  +S  ++S T   S  +S++      H   PE++IGL +N+ +GRL+ E+I+GS   +LS  +  + YVKL+L +S GQE+S  KTSIR+   +P++KE+F+FQVALFQ+ EVTL++SV  K+S+ RKE++GW++LG  SSG+E+LNHW+E+ E    +V   H L
Sbjct:  234 KYGTLDVTFDYDSQEQKLLVTVTAVTDL-PTHNR-----------TGNNNSWQVHLVLLPVKKQRAKTAVQRGPCPAFTETFKFNHIESEMIANYAVRFRLYLVRRMKKERMVGEKIFYLTKLNLQGKLSLPVVLEPAYSLS----GCDSQMSMSEMSCTESTSSCQSLV------HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTL 527          
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 191.815 bits (486), Expect = 1.326e-53
Identity = 118/316 (37.34%), Postives = 182/316 (57.59%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY-GSQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVT--GSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V DL  T NR           T +  S+Q+H  +LPVKK R K+ +++G  P F E F    I  E   +  +RFRLY   +     M+G+ +  L+ ++L         ++  Y+L+    G D  +S  ++S T   S  +S++      H   PE++IGL +N+ +GRL+ E+I+GS   +LS  +  + YVKL+L +S GQE+S  KTSIR+   +P++KE+F+FQVALFQ+ EVTL++SV  K+S+ RKE++GW++LG  SSG+E+LNHW+E+ E    +V   H L
Sbjct:  250 KYGTLDVTFDYDSQEQKLLVTVTAVTDL-PTHNR-----------TGNNNSWQVHLVLLPVKKQRAKTAVQRGPCPAFTETFKFNHIESEMIANYAVRFRLYLVRRMKKERMVGEKIFYLTKLNLQGKLSLPVVLEPAYSLS----GCDSQMSMSEMSCTESTSSCQSLV------HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTL 543          
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Match: SYT14 (synaptotagmin 14 [Source:NCBI gene;Acc:100491102])

HSP 1 Score: 190.66 bits (483), Expect = 9.701e-52
Identity = 118/316 (37.34%), Postives = 182/316 (57.59%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY-GSQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVT--GSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V DL  T NR           T +  S+Q+H  +LPVKK R K+ +++G  P F E F    I  E   +  +RFRLY   +     M+G+ +  L+ ++L         ++  Y+L+    G D  +S  ++S T   S  +S++      H   PE++IGL +N+ +GRL+ E+I+GS   +LS  +  + YVKL+L +S GQE+S  KTSIR+   +P++KE+F+FQVALFQ+ EVTL++SV  K+S+ RKE++GW++LG  SSG+E+LNHW+E+ E    +V   H L
Sbjct:  497 KYGTLDVTFDYDSQEQKLLVTVTAVTDL-PTHNR-----------TGNNNSWQVHLVLLPVKKQRAKTAVQRGPCPAFTETFKFNHIESEMIANYAVRFRLYLVRRMKKERMVGEKIFYLTKLNLQGKLSLPVVLEPAYSLS----GCDSQMSMSEMSCTESTSSCQSLV------HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLSANRPPNTYVKLTLMNSMGQEMSKCKTSIRRGQSNPLYKETFIFQVALFQLSEVTLILSVYNKRSMKRKELIGWISLGLNSSGDEQLNHWTEMKESKGQQVCRWHTL 790          
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Match: tjp1 (tight junction protein 1 [Source:Xenbase;Acc:XB-GENE-490684])

HSP 1 Score: 119.398 bits (298), Expect = 1.566e-31
Identity = 58/117 (49.57%), Postives = 82/117 (70.09%), Query Frame = 3
Query: 1143 IIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +I+GS   +L+  +  D Y KLSL  S G E+S  KTS+R+   +PV+KE+F+FQVALFQ+ + TLMIS+  ++S+ RKE++GW++LG  SSGEEE NHW E+ E    +V H H L
Sbjct:    1 MIKGSHFRNLAINRPPDTYGKLSLLDSVGHEISRCKTSVRRGQPNPVYKETFIFQVALFQLTDFTLMISIYNRRSMKRKEMIGWISLGKNSSGEEEQNHWLEMKESKGQQVCHWHTL 117          
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 182.57 bits (462), Expect = 3.483e-50
Identity = 109/308 (35.39%), Postives = 176/308 (57.14%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVIS--ENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L       + I EP  +      Q+S++ +      S  ++++ H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTS R+   +PV+KE+F+FQVALFQ+ +VTL++SV  ++S+ RKE++GW++LG  SSGEEEL HW+ + E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSERQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPV-ILEPSYNPSGCDSQVSLSEASCGDSTSSCQSLQ-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHAL 552          
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 181.8 bits (460), Expect = 1.436e-48
Identity = 109/308 (35.39%), Postives = 176/308 (57.14%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVIS--ENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L       + I EP  +      Q+S++ +      S  ++++ H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTS R+   +PV+KE+F+FQVALFQ+ +VTL++SV  ++S+ RKE++GW++LG  SSGEEEL HW+ + E    +V   H L
Sbjct:  543 KYGTLDVTFDYDSERQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPV-ILEPSYNPSGCDSQVSLSEASCGDSTSSCQSLQ-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHAL 835          
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Match: Syt14 (synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:2444490])

HSP 1 Score: 174.481 bits (441), Expect = 3.088e-47
Identity = 110/327 (33.64%), Postives = 177/327 (54.13%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVIS--ENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKN-----------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L       + I EP  +      Q+S++ +      S  ++++ H   PE++IGL +N+ +GRL+ E+I+GS     + ++  N                 +D YVKL+L +S GQE+S  KTS R+   +PV+KE+F+FQVALFQ+ +VTL++SV  ++S+ RKE++GW++LG  SSGEEEL HW+ + E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSERQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPV-ILEPSYNPSGCDSQVSLSEASCGDSTSSCQSLQ-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHAL 571          
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Match: Syt16 (synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:2673872])

HSP 1 Score: 168.318 bits (425), Expect = 3.955e-45
Identity = 101/246 (41.06%), Postives = 149/246 (60.57%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTL-NMIGQ---CLCDLSS-----IDLSVDTEYNLTISE-PGEDDVIS-TDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSG 1412
            S V S+Q+H  +LP KK R K+ I++G +P+F E     K+      S  +RFRLY ++  T   M+G+   CL  L       + L ++   NL+  E P    V+S +D  S T S            H   PEL++GLS+N+ +GRL+VE+I+GS   +L+  +  D Y KL L +  GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTLMIS+ +++++ RKE++GWVALG  SSG
Sbjct:  287 SGVNSWQVHIVLLPSKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCLSHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDSASSTQSL----------SHGGVPELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSG 522          
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Match: Syt16 (synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:2673872])

HSP 1 Score: 168.703 bits (426), Expect = 1.071e-44
Identity = 101/246 (41.06%), Postives = 149/246 (60.57%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTL-NMIGQ---CLCDLSS-----IDLSVDTEYNLTISE-PGEDDVIS-TDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSG 1412
            S V S+Q+H  +LP KK R K+ I++G +P+F E     K+      S  +RFRLY ++  T   M+G+   CL  L       + L ++   NL+  E P    V+S +D  S T S            H   PEL++GLS+N+ +GRL+VE+I+GS   +L+  +  D Y KL L +  GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTLMIS+ +++++ RKE++GWVALG  SSG
Sbjct:  377 SGVNSWQVHIVLLPSKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCLSHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDSASSTQSL----------SHGGVPELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSG 612          
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Match: sp|Q8NB59|SYT14_HUMAN (Synaptotagmin-14 OS=Homo sapiens OX=9606 GN=SYT14 PE=1 SV=2)

HSP 1 Score: 191.045 bits (484), Expect = 1.669e-52
Identity = 115/314 (36.62%), Postives = 182/314 (57.96%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLS--------VDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L         ++  YN +    G D  +S  ++S + S   +   +++E H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEELNHW+E+ E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSQEQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPVILEPSYNHS----GCDSQMSVSEMSCSES---TSSCQSLE-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELNHWTEMKESKGQQVCRWHAL 552          
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Match: sp|Q17RD7|SYT16_HUMAN (Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 1.111e-49
Identity = 102/260 (39.23%), Postives = 154/260 (59.23%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTL-NMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S V S+Q+H  +LP KK R ++ I++G +P+F E     K+      +  +RFRLY ++  T   M+G+ L  LS +    + +  L +          +       S   S  S     H   PEL++GLS+N+ +GRL+VE+I+GS   +L+  +  D Y KL L +S GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTLMISV  ++++ RKE++GW+ALG  SSGEEE +HW E+ E    ++   H L
Sbjct:  383 SGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTFAKLEPRDVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSPSAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKLFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMIGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTL 642          
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Match: sp|Q7TN84|SYT14_MOUSE (Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.436e-49
Identity = 109/308 (35.39%), Postives = 176/308 (57.14%), Query Frame = 3
Query:  579 KMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVIS--ENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            K   + V    DS   KL + +  V D+  T NR                S+Q+H  +LP+KK R K+ I++G  P+F E F    +  E   +  +RFRLYG  +     ++G+ +  L+ ++L       + I EP  +      Q+S++ +      S  ++++ H   PE++IGL +N+ +GRL+ E+I+GS   +L+  +  + YVKL+L +S GQE+S  KTS R+   +PV+KE+F+FQVALFQ+ +VTL++SV  ++S+ RKE++GW++LG  SSGEEEL HW+ + E    +V   H L
Sbjct:  260 KYGTLDVTFDYDSERQKLLVTVTAVTDI-PTYNRTGGN------------SWQVHLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVGEKIFYLTKLNLQGKMSLPV-ILEPSYNPSGCDSQVSLSEASCGDSTSSCQSLQ-HGSVPEILIGLLYNATTGRLSAEVIKGSHFKNLAANRPPNTYVKLTLLNSMGQEMSKCKTSTRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNRRSMKRKEMIGWISLGLNSSGEEELRHWTAMKESKGQQVCRWHAL 552          
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Match: sp|Q7TN83|SYT16_MOUSE (Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 7.490e-44
Identity = 101/246 (41.06%), Postives = 149/246 (60.57%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTL-NMIGQ---CLCDLSS-----IDLSVDTEYNLTISE-PGEDDVIS-TDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSG 1412
            S V S+Q+H  +LP KK R K+ I++G +P+F E     K+      S  +RFRLY ++  T   M+G+   CL  L       + L ++   NL+  E P    V+S +D  S T S            H   PEL++GLS+N+ +GRL+VE+I+GS   +L+  +  D Y KL L +  GQE+S  KTSIR+   +PV+KE+F+FQVALFQ+ +VTLMIS+ +++++ RKE++GWVALG  SSG
Sbjct:  377 SGVNSWQVHIVLLPSKKQRGKTNIQRGPNPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCLSHLHPEGEMKVTLVLEPRSNLSSGESPLSPSVVSHSDSASSTQSL----------SHGGVPELLVGLSYNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSG 612          
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Match: sp|Q58G82|SY14L_HUMAN (Putative synaptotagmin-14-like protein OS=Homo sapiens OX=9606 GN=SYT14P1 PE=5 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 1.667e-30
Identity = 62/130 (47.69%), Postives = 90/130 (69.23%), Query Frame = 3
Query: 1086 PELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEV 1466
            PE++I L +N+ +GRL+ E+I+GS L   +  +  + YVKL+L  S  QE+S  K SIR+   +PV+KE+F+F+V LFQ+  VTLM+SV  K S+ RK ++GW+ LG  SSG EELNHW+E+ E    +V
Sbjct:   51 PEILISLLYNATNGRLSAEVIKGSHLKNWAANRPPNTYVKLTLRKSTDQEMSKCKISIRRGRPNPVYKETFVFKVTLFQLSHVTLMLSVYNKSSMRRK-MIGWIYLGLNSSG-EELNHWTEMKESKGRQV 178          
BLAST of synaptotagmin-14 vs. TrEMBL
Match: T1J0L6 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.294e-57
Identity = 121/313 (38.66%), Postives = 186/313 (59.42%), Query Frame = 3
Query:  576 NKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEG------HDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +K   +      D+ + K+ I++LQ  D+  T++R                + Q+   +LP KK + K+KIRQG  P FNE F   +IN E   S+ +RFRLYG +      MIG+ +    S++L  +T + LT+ EP  +      Q   + +++ S+   +  G      H   PEL++GLS+N  +GRL+VE+I+GS   +L+  +  D YVKLSL SSN QE++ +KTSIR+   +P+FKE+FMFQVALFQ+ +VTLM+SV  K+++ RKE++GW +LG  SSGEEEL+HW+++ +    +V   H L
Sbjct:  248 SKCGNLEAAFAYDAPTRKVTIRVLQARDI-PTKDR------------GGANNVQVRLLLLPSKKQKHKTKIRQGDCPQFNETFLFSRINPEEVTSMGVRFRLYGCERMRRERMIGESIVSFVSLNLDQETTHWLTL-EPRTNLACVIKQHGDSKTDLSSLARSDSTGSTQSMQHGGVPELLLGLSYNGTTGRLSVEVIKGSHFRNLAMNRAPDTYVKLSLMSSNNQEIARSKTSIRRGQPNPLFKETFMFQVALFQLPDVTLMVSVYNKRNMKRKEMIGWFSLGLNSSGEEELSHWNDMRDSKGEQVCRWHVL 546          
BLAST of synaptotagmin-14 vs. TrEMBL
Match: A0A2P8XRQ6 (Synaptotagmin-16 OS=Blattella germanica OX=6973 GN=SYT16 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.239e-57
Identity = 116/310 (37.42%), Postives = 190/310 (61.29%), Query Frame = 3
Query:  576 NKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVI---STDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +K   + V    D+   K+ +++LQ  D+   +            R  + ++ Q+   +LP K+ + K+K+RQG +P + E F + ++N E  NS+ +RFRLYG +      MIG+C+   +SI+L ++T   + + EP  +  +   ++D +S+  S+  S  S +   H   PEL++GL++N  +GRL+VE+++GS   +L+  +  D YVKL L SS GQE+S +KTSIR+   +P+FKE+FMFQVALFQ+ +VTLM+SV  K+S+ RKE++GW +LG  SSGEEEL HW+++ +    ++   H L
Sbjct:  185 SKCGHLEVAFAYDAPMRKMTVRVLQARDIPARD------------RGGATHT-QVRLVMLPSKRQKHKTKVRQGNNPQYMESFLLHRVNPEDVNSMGVRFRLYGCERMRRERMIGECVVSFTSINLELETTMWIAL-EPRANLTLNSSASDLLSLARSD--STGSTHSMQHGGVPELLLGLAYNGTTGRLSVEVVKGSHFRNLAMTRPPDTYVKLCLVSSTGQEMSRSKTSIRRGQPNPLFKETFMFQVALFQLPDVTLMVSVYNKRSMKRKEMIGWFSLGLNSSGEEELAHWNDMRDVRGEQICRWHVL 478          
BLAST of synaptotagmin-14 vs. TrEMBL
Match: A0A067QZG2 (Synaptotagmin-16 OS=Zootermopsis nevadensis OX=136037 GN=L798_14257 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.288e-56
Identity = 114/310 (36.77%), Postives = 193/310 (62.26%), Query Frame = 3
Query:  576 NKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVI---STDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +K   + V    D+   K+ +++LQ  D+   +            R  + ++ Q+   +LP K+ + K+K+RQG +P + E F + ++N E  NS+ +RFRLYG +      MIG+C+   +SI+L ++T   +T+ EP  +  +   ++D +S+  S+  S  S +   H   PEL++GL++N  +GRL++E+++GS   +L+  +  D YVKL L SS+GQE+S +KTSIR+   +P+FKE+FMFQVALFQ+ +V+LM+SV  K+S++RKE++GW +LG  SSGEEE+ HW+++ +    ++   H L
Sbjct:  194 SKCGHLEVAFAYDAPMRKMTVRVLQARDIPARD------------RGGATHT-QVRLVMLPSKRQKHKTKVRQGNNPQYTESFLLHRVNPEDVNSMGVRFRLYGCERMRRERMIGECVVSFTSINLELETTMWVTL-EPRVNLTLNSSASDLLSLARSD--STGSTHSMQHGGVPELLLGLAYNGTTGRLSIEVVKGSHFRNLAMTRPPDTYVKLCLLSSSGQEMSRSKTSIRRGQPNPLFKETFMFQVALFQLPDVSLMVSVYNKRSMNRKEMIGWFSLGLSSSGEEEVAHWNDMRDVRGEQICRWHIL 487          
BLAST of synaptotagmin-14 vs. TrEMBL
Match: A0A2P6KHH9 (Syt14 OS=Nephila clavipes OX=2585209 GN=NCL1_39917 PE=4 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 1.322e-56
Identity = 135/346 (39.02%), Postives = 196/346 (56.65%), Query Frame = 3
Query:  465 DSTRASIRSVTNKDILDTWE-ETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTG-SEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            D+  A   SV    I D  E    +EE S   S +R G+    + V    D    K+ + +LQ  DL   E            R  S +  Q+   +LP K+ +FK+KIR G+ P FNE F   +I+ E  NS+ +RFRL G +     ++IG+C+   SSI +   T   LT+ EP  +   S  +  +T  +   S  S     H   PEL++GL++N  +GRL+VEI +GS   ++S  +  D YVKLSL SSNGQE++ +KTS+R+   +P+FKE+F+FQVALFQ+ +VTLMISV  K+S+ RKE++GW +LG  SSG+EEL HW+++ E    +V   H L
Sbjct:  205 DTFSACGDSVMEDQIFDATELHCNVEETS---SAVRCGS----LEVGFAYDPPLRKMTVHVLQAQDLPDRE------------RGGSNH-VQVRLLLLPHKRQKFKTKIRTGSKPQFNESFIFNRISPEELNSMGVRFRLNGCERMRREHLIGECIVHFSSIRMDQQTTLWLTL-EPRSNIAHSDSKADITSLTRSDSTGSTQSMQHGGMPELLLGLAYNGTTGRLSVEINKGSHFRNVSMNRAPDTYVKLSLVSSNGQEIARSKTSVRRGQPNPLFKETFIFQVALFQLPDVTLMISVYNKRSMKRKEMIGWFSLGLNSSGDEELAHWNDMRENRGEQVCRWHAL 529          
BLAST of synaptotagmin-14 vs. TrEMBL
Match: A0A4Y2DXR8 (Synaptotagmin-16 OS=Araneus ventricosus OX=182803 GN=SYT16 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.328e-56
Identity = 134/346 (38.73%), Postives = 193/346 (55.78%), Query Frame = 3
Query:  465 DSTRASIRSVTNKDILDTWE-ETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTG-SEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            D+  A   SV    I D  E    +EE S   S +R G+    + V    D    K+ + +LQ  DL    +R      +V          Q+   +LP K+ +FK+KIR G+ P FNE F   +I+ E   S+ +RFRL G +     ++IG+C+   SSI +   T   LT+ EP  +   S  +  +T  +   S  S     H   PEL+IGL++N  +GRL+VEI +GS     S  +  D YVKLSL SSNGQE++ +KTS+R+   +P+FKE+F+FQVALFQ+ +VTLMISV  K+S+ RKE++GW +LG  SSG+EEL HW+++ E    +V   H L
Sbjct:  212 DTFSACGDSVMEDQIFDATELHCNVEETS---SAVRCGS----LEVGFAYDPPLRKMTVHVLQAQDL---PDRDRGGSNHV----------QVRLLLLPHKRQKFKTKIRTGSKPQFNESFIFSRISPEELTSMGVRFRLNGCERMRREHLIGECIVPFSSIRMDQQTTLWLTL-EPRSNIAHSDSKADITSLARSDSTGSTQSMQHGGMPELLIGLAYNGTTGRLSVEINKGSHFRNASMNRAPDTYVKLSLVSSNGQEIARSKTSVRRGQPNPLFKETFIFQVALFQLPDVTLMISVYNKRSMKRKEMIGWFSLGLNSSGDEELAHWNDMRENKGEQVCRWHAL 536          
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Match: syt14a (synaptotagmin-14 [Source:NCBI gene;Acc:103044022])

HSP 1 Score: 185.652 bits (470), Expect = 3.880e-51
Identity = 113/297 (38.05%), Postives = 172/297 (57.91%), Query Frame = 3
Query:  651 VFDLFGTENRIDTKKTNV-----LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISE----------NIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD    + R+    T V     L RT +V S+Q+H  +LP KK R K+ I +G  P+F E F    I  E  ++  +RFRLY   +     ++G+ +  L+ ++L         +S P    VI     S+TGSE ++ IS+                  PE+++GL +N+ +GRL+VE+I+GS   +L+  K  + YVKL+L +S GQE+S  KTSI +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+++ E    +V   H L
Sbjct:  319 VFDYDSCDQRLAVTVTAVTDIPPLKRTGNV-SWQVHLVLLPTKKQRAKTSIARGPCPIFTETFRFSHIESEMISNYAIRFRLYSVRRMKKEKILGEKVFYLTKLNLQGK------MSVP----VILDPCCSITGSESQASISDASCTDTASTFQSAAQGSAPEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPNTYVKLTLLNSMGQEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSL 604          
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Match: syt16 (synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313-210])

HSP 1 Score: 178.718 bits (452), Expect = 4.424e-49
Identity = 98/269 (36.43%), Postives = 160/269 (59.48%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKNKDF-------YVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S + S+Q+H ++LP K+ R+K+ +++G+ P F E F   ++ +    S  LRFRLY   + +   M+G+ +  LS ++          + EP   ++ + D      ++  S  S     H   PEL++GL++N+ +GRL+VEII+GS     +L++    +        Y KL+L +S GQE+S  KTS+R+   +PVFKE+F+FQVALFQ+ +VTLM++V  ++++ RKE++GW+ALG  SSGEEE  HW ++ E    +V   H L
Sbjct:  267 SGMDSWQVHVALLPGKRQRYKTAVQRGSAPRFGETFRFSRLEQAELGSSALRFRLYALGKMNRERMMGETIYRLSKLNTESGQMEATLVLEP-RSNLKAIDSQVSLSAQSDSASSSQSLSHGGVPELLLGLAYNATTGRLSVEIIKGSHFRNLALNRPPGNNNYNNNNNTYGKLTLLNSMGQEISRCKTSVRRGQPNPVFKETFVFQVALFQLSDVTLMVAVYNRRNMKRKEMIGWLALGQNSSGEEEALHWQDMKESGNQQVCRWHTL 534          
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Match: syt14a (synaptotagmin-14 [Source:NCBI gene;Acc:103044022])

HSP 1 Score: 176.407 bits (446), Expect = 4.178e-48
Identity = 114/315 (36.19%), Postives = 171/315 (54.29%), Query Frame = 3
Query:  651 VFDLFGTENRIDTKKTNV-----LSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT--------------STLNMIGQCLCDLSSIDLSVDTEYNLT----ISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS-----SLSKEKNKDF---------YVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            VFD    + R+    T V     L RT +V S+Q+H  +LP KK R K+ I +G  P+F E F    I  E  ++  +RFRLY  +               + LN+ G+      S+ + +D   ++T    IS+    D  ST Q +  GS                PE+++GL +N+ +GRL+VE+I+GS     + +K  +K F         YVKL+L +S GQE+S  KTSI +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+++ E    +V   H L
Sbjct:  260 VFDYDSCDQRLAVTVTAVTDIPPLKRTGNV-SWQVHLVLLPTKKQRAKTSIARGPCPIFTETFRFSHIESEMISNYAIRFRLYSVRRMKKEKILGEKVFYLTKLNLQGK-----MSVPVILDPCCSITSQASISDASCTDTASTFQSAAQGSA---------------PEILLGLVYNATTGRLSVEVIKGSHFKNLAANKPPSKYFHNFTTDSYTYVKLTLLNSMGQEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCRWHSL 553          
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Match: syt14b (synaptotagmin-14-like [Source:NCBI gene;Acc:103040669])

HSP 1 Score: 157.532 bits (397), Expect = 9.806e-41
Identity = 96/265 (36.23%), Postives = 154/265 (58.11%), Query Frame = 3
Query:  711 RTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSV--ISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVV-AKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +T+   S+Q+H  +LP KK R K+ +++G  P+F E F    + ++A     +RFRLY         ++G+ +  L+ ++L   T   +T+ EPG         +SV+    RSV  +S +  G    PEL++GL +NS++GRL  E+I+GS     + ++  + YVKL +  S G+E+S  KTS+ +   +P +KE+FMFQVALFQ+ EVTL + V   + S+ R+E VGWV+LG  S+ EE+  HW+++ E    +V   H L
Sbjct:  454 KTTGNISWQVHLVLLPTKKQRAKTGVQKGPCPVFTETFRFSPVEQDALREYAVRFRLYSVRHRKKEKVLGEKVFYLTKLNLQGKTALPVTL-EPGSAVPGCGSLVSVS----RSVGALSYHSTGESSTPELLLGLLYNSSTGRLAAEVIKGSHFKNSATDQPPNTYVKLVMLDSKGKEMSKCKTSVCRGQPNPTYKETFMFQVALFQLSEVTLQVMVYSRRSSMRRRERVGWVSLGLNSTTEEQEEHWAQMKEAEGRQVCQWHTL 713          
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Match: syt14b (synaptotagmin-14-like [Source:NCBI gene;Acc:103040669])

HSP 1 Score: 151.754 bits (382), Expect = 1.029e-38
Identity = 97/284 (34.15%), Postives = 152/284 (53.52%), Query Frame = 3
Query:  711 RTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSV--ISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN----------------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVV-AKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            +T+   S+Q+H  +LP KK R K+ +++G  P+F E F    + ++A     +RFRLY         ++G+ +  L+ ++L   T   +T+ EPG         +SV+    RSV  +S +  G    PEL++GL +NS++GRL  E+I+GS                             +D YVKL +  S G+E+S  KTS+ +   +P +KE+FMFQVALFQ+ EVTL + V   + S+ R+E VGWV+LG  S+ EE+  HW+++ E    +V   H L
Sbjct:  454 KTTGNISWQVHLVLLPTKKQRAKTGVQKGPCPVFTETFRFSPVEQDALREYAVRFRLYSVRHRKKEKVLGEKVFYLTKLNLQGKTALPVTL-EPGSAVPGCGSLVSVS----RSVGALSYHSTGESSTPELLLGLLYNSSTGRLAAEVIKGSHFKNSATDQPPSGLFCCIKRFIGGQLYIMRDTYVKLVMLDSKGKEMSKCKTSVCRGQPNPTYKETFMFQVALFQLSEVTLQVMVYSRRSSMRRRERVGWVSLGLNSTTEEQEEHWAQMKEAEGRQVCQWHTL 732          
BLAST of synaptotagmin-14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000226.1 (pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gene:ENSPMAG00000000205.1 transcript:ENSPMAT00000000226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 2.124e-14
Identity = 40/138 (28.99%), Postives = 77/138 (55.80%), Query Frame = 3
Query: 1089 ELMIGLSHNSNSGRLTVEIIRGSSLSKEK----NKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQ 1490
            E+++ L ++  + RLTV +++   L K      + D YVK++++S   +  +  KT ++K T++PVF ESF+F++    + ++ + ++VV      + EV+G +ALG    G E   HW E+ E  + ++   H L +
Sbjct:    7 EILVSLCYHPAASRLTVVVLKARHLPKTDIVGLSVDPYVKVNIYSGK-RRFAKKKTHVKKCTLNPVFNESFVFELPEEGLSDLAVELTVVDFDRTTKDEVIGRLALG---PGTE---HWREVCENPRRQIAKWHPLSE 137          
BLAST of synaptotagmin-14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 9.587e-10
Identity = 36/140 (25.71%), Postives = 72/140 (51.43%), Query Frame = 3
Query: 1074 HDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
             DR  ++   L +  ++G+LT+ I+  ++L         D YVK+ +    G  L   KT+++K  ++P F E+F F +    ++++ L+ SV+   S+ R + +G V +G  ++G     HWS+++   +  +   H L
Sbjct:    7 QDRLGDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEG-GIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAGAGH-RHWSDMLANPRRPITQWHTL 144          
BLAST of synaptotagmin-14 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005109.1 (pep scaffold:Pmarinus_7.0:GL487076:302:1441:-1 gene:ENSPMAG00000004645.1 transcript:ENSPMAT00000005109.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.596e-7
Identity = 25/77 (32.47%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQT-STLNMIGQCLCDLSSI 944
            S   ++Q+H  +LP K+ RFK+ ++ G  P+F E F    +     ++  LRFRLY  ++ +   M+G+ L  LS +
Sbjct:   68 SGANTWQVHLVLLPTKRQRFKTSVQNGETPVFQESFRFSALEPGELSTYALRFRLYAVRSMNRERMMGEKLLYLSKL 144          
BLAST of synaptotagmin-14 vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 50.447 bits (119), Expect = 3.091e-7
Identity = 35/139 (25.18%), Postives = 70/139 (50.36%), Query Frame = 3
Query: 1089 ELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNH----WSEIMEGAKSEVMHSHRL 1484
            +L   + ++  + +LTV +I+ +   +L      D YVKL L     ++    +T + + T++PVF ESF+F+V   ++   TL+++V       + +++G V +   +    +L H    W +++   K EV  + RL
Sbjct:   99 KLQFSIDYDFQNNQLTVGVIQAAELPALDMGGTSDPYVKLFLMPDKKKKY---ETKVHRKTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEVKVPMNTI---DLGHVIEEWRDLVSAEKEEVSRARRL 231          
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Match: EDO41224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4W3])

HSP 1 Score: 157.532 bits (397), Expect = 9.389e-44
Identity = 92/263 (34.98%), Postives = 150/263 (57.03%), Query Frame = 3
Query:  729 SYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQ-TSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTD---QISVTGSEIRSVISENIEG----HDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S Q+   +LP KK RFK+K +   +P F+E F   +I +    ++ LR RLYG +      ++G+   +L+  +L  +         PG + + S+D    +S TGS        +           PEL++ L + S +GRLTVE+++ S+L   + ++  D YVK+S+F+S GQ+LS +KTSIR++   P F E+F+FQ+  F++  V+LM SVV  K + RKE++GW ++G  ++GE+E +HW E++EG    V   H L
Sbjct:   45 SVQVRIVILPTKKQRFKTKAKPATNPNFHETFTFTRITQNELRNLCLRVRLYGHERIGKDKLLGESKIELTEFELDGEGTPLWRTLTPG-NAIGSSDSMYDLSDTGSVHSFGSYGSSSSLAMVQSGAPELLVSLCYQSLTGRLTVEVLKASNLRNVAMQRAPDTYVKVSMFNSIGQQLSKSKTSIRRSMYDPEFNETFVFQIIEFELPSVSLMFSVVNIKKMRRKEIMGWFSMGRDNTGEDEESHWKEMIEGKGKAVKRWHVL 306          
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Match: EDO47875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL62])

HSP 1 Score: 104.375 bits (259), Expect = 5.219e-25
Identity = 74/259 (28.57%), Postives = 138/259 (53.28%), Query Frame = 3
Query:  735 QIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY--GSQTSTLNMIGQCLCDLSSIDLSVD-TEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVA-KKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQ 1490
            ++   +LP K+  F++K ++  DP+   ++  PK   +    ++LRFRLY  GS  +  +++G+ +  L +++L  +     + +  PG    +          E    ISE     DR PE++I L +   +G+L +E+I+  +L   +  K K+ YV + L  SNG+ +S  +T+ R++ I P + E F+F V   ++  VT++I++ +  K++ RK  VG +ALG   S EEE  HW E+    +  ++  HR+++
Sbjct:   27 EVSVMLLPGKRQSFRAKPKEFNDPV--AIYLYPK---DKVKDMSLRFRLYEHGSMGAR-HLLGEGVLRLRNVNLDNEMVPVAVDLQPPG--SYVPEGASGAIMYEGELAISEE----DR-PEILISLEYRRLTGKLLLEVIKTRNLGMLTDSKAKEMYVSVKLIGSNGELISKGRTTPRRHMIDPEYNEMFLFHVPEQELNSVTVLIALTSVSKTLGRKLKVGQLALGQNYSSEEEYRHWFEMTRSKEKSIVRWHRINE 272          
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 87.8113 bits (216), Expect = 2.541e-19
Identity = 67/257 (26.07%), Postives = 125/257 (48.64%), Query Frame = 3
Query:  738 IHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLN-MIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNP--ELMIGLSHNSNSGRLTVEIIRGSSLSKEK---NKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLH 1487
            +   +LP KK + ++++ R+  +P++NEVF             TL  ++      + N  IG+    L +IDL   T   LT ++    D++   +                   DR P  +L++ L +   + R+ V +++ + L       + D YVK+ +   + + L   KT+I++ T  PV+ ESF+F V L +++++T + +V+    I + E++G V LGY+++G   L HW+E+M   +  V   HRL 
Sbjct:   42 VKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVT---LTFTK----DLLPCKK-------------------DRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKD-RRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTG-SSLRHWTEMMNNPRKPVAQWHRLQ 270          
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Match: EDO28994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4W7])

HSP 1 Score: 71.633 bits (174), Expect = 2.240e-15
Identity = 36/102 (35.29%), Postives = 62/102 (60.78%), Query Frame = 3
Query: 1182 DFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLH 1487
            D YVK+ +   + + L   KT+I++ T  PV+ ESF+F V L +++++T + +V+    I + E++G V LGY+++G   L HW+E+M   +  V   HRL 
Sbjct:    3 DPYVKMYIMHKD-RRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRTTG-SSLRHWTEMMNNPRKPVAQWHRLQ 102          
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Match: EDO47876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL63])

HSP 1 Score: 72.7886 bits (177), Expect = 2.364e-15
Identity = 43/138 (31.16%), Postives = 77/138 (55.80%), Query Frame = 3
Query: 1086 PELMIGLSHNSNSGRLTVEIIRGSSL---SKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRK-EVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLH 1487
            PE+++ L +   + +L  E+++  +L   ++ K  D YV L+L   + + L   +TS++++ I     E FMF++   +MKEVTL+ SVV    + +K EV+G  A G  +SG+++  HW  ++   K E    +R H
Sbjct:    8 PEILLSLEYRGLTRKLVAEVVKTRNLGLWTESKPCDLYVDLTLKDKDRRVLRVCRTSVKRHVIDIENNEMFMFRLNNERMKEVTLIFSVVRVSDVRKKEEVLGSCAFGRDTSGQQQAEHWDNML---KDEARVEYRWH 142          
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Match: syt14a (synaptotagmin 14 [Source:NCBI gene;Acc:101155984])

HSP 1 Score: 182.956 bits (463), Expect = 1.580e-50
Identity = 124/386 (32.12%), Postives = 204/386 (52.85%), Query Frame = 3
Query:  384 AEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDIL-DTWEETTLEEVSKSGS--IIRKG------NKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDL----SVDTEYNLTISEPGEDDVISTDQISVT--GSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRG---SSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            A+ D  +S   S  +        G E   T + +     +DI  D+    + E++S  GS  ++ KG       K   + +    DS   +L + I+ V DL              + RT+++ S+Q+H  +LP KK R K+ +++G  P+F E F    +  E  ++  +RFRLY   +     + G+ +  L+ ++L    SV    +     PG +  +S   ++ +   S  +SV           PE+++GL +N+ +GRL+VEII+G    +L+  K  + YVKL+L +S G E+S  KTSI +   +P +KE+F+FQVALFQ+ +VTL++SV  K+S+ RKE++GW++LG  SSGEEEL HW+++ E    +V H H L
Sbjct:  172 AKCDMSQSGSGSPHLSFGKYPSDGSEGHETESYLNKGYEEDIPSDSTAVLSPEDMSARGSAALLLKGYEPDPVAKFGTLDIVFDYDSEEQQLAVTIMAVTDL------------PTVKRTANI-SWQVHLVLLPTKKQRAKTGVQRGPCPIFTETFRFSHVESEMISNYAIRFRLYSMRRMKKEKVFGEKVFYLTKLNLQGKMSVPVILDPCCPIPGGESQVSLSDMTCSESASSFQSV------SQASTPEILVGLVYNATTGRLSVEIIKGIHFKNLAANKPPNTYVKLTLLNSMGHEMSKCKTSICRGQPNPTYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWISLGLNSSGEEELTHWTQMKESKGQQVCHWHSL 538          
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Match: ENSORLT00000022607.2 (synaptotagmin 16 [Source:NCBI gene;Acc:101173827])

HSP 1 Score: 179.874 bits (455), Expect = 2.640e-49
Identity = 97/262 (37.02%), Postives = 156/262 (59.54%), Query Frame = 3
Query:  717 SSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLY--GSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVIS-ENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGS---SLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S + S+Q+H  +LP KK R K+ +++G  P FNE      +     ++  +RFRLY  G +     M+G+ +  L  +D    T     + EP  +      Q+S++ +    + S      H   PEL++GLS+N+ +GR++VE+IRGS   +L+  +  D Y +L+L +S GQE++  KTS+R+   +PV+KE+F+FQVALFQ+ +VTL++S+  ++S+ RKE+VGW+ALG  SSG+EE  HW  + E    +V   H L
Sbjct:  295 SGLDSWQVHMLLLPTKKQRHKTSVQKGPCPHFNETLRFSHVEPTDLHTSAVRFRLYALGGRMFRERMVGEKVLCLGGLDPQGGTTETTVVLEPRSNLKHVGSQLSLSAASQSDIASFTQSLTHGGVPELLLGLSYNATTGRMSVELIRGSLFRNLAVSRPPDTYGRLTLLNSVGQEIARCKTSVRRGQPNPVYKETFVFQVALFQLSDVTLLVSINTRRSMKRKEMVGWIALGQNSSGKEEQLHWQVMKESRGQQVCRWHVL 556          
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Match: syt14b (synaptotagmin-14 [Source:NCBI gene;Acc:101173829])

HSP 1 Score: 157.918 bits (398), Expect = 1.085e-41
Identity = 91/277 (32.85%), Postives = 154/277 (55.60%), Query Frame = 3
Query:  729 SYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEG-HDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN----------------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHR-KEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
            S+Q+H  +LP KK R K+ +++G  P+F E F   ++ +EA     +RFRLY   +     ++G+ +  L+ ++L       +T+ EPG +       +SV+    RS  + +     D  PE+++GL +NS +GRL+ E+I+G+      +                      +D YVKL++  S G+E+S  KT+  +   +P +KE+F+FQVALFQ+ EV+L++SV  ++S  R +E +GWV+LG  S+ EE+L HW+E+ E    ++ H H L
Sbjct:  248 SWQVHLVLLPTKKQRAKTGVQKGPCPVFTETFKFSRVEQEALGDCAVRFRLYSIRRMKKEKVLGEKVFYLTKLNLQGKIALPVTL-EPGSELPGCGSLVSVS----RSAGALSYRSTEDSLPEILLGLIYNSATGRLSAEVIQGNHFKTAASDKPISDLFCCVKHFVGGQLYIMRDTYVKLTMLDSKGKEMSKCKTATCRGHPNPTYKETFVFQVALFQLSEVSLVVSVFCRRSSMRPRERLGWVSLGLNSTSEEQLVHWTEMREAEGQQICHWHTL 519          
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Match: syt14b (synaptotagmin-14 [Source:NCBI gene;Acc:101173829])

HSP 1 Score: 157.147 bits (396), Expect = 1.470e-40
Identity = 94/289 (32.53%), Postives = 158/289 (54.67%), Query Frame = 3
Query:  702 VLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGS----EIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKN----------------------KDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHR-KEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRL 1484
             L +T ++ S+Q+H  +LP KK R K+ +++G  P+F E F   ++ +EA     +RFRLY   +     ++G+ +  L+ ++L       +T+ EPG +       +SV+ S      RS         D  PE+++GL +NS +GRL+ E+I+G+      +                      +D YVKL++  S G+E+S  KT+  +   +P +KE+F+FQVALFQ+ EV+L++SV  ++S  R +E +GWV+LG  S+ EE+L HW+E+ E    ++ H H L
Sbjct:  452 ALKQTGNI-SWQVHLVLLPTKKQRAKTGVQKGPCPVFTETFKFSRVEQEALGDCAVRFRLYSIRRMKKEKVLGEKVFYLTKLNLQGKIALPVTL-EPGSELPGCGSLVSVSRSAGALSYRST-------EDSLPEILLGLIYNSATGRLSAEVIQGNHFKTAASDKPISDLFCCVKHFVGGQLYIMRDTYVKLTMLDSKGKEMSKCKTATCRGHPNPTYKETFVFQVALFQLSEVSLVVSVFCRRSSMRPRERLGWVSLGLNSTSEEQLVHWTEMREAEGQQICHWHTL 731          
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Match: syt9b (synaptotagmin-9 [Source:NCBI gene;Acc:101171486])

HSP 1 Score: 89.7373 bits (221), Expect = 1.379e-18
Identity = 78/276 (28.26%), Postives = 138/276 (50.00%), Query Frame = 3
Query:  705 LSRTSSVYSYQIHCSVLPVKKFRFKSKI-RQGADPMFNEVFYVPKINEEAANSITLRFRLYG-SQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSK---EKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEEL--NHWSEIMEGAKSEVMHSHRLHQNSSSKKF 1511
             S TS  Y   +   +LP +K + ++K+ R+  +P+F+EVF  P    E + S  L F +Y   + S  ++IGQ + D + +DL            P E  +           +I+ V S+N++      ELM  L +   +GRLT+ +I+  +L         D YVK+SL    G+ L   KTS ++NT++PV+ E+ +F V    + +++L+I+V+    +   EV+G   +G   S  E L  +HW+E++   +  + H H L + ++ + F
Sbjct:  265 FSGTSDPY---VKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVAYAELS-SRKLHFSVYDFDRFSRHDLIGQVVVD-NFLDLP---------DFPRETKLCR---------DIQYVTSDNVDLG----ELMFSLCYLPTAGRLTITMIKARNLKAMDITGASDPYVKVSLMC-EGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGVCRVG---SEAESLGRDHWNEMLSYPRKPIAHWHPLIELTTEETF 509          
BLAST of synaptotagmin-14 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 3
Query:   99 MNFVNGNVLNLPISTGIFDNLKSIKTILSRKINGIINKEPTVDVVAQLPINEDVQSVLSEDLYITTQISEPFQXXXXXXXXXXXIFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 1517
            MNFVNGNVLNLPISTGIFDNLKSIKTILSRKINGIINKEPTVDVVAQLPINEDVQSVLSEDLYITTQISEPFQEYSESDDSDEDIFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ
Sbjct:    1 MNFVNGNVLNLPISTGIFDNLKSIKTILSRKINGIINKEPTVDVVAQLPINEDVQSVLSEDLYITTQISEPFQEYSESDDSDEDIFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 473          
BLAST of synaptotagmin-14 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 389/389 (100.00%), Postives = 389/389 (100.00%), Query Frame = 3
Query:  351 IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 1517
            IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ
Sbjct:   70 IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 458          
BLAST of synaptotagmin-14 vs. Planmine SMEST
Match: SMESG000051011.1 (SMESG000051011.1)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 389/389 (100.00%), Postives = 389/389 (100.00%), Query Frame = 3
Query:  351 IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 1517
            IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ
Sbjct:   39 IFNNYACIENTAEFDKIRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVSKSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKTNVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEIIRGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFLQ 427          
BLAST of synaptotagmin-14 vs. Planmine SMEST
Match: SMESG000024484.1 (SMESG000024484.1)

HSP 1 Score: 144.821 bits (364), Expect = 1.270e-37
Identity = 86/280 (30.71%), Postives = 150/280 (53.57%), Query Frame = 3
Query:  762 KKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLN-MIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIE-GHDRN---------------------PELMIGLSHNSNSGRLTVEIIRGSS----LSKEKNK--DFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFL 1514
            K FR+ SK          E    P+++ +  ++  +R RLYG +    + ++ + +  L ++DL    +Y L + +                +E++ +  +NIE G D N                      E+++GL++N  +GRLTVEI++G++    LS+  +K  + +VK++L + N QE++ +KT +R+N  +P+FKE FMFQV  FQ+ E+T++  V  +KS HRKE++GW ++G  +S  EEL+HW  + +    EV   H L QN+ S++ L
Sbjct:  190 KLFRWNSKQFASNSFRIPETMEFPEMSAKDISTTAVRIRLYGCERKRRDILLSETIIGLGNVDLKKQEQYRLKMEK---------------RAELKHLDKKNIEMGDDENNFAKEMSKKATIQVEETIGVEAEMLLGLAYNPITGRLTVEIVKGNAFKNPLSRNDDKLPNSFVKVTLSAENNQEITRSKTELRRNQANPLFKEKFMFQVPQFQLNEITIIFGVYHRKSAHRKEIIGWFSIGLNNSSPEELSHWKNMQQSNGEEVFQWHELLQNTKSRQGL 454          
BLAST of synaptotagmin-14 vs. Planmine SMEST
Match: SMESG000024484.1 (SMESG000024484.1)

HSP 1 Score: 144.436 bits (363), Expect = 1.430e-37
Identity = 86/280 (30.71%), Postives = 150/280 (53.57%), Query Frame = 3
Query:  762 KKFRFKSKIRQGADPMFNEVFYVPKINEEAANSITLRFRLYGSQTSTLN-MIGQCLCDLSSIDLSVDTEYNLTISEPGEDDVISTDQISVTGSEIRSVISENIE-GHDRN---------------------PELMIGLSHNSNSGRLTVEIIRGSS----LSKEKNK--DFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQVALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIMEGAKSEVMHSHRLHQNSSSKKFL 1514
            K FR+ SK          E    P+++ +  ++  +R RLYG +    + ++ + +  L ++DL    +Y L + +                +E++ +  +NIE G D N                      E+++GL++N  +GRLTVEI++G++    LS+  +K  + +VK++L + N QE++ +KT +R+N  +P+FKE FMFQV  FQ+ E+T++  V  +KS HRKE++GW ++G  +S  EEL+HW  + +    EV   H L QN+ S++ L
Sbjct:  162 KLFRWNSKQFASNSFRIPETMEFPEMSAKDISTTAVRIRLYGCERKRRDILLSETIIGLGNVDLKKQEQYRLKMEKR---------------AELKHLDKKNIEMGDDENNFAKEMSKKATIQVEETIGVEAEMLLGLAYNPITGRLTVEIVKGNAFKNPLSRNDDKLPNSFVKVTLSAENNQEITRSKTELRRNQANPLFKEKFMFQVPQFQLNEITIIFGVYHRKSAHRKEIIGWFSIGLNNSSPEELSHWKNMQQSNGEEVFQWHELLQNTKSRQGL 426          
The following BLAST results are available for this feature:
BLAST of synaptotagmin-14 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT141.761e-5336.62synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT141.761e-5336.62synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT143.476e-5336.62synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT162.314e-5039.23synaptotagmin 16 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
SYT144.102e-5034.83synaptotagmin 14 [Source:HGNC Symbol;Acc:HGNC:2314... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-15.206e-1727.63Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-45.702e-1622.83SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:P91493... [more]
snt-12.974e-1527.72Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-22.592e-1424.64Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-69.755e-1432.24SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt141.748e-5342.23gene:FBgn0261086 transcript:FBtr0336485[more]
Syt141.748e-5342.23gene:FBgn0261086 transcript:FBtr0078957[more]
Syt145.381e-5342.23gene:FBgn0261086 transcript:FBtr0339551[more]
Syt49.452e-2226.91gene:FBgn0028400 transcript:FBtr0081578[more]
Syt19.691e-1927.90gene:FBgn0004242 transcript:FBtr0343993[more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a1.334e-5238.49synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14a5.089e-5036.45synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14a1.497e-4935.74synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14a1.543e-4935.74synaptotagmin XIVa [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
syt14b1.854e-4637.35synaptotagmin XIVb [Source:ZFIN;Acc:ZDB-GENE-04101... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT147.780e-5437.34synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT148.346e-5437.34synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT141.326e-5337.34synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
SYT149.701e-5237.34synaptotagmin 14 [Source:NCBI gene;Acc:100491102][more]
tjp11.566e-3149.57tight junction protein 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt143.483e-5035.39synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt141.436e-4835.39synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt143.088e-4733.64synaptotagmin XIV [Source:MGI Symbol;Acc:MGI:24444... [more]
Syt163.955e-4541.06synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:26738... [more]
Syt161.071e-4441.06synaptotagmin XVI [Source:MGI Symbol;Acc:MGI:26738... [more]
back to top
BLAST of synaptotagmin-14 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NB59|SYT14_HUMAN1.669e-5236.62Synaptotagmin-14 OS=Homo sapiens OX=9606 GN=SYT14 ... [more]
sp|Q17RD7|SYT16_HUMAN1.111e-4939.23Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 ... [more]
sp|Q7TN84|SYT14_MOUSE2.436e-4935.39Synaptotagmin-14 OS=Mus musculus OX=10090 GN=Syt14... [more]
sp|Q7TN83|SYT16_MOUSE7.490e-4441.06Synaptotagmin-16 OS=Mus musculus OX=10090 GN=Syt16... [more]
sp|Q58G82|SY14L_HUMAN1.667e-3047.69Putative synaptotagmin-14-like protein OS=Homo sap... [more]
back to top
BLAST of synaptotagmin-14 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1J0L61.294e-5738.66Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A2P8XRQ62.239e-5737.42Synaptotagmin-16 OS=Blattella germanica OX=6973 GN... [more]
A0A067QZG21.288e-5636.77Synaptotagmin-16 OS=Zootermopsis nevadensis OX=136... [more]
A0A2P6KHH91.322e-5639.02Syt14 OS=Nephila clavipes OX=2585209 GN=NCL1_39917... [more]
A0A4Y2DXR84.328e-5638.73Synaptotagmin-16 OS=Araneus ventricosus OX=182803 ... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a3.880e-5138.05synaptotagmin-14 [Source:NCBI gene;Acc:103044022][more]
syt164.424e-4936.43synaptotagmin XVI [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
syt14a4.178e-4836.19synaptotagmin-14 [Source:NCBI gene;Acc:103044022][more]
syt14b9.806e-4136.23synaptotagmin-14-like [Source:NCBI gene;Acc:103040... [more]
syt14b1.029e-3834.15synaptotagmin-14-like [Source:NCBI gene;Acc:103040... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000226.12.124e-1428.99pep scaffold:Pmarinus_7.0:GL478944:1404:4221:1 gen... [more]
ENSPMAT00000006908.19.587e-1025.71pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
ENSPMAT00000005109.11.596e-732.47pep scaffold:Pmarinus_7.0:GL487076:302:1441:-1 gen... [more]
syt2a3.091e-725.18synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of synaptotagmin-14 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412249.389e-4434.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478755.219e-2528.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.541e-1926.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289942.240e-1535.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478762.364e-1531.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of synaptotagmin-14 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt14a1.580e-5032.12synaptotagmin 14 [Source:NCBI gene;Acc:101155984][more]
ENSORLT00000022607.22.640e-4937.02synaptotagmin 16 [Source:NCBI gene;Acc:101173827][more]
syt14b1.085e-4132.85synaptotagmin-14 [Source:NCBI gene;Acc:101173829][more]
syt14b1.470e-4032.53synaptotagmin-14 [Source:NCBI gene;Acc:101173829][more]
syt9b1.379e-1828.26synaptotagmin-9 [Source:NCBI gene;Acc:101171486][more]
back to top
BLAST of synaptotagmin-14 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051011.10.000e+0100.00SMESG000051011.1[more]
SMESG000051011.10.000e+0100.00SMESG000051011.1[more]
SMESG000051011.10.000e+0100.00SMESG000051011.1[more]
SMESG000024484.11.270e-3730.71SMESG000024484.1[more]
SMESG000024484.11.430e-3730.71SMESG000024484.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034767 ID=SMED30034767|Name=synaptotagmin-14|organism=Schmidtea mediterranea sexual|type=transcript|length=1659bp
CTTAAAAGTCATAAAATAAATTATTGCAACAATTATATATTTCAACGGAA
GTCTGATAATTACCGTTTTGTTAAACAAATCCCAATTTTCATTATTAAAT
GAATTTCGTAAATGGAAACGTTTTAAATCTTCCCATATCAACTGGAATTT
TCGATAATTTGAAATCGATTAAAACAATCCTAAGTAGAAAAATCAATGGA
ATAATCAATAAAGAACCAACCGTAGATGTCGTTGCACAATTACCGATCAA
TGAAGATGTGCAATCTGTGCTATCGGAGGATTTATATATAACAACACAAA
TTTCAGAACCGTTTCAGGAGTATTCAGAGAGTGATGATAGTGATGAAGAC
ATTTTTAACAACTACGCCTGTATCGAAAATACAGCTGAATTTGATAAAAT
ACGATCCAGTATGAGATCTACGAAAATGGAGATCAGCGATCCTAATAAAG
TGGGAATGGAAAAAGATAGTACCAGAGCCAGTATACGATCCGTGACAAAT
AAAGATATATTGGACACCTGGGAAGAGACAACCCTAGAAGAGGTTTCAAA
GAGCGGAAGCATCATTCGAAAAGGGAATAAAATGGCAATTGTAAGAGTTC
ATTTATTTTTGGACAGTTTAAGTTCAAAATTAAAAATTCAAATACTGCAA
GTTTTTGATTTGTTTGGAACTGAAAATCGTATAGATACGAAAAAGACGAA
CGTTTTGAGCAGAACTTCGTCGGTCTATTCGTACCAGATTCATTGTTCTG
TGTTGCCAGTCAAGAAATTTAGGTTCAAATCTAAAATTAGACAAGGAGCT
GACCCAATGTTTAATGAAGTGTTTTACGTTCCAAAAATCAATGAAGAGGC
TGCTAACTCTATTACACTAAGATTTCGTTTGTACGGCAGTCAGACCTCAA
CTCTGAATATGATTGGACAATGTTTGTGCGACCTCAGTTCCATTGATTTG
TCTGTGGATACGGAATACAATTTAACAATTAGTGAGCCAGGAGAAGATGA
TGTAATAAGTACAGATCAAATCTCAGTTACTGGTTCAGAGATACGAAGTG
TTATTTCAGAAAACATCGAAGGTCATGACAGAAATCCTGAACTAATGATA
GGACTTTCTCACAATTCCAATAGCGGAAGACTAACTGTAGAAATCATCAG
AGGAAGCAGTCTTTCTAAAGAAAAAAATAAAGATTTTTATGTGAAGTTAT
CTTTGTTCTCTTCCAATGGTCAAGAGCTGTCACATACCAAAACATCGATA
AGAAAAAATACTATTTCTCCTGTATTTAAAGAATCTTTCATGTTTCAAGT
TGCTCTTTTTCAAATGAAAGAAGTAACACTGATGATATCAGTAGTTGCGA
AGAAATCAATTCATAGAAAAGAGGTTGTGGGGTGGGTTGCCTTAGGCTAT
AAATCAAGCGGCGAGGAGGAACTAAATCACTGGAGTGAGATCATGGAAGG
GGCAAAAAGTGAAGTTATGCACAGCCACAGACTTCATCAGAATAGCAGTT
CTAAAAAATTTTTACAGTAACATTTTATAATATTTGATCAGACAATTATG
TGAGACTTTATGAGACTGATCTTTATTATTTGGACGACGAAATTTTGTTT
TGTTTTTTATTTATTTGTGAGATATAAACTAGATTTTATAGGAAAATAAA
TTAAGTAGC
back to top

protein sequence of SMED30034767-orf-1

>SMED30034767-orf-1 ID=SMED30034767-orf-1|Name=SMED30034767-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MNFVNGNVLNLPISTGIFDNLKSIKTILSRKINGIINKEPTVDVVAQLPI
NEDVQSVLSEDLYITTQISEPFQEYSESDDSDEDIFNNYACIENTAEFDK
IRSSMRSTKMEISDPNKVGMEKDSTRASIRSVTNKDILDTWEETTLEEVS
KSGSIIRKGNKMAIVRVHLFLDSLSSKLKIQILQVFDLFGTENRIDTKKT
NVLSRTSSVYSYQIHCSVLPVKKFRFKSKIRQGADPMFNEVFYVPKINEE
AANSITLRFRLYGSQTSTLNMIGQCLCDLSSIDLSVDTEYNLTISEPGED
DVISTDQISVTGSEIRSVISENIEGHDRNPELMIGLSHNSNSGRLTVEII
RGSSLSKEKNKDFYVKLSLFSSNGQELSHTKTSIRKNTISPVFKESFMFQ
VALFQMKEVTLMISVVAKKSIHRKEVVGWVALGYKSSGEEELNHWSEIME
GAKSEVMHSHRLHQNSSSKKFLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 344..457
e-value: 3.9E-12
score: 56.3
coord: 177..291
e-value: 0.0081
score: 25.4
IPR000008C2 domainPFAMPF00168C2coord: 343..446
e-value: 1.4E-11
score: 44.6
coord: 216..285
e-value: 6.7E-4
score: 19.9
IPR000008C2 domainPROSITEPS50004C2coord: 342..431
score: 11.655
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 317..464
e-value: 4.6E-27
score: 96.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 155..296
e-value: 8.3E-8
score: 33.9
NoneNo IPR availablePANTHERPTHR46129FAMILY NOT NAMEDcoord: 74..463
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 167..296
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 323..450