SMED30034756

Overview
NameSMED30034756
Smed IDSMED30034756
Length (bp)1567
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034756 (SMED30034756) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034756 (SMED30034756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034756 (SMED30034756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034756 (SMED30034756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034756h1SMcG0004211 SmedASXL_014780SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034756h1SMcG0004211 SmedASXL_014780SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034756 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000023:102852..107836 +7656
Homology
BLAST of SMED30034756 vs. Ensembl Human
Match: MPHOSPH8 (M-phase phosphoprotein 8 [Source:HGNC Symbol;Acc:HGNC:29810])

HSP 1 Score: 53.9138 bits (128), Expect = 6.796e-7
Identity = 69/310 (22.26%), Postives = 138/310 (44.52%), Query Frame = 1
Query:  643 NINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            N      +P N  +L+D ++ GD   ++  + S++  +L+   S+   L +LAA      ++  L++ G  +N +  +  TAL+ A E    + + +L+  GA +N   SN ++ L   C++     +++++  GAD    S+ ++ +L     +AK      +  + + HL  LS   +  I      +L L   + P++ I+   + +    + D N K   +N P      LFI     +G E+         +++V LND  Q  +      + +F  +   NKL ++       K ++++ AY V
Sbjct:  558 NFAATDAIPSN--VLRDAVKNGDYITVKVALNSNEEYNLDQEDSSGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSAL----HFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLAL---LEPVFPIACHRLCEGPDFSTDFNYK-PPQNIPEGSGILLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPSAKVKLLIGAYRV 857          
BLAST of SMED30034756 vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 51.9878 bits (123), Expect = 2.653e-6
Identity = 33/117 (28.21%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  700 EKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGA 1050
            E+G+L++++  + +    +LE+L  N+  L I A+K   + IV  LL  GVN+  +D    TALM+AC      +++LL+++GA+ +     +   + +   +     + +LL  GA
Sbjct:   47 EQGNLEIVKELIKNGANCNLEDL-DNWTAL-ISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGA 161          
BLAST of SMED30034756 vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 50.8322 bits (120), Expect = 5.879e-6
Identity = 33/117 (28.21%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  700 EKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGA 1050
            E+G+L++++  + +    +LE+L  N+  L I A+K   + IV  LL  GVN+  +D    TALM+AC      +++LL+++GA+ +     +   + +   +     + +LL  GA
Sbjct:   47 EQGNLEIVKELIKNGANCNLEDL-DNWTAL-ISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGA 161          
BLAST of SMED30034756 vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 50.8322 bits (120), Expect = 6.040e-6
Identity = 33/117 (28.21%), Postives = 63/117 (53.85%), Query Frame = 1
Query:  700 EKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGA 1050
            E+G+L++++  + +    +LE+L  N+  L I A+K   + IV  LL  GVN+  +D    TALM+AC      +++LL+++GA+ +     +   + +   +     + +LL  GA
Sbjct:   47 EQGNLEIVKELIKNGANCNLEDL-DNWTAL-ISASKEGHVHIVEELLKCGVNLEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLLLQNGA 161          
BLAST of SMED30034756 vs. Ensembl Xenopus
Match: MPHOSPH8 (M-phase phosphoprotein 8 [Source:NCBI gene;Acc:100145122])

HSP 1 Score: 51.6026 bits (122), Expect = 3.433e-6
Identity = 65/286 (22.73%), Postives = 122/286 (42.66%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRK 1521
            LKD ++ GD   ++  + S +  +LE   S+   L +LAA      ++  L+  G  IN++  +  TAL+ A E    + + LL+  GA +N   ++ ++ L   C++     +++LL  G D    S+ + ++L    ++A       +  + + HL  LS  +++ I      +L L   + P+      E  D   L+F   +      TP      LF+      G E+         +++V LND  Q  +      I +F  +   NKL ++   +   K
Sbjct:  553 LKDAVKNGDYVTVKYALNSKEEYNLEQEDSSGMTLVMLAAAAGQDDVLRLLIKKGAKINARQKNGTTALIHAAEKNYLTTVALLLEAGAYVNVQQASGETALMKACKRGNSDIVRLLLEYGVDCNVLSKHQGNAL----QFAMQSNNVHLYEMIKSHLETLSRVVEDAIKDYFDTRLSLLEPVFPLACHRLCEGPD-FSLDFSYKAPF---TTPEGSGILLFVFHANYFGKEVVVRLCGPCSVQAVVLNDKFQLPVFLDAHFIYSFSPVAGLNKLFIRLTEVPAAK 830          
BLAST of SMED30034756 vs. Ensembl Xenopus
Match: FANK1 (fibronectin type III and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100495570])

HSP 1 Score: 49.2914 bits (116), Expect = 9.569e-6
Identity = 24/58 (41.38%), Postives = 36/58 (62.07%), Query Frame = 1
Query:  778 YPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGA 951
            +  L  +AA + ++ I   L++ G  +N+KDT+ KT LM A  N  ESL+ LL+ NGA
Sbjct:  246 WTPLMRIAAVSGNVDIARCLIAAGAGVNAKDTNGKTPLMVAVLNNHESLVHLLLENGA 303          
BLAST of SMED30034756 vs. Ensembl Xenopus
Match: FANK1 (fibronectin type III and ankyrin repeat domains 1 [Source:NCBI gene;Acc:100495570])

HSP 1 Score: 49.2914 bits (116), Expect = 9.765e-6
Identity = 24/58 (41.38%), Postives = 36/58 (62.07%), Query Frame = 1
Query:  778 YPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGA 951
            +  L  +AA + ++ I   L++ G  +N+KDT+ KT LM A  N  ESL+ LL+ NGA
Sbjct:  242 WTPLMRIAAVSGNVDIARCLIAAGAGVNAKDTNGKTPLMVAVLNNHESLVHLLLENGA 299          
BLAST of SMED30034756 vs. Ensembl Mouse
Match: Mphosph8 (M-phase phosphoprotein 8 [Source:MGI Symbol;Acc:MGI:1922589])

HSP 1 Score: 53.5286 bits (127), Expect = 5.305e-7
Identity = 67/303 (22.11%), Postives = 136/303 (44.88%), Query Frame = 1
Query:  664 LPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            +P NL  L+D ++ GD   ++  + S++  +L+   S    L +LAA      ++  L++ G  +N +  +  TAL+ A E    + + +L+  GA +N   SN ++ L   C++     +++++  GAD    S+ ++ +L     +AK      +  + + HL  LS   +  I      +L L   + P++ I+   + +    + D N  +  +N P      LFI     +G ++         +++V LND  Q  +      + +F  +   NKL ++       K ++++ AY V
Sbjct:  563 IPNNL--LRDAVKNGDYIAVKVALNSNEEYNLDQEDSTGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALY----FAKQCNNVLVYELLKSHLETLSRVAEETIRDYFESRLAL---LEPVFPIACHRLCEGPDFSTDFNY-MPPQNMPEGSGVLLFIFHANFLGKDVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPFAKVKLLIGAYRV 855          
BLAST of SMED30034756 vs. UniProt/SwissProt
Match: sp|G3V8T1|MPP8_RAT (M-phase phosphoprotein 8 OS=Rattus norvegicus OX=10116 GN=Mphosph8 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.010e-6
Identity = 67/303 (22.11%), Postives = 136/303 (44.88%), Query Frame = 1
Query:  664 LPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            +P NL  L+D ++ GD   ++  + S++  +L+   S    L +LAA      ++  L++ G  +N +  +  TAL+ A E    + + +L+  GA +N   SN ++ L   C++     +++++  GAD    S+ ++ +L     +AK      +  + + HL  LS   +  I      +L L   + P++ I+   + +    + D N  +  +N P      LFI     +G ++         +++V LND  Q  +      + +F  +   NKL ++       K ++++ AY V
Sbjct:  556 IPSNL--LRDAVKNGDYIAVKVALNSNEEYNLDQEDSTGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALY----FAKQCNNVLVYELLKSHLETLSRVAEETIRDYFESRLAL---LEPVFPIACHRLCEGPDFSTDFNY-MPPQNMPEGSGVLLFIFHANFLGKDVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPFAKVKLLIGAYRV 848          
BLAST of SMED30034756 vs. UniProt/SwissProt
Match: sp|Q99549|MPP8_HUMAN (M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 GN=MPHOSPH8 PE=1 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 3.263e-6
Identity = 69/310 (22.26%), Postives = 138/310 (44.52%), Query Frame = 1
Query:  643 NINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            N      +P N  +L+D ++ GD   ++  + S++  +L+   S+   L +LAA      ++  L++ G  +N +  +  TAL+ A E    + + +L+  GA +N   SN ++ L   C++     +++++  GAD    S+ ++ +L     +AK      +  + + HL  LS   +  I      +L L   + P++ I+   + +    + D N K   +N P      LFI     +G E+         +++V LND  Q  +      + +F  +   NKL ++       K ++++ AY V
Sbjct:  558 NFAATDAIPSN--VLRDAVKNGDYITVKVALNSNEEYNLDQEDSSGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSAL----HFAKQSNNVLVYDLLKNHLETLSRVAEETIKDYFEARLAL---LEPVFPIACHRLCEGPDFSTDFNYK-PPQNIPEGSGILLFIFHANFLGKEVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPSAKVKLLIGAYRV 857          
BLAST of SMED30034756 vs. UniProt/SwissProt
Match: sp|Q3TYA6|MPP8_MOUSE (M-phase phosphoprotein 8 OS=Mus musculus OX=10090 GN=Mphosph8 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.711e-6
Identity = 67/303 (22.11%), Postives = 136/303 (44.88%), Query Frame = 1
Query:  664 LPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS----FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            +P NL  L+D ++ GD   ++  + S++  +L+   S    L +LAA      ++  L++ G  +N +  +  TAL+ A E    + + +L+  GA +N   SN ++ L   C++     +++++  GAD    S+ ++ +L     +AK      +  + + HL  LS   +  I      +L L   + P++ I+   + +    + D N  +  +N P      LFI     +G ++         +++V LND  Q  +      + +F  +   NKL ++       K ++++ AY V
Sbjct:  563 IPNNL--LRDAVKNGDYIAVKVALNSNEEYNLDQEDSTGMTLVMLAAAGGQDDLLRLLITKGAKVNGRQKNGTTALIHAAEKNFLTTVAILLEAGAFVNVQQSNGETALMKACKRGNSDIVRLVIECGADCNILSKHQNSALY----FAKQCNNVLVYELLKSHLETLSRVAEETIRDYFESRLAL---LEPVFPIACHRLCEGPDFSTDFNY-MPPQNMPEGSGVLLFIFHANFLGKDVIARLCGPCSVQAVVLNDKFQLPVFLDSHFVYSFSPVAGPNKLFIRLTEAPFAKVKLLIGAYRV 855          
BLAST of SMED30034756 vs. TrEMBL
Match: K1PS99 (M-phase phosphoprotein 8 OS=Crassostrea gigas OX=29159 GN=CGI_10008812 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.723e-11
Identity = 72/296 (24.32%), Postives = 138/296 (46.62%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS---FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLK-KQNKLSVKFENIKCRKTRIILAAYYVTTI 1560
             +  + +GD   ++  + S +R  +E +      L + AA++    I   L+S G +IN++  +  T+LM ACE+     + LLV  GA +N      ++ L    ++   + ++ LL  GA+FS  +++S  S   YAK ++LT+I+ I  + +++L+      + + L    ++   + P+ V  P     +  +NF      ++ NTP     LFI    I  ++ KC F     + S  LN V Q  LT+    + +   L+  +N++ +        K ++++ AY    I
Sbjct:  466 FQQAVTEGDYQAVRRALSSSKRYDVEAVDDLGITLLMYAAQSGFDDIAELLVSNGADINAQQKNGTTSLMLACEHAYICTVALLVELGAKINVQQDTGETALMKAVKRGHKQIVKFLLEYGANFS-AQNNSGFSALTYAKMLRLTEIEDIITEFITRLTKEFDKQVAVTLNNTAQISSSLFPMQVF-PLCESSKFVINF---KHEMQPNTPGVGYLLFIAHARITATDCKCRFYGPCAVNSATLNGVPQPPLTEEANFVLSCCPLQNGRNEIVINTVKASTSKAKLVICAYKAQLI 756          
BLAST of SMED30034756 vs. TrEMBL
Match: A0A210QD81 (M-phase phosphoprotein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07684 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.026e-11
Identity = 71/298 (23.83%), Postives = 146/298 (48.99%), Query Frame = 1
Query:  679 EILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPS---FLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKK-QNKLSVKFENIKCRKTRIILAAYYVTTI 1560
            E  +  + +GD  L++  + S ++  +E++      L + +A+N +  I   L++   NIN++  +  T+LM ACE+     + LLV  GA++N   +  ++ L     +   + ++ LL  GA+FS  +++S  +   YAK M+LT+I+ I   ++S+L+      + + L    ++   + P+    P    ++  +NF      L+ NTP     LF+    I   +++C F     +++V+LN V+Q  LT+    + +   L+  +N++ +        K ++++ AY    I
Sbjct:  527 ENFRQAVMEGDYLLVKKALGSKKKFDVESVDDLGITLLMYSAQNGNDDIAELLVNHKANINAQQHNGTTSLMLACEHAHICTVALLVELGANVNLQQTTGETALMKAVRRGHKQIVKFLLEHGANFS-AQNNSGFTAVTYAKMMRLTEIEDIIVDYISRLTNEFDKQVAITLNSTAKIISALFPLQCF-PLSEGEKFSVNFKHE---LQANTPGVGYLLFVAHARITAQDIRCRFYGPCAVQNVSLNGVQQPPLTEEANFVLSCCPLQHGRNEVIINTVPAPGSKAKLVVCAYKAQLI 819          
BLAST of SMED30034756 vs. TrEMBL
Match: A0A1S3HJH8 (ankyrin repeat and KH domain-containing protein mask isoform X1 OS=Lingula unguis OX=7574 GN=LOC106155815 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.793e-11
Identity = 76/292 (26.03%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKN--DDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDE--IHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLK-KQNKLSVKFENIKCRKTRIILAAY 1545
            LK  +++G  + ++  + S ++ +LE        L +LAA    DDL  V  L+  G N+N+K     T LMFA EN     + +L+  GA +N  N + ++ L    +K   + +++LL  GADFS   +    +L +YAK +   ++Q    +H+ KL+      + L +         + P++V+ P    D+  IH N ++   +        LF+    I   E KC  S    +K+  LN V Q +LT   + + +F  L   +N+L +        + ++++ AY
Sbjct:  521 LKHAVKEGMYERVRKALNSQKQYNLEQPDQMGMTLVMLAAAKGFDDL--VELLVINGANMNAKAKTGNTPLMFAAENGHLCTVAVLLALGAHINIQNGSQETALIKATKKGHNQIVKMLLENGADFSAENATGNTAL-KYAKLLNSVELQATINQHVKKLTALFTQQVYLTMNNTAETVCSLFPLHVL-PLNEGDKFVIHFNHELQPTVPGVGM--LLFVAHARITPQETKCRLSGPCAVKTAILNGVAQPTLTDEGQFVLSFSPLHNGRNELIIHTVYAPTSRAKLVVGAY 806          
BLAST of SMED30034756 vs. TrEMBL
Match: A0A1S3HMJ6 (ankyrin repeat and KH domain-containing protein mask isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155815 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.136e-11
Identity = 76/292 (26.03%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKN--DDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDE--IHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLK-KQNKLSVKFENIKCRKTRIILAAY 1545
            LK  +++G  + ++  + S ++ +LE        L +LAA    DDL  V  L+  G N+N+K     T LMFA EN     + +L+  GA +N  N + ++ L    +K   + +++LL  GADFS   +    +L +YAK +   ++Q    +H+ KL+      + L +         + P++V+ P    D+  IH N ++   +        LF+    I   E KC  S    +K+  LN V Q +LT   + + +F  L   +N+L +        + ++++ AY
Sbjct:  520 LKHAVKEGMYERVRKALNSQKQYNLEQPDQMGMTLVMLAAAKGFDDL--VELLVINGANMNAKAKTGNTPLMFAAENGHLCTVAVLLALGAHINIQNGSQETALIKATKKGHNQIVKMLLENGADFSAENATGNTAL-KYAKLLNSVELQATINQHVKKLTALFTQQVYLTMNNTAETVCSLFPLHVL-PLNEGDKFVIHFNHELQPTVPGVGM--LLFVAHARITPQETKCRLSGPCAVKTAILNGVAQPTLTDEGQFVLSFSPLHNGRNELIIHTVYAPTSRAKLVVGAY 805          
BLAST of SMED30034756 vs. TrEMBL
Match: A0A1S3HMK1 (M-phase phosphoprotein 8 isoform X7 OS=Lingula unguis OX=7574 GN=LOC106155815 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 8.586e-11
Identity = 76/292 (26.03%), Postives = 136/292 (46.58%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKN--DDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDE--IHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLK-KQNKLSVKFENIKCRKTRIILAAY 1545
            LK  +++G  + ++  + S ++ +LE        L +LAA    DDL  V  L+  G N+N+K     T LMFA EN     + +L+  GA +N  N + ++ L    +K   + +++LL  GADFS   +    +L +YAK +   ++Q    +H+ KL+      + L +         + P++V+ P    D+  IH N ++   +        LF+    I   E KC  S    +K+  LN V Q +LT   + + +F  L   +N+L +        + ++++ AY
Sbjct:  421 LKHAVKEGMYERVRKALNSQKQYNLEQPDQMGMTLVMLAAAKGFDDL--VELLVINGANMNAKAKTGNTPLMFAAENGHLCTVAVLLALGAHINIQNGSQETALIKATKKGHNQIVKMLLENGADFSAENATGNTAL-KYAKLLNSVELQATINQHVKKLTALFTQQVYLTMNNTAETVCSLFPLHVL-PLNEGDKFVIHFNHELQPTV--PGVGMLLFVAHARITPQETKCRLSGPCAVKTAILNGVAQPTLTDEGQFVLSFSPLHNGRNELIIHTVYAPTSRAKLVVGAY 706          
BLAST of SMED30034756 vs. Ensembl Cavefish
Match: ENSAMXT00000034627.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:21583758:21586293:1 gene:ENSAMXG00000034330.1 transcript:ENSAMXT00000034627.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 3.860e-6
Identity = 60/259 (23.17%), Postives = 109/259 (42.08%), Query Frame = 1
Query:  787 LFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD---FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKD-EIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            L +LAA      I+  L+  GV +N +  +  TALM A E    + + +L+  G+ LN      ++ L   C++     +++LL  GAD    S+ K+ +L    + + N+ + D+ +    H+  LS   +  I      +L L   + P+      E  D  +  N+        + +   LFI     + SE+         + +V LND  Q  +      I +F  +   NKL ++       K ++++ AY V
Sbjct:    3 LSMLAAAGGQDDILRLLIKKGVKVNGRQKNGTTALMHAAEKNFLTTVAILLEAGSCLNAQTIGGETALMRACKRGNADVVRLLLEYGADCNILSKHKNTALY-FAKLSNNLVVNDLIK---DHIQTLSTVAEETIRAYFESRLALLESVFPLACHRLCEGPDFSLEFNYKPPPHPPGEGSGILLFIFHANFM-SEITARLCGPCSVHAVILNDKFQLPIFLDSHFIYSFSPVPGANKLFIRLAESPTAKVKLLICAYKV 256          
BLAST of SMED30034756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006173.1 (pep scaffold:Pmarinus_7.0:GL476888:203576:225198:1 gene:ENSPMAG00000005569.1 transcript:ENSPMAT00000006173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.047e-7
Identity = 62/295 (21.02%), Postives = 134/295 (45.42%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIM-PIYVISPFEIKD---EIHLNFDINSKLLKKNTPSFLFILTGIIIGSE-MKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYVT 1554
            L++ +  GD+  ++  + + Q   +++       L +LAA    L I+  L+  G N+N++  +  TAL++A E    S + LL+ NGA +N   +N ++ L   C++   + +++LL+  AD S +    L+  +    + KL   Q I+E   +   + +    L ++      DV+++ P++ ++   +      +   ++         + + LF++     G E + C  +    +++V LN   Q  L      + +F  +   N L V+F      K  +++ A+ V+
Sbjct:    2 LREAVRTGDMHTVRAAL-TTQPHQVDHEDGTGMTLVMLAAAFGHLDILRLLIRSGANVNARQKNGSTALIYAAEKNHLSTLALLLENGARVNLQQNNGETALSKACKRGDVEMVRLLLDNFADCSAM----LVQQSATQAHQKLYTNQIISEMIANNRQL-LSGAALDKIQEYFEEDVKLLDPLFPMTCHRVDGCECSVQFEYEPADDPPAGCSSTLLFLVHSSTQGCERIACRLTGACAVQAVVLNQHYQLPLFLKNNFVFSFNPVPGMNSLLVRFSTSPALKVNVMVCAHAVS 290          
BLAST of SMED30034756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006175.1 (pep scaffold:Pmarinus_7.0:GL476888:203579:225198:1 gene:ENSPMAG00000005569.1 transcript:ENSPMAT00000006175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 4.748e-7
Identity = 64/294 (21.77%), Postives = 136/294 (46.26%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIM-PIYVISPFEIKD-EIHLNFDIN-SKLLKKNTPSFLFILTGIIIGSE-MKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYVT 1554
            L++ +  GD+  ++  + + Q   +++       L +LAA    L I+  L+  G N+N++  +  TAL++A E    S + LL+ NGA +N   +N ++ L   C++   + +++LL+  AD S +    L+  +    + KL   Q I+E   +   + +    L ++      DV+++ P++ ++   +   E  + F+   +      + + LF++     G E + C  +    +++V LN   Q  L      + +F  +   N L V+F      K  +++ A+ V+
Sbjct:    1 LREAVRTGDMHTVRAAL-TTQPHQVDHEDGTGMTLVMLAAAFGHLDILRLLIRSGANVNARQKNGSTALIYAAEKNHLSTLALLLENGARVNLQQNNGETALSKACKRGDVEMVRLLLDNFADCSAM----LVQQSATQAHQKLYTNQIISEMIANNRQL-LSGAALDKIQEYFEEDVKLLDPLFPMTCHRVDGCECSVQFEYEPADDPPAGSSTLLFLVHSSTQGCERIACRLTGACAVQAVVLNQHYQLPLFLKNNFVFSFNPVPGMNSLLVRFSTSPALKVNVMVCAHAVS 288          
BLAST of SMED30034756 vs. Ensembl Medaka
Match: ENSORLT00000016144.3 (M-phase phosphoprotein 8 [Source:NCBI gene;Acc:101156779])

HSP 1 Score: 53.5286 bits (127), Expect = 4.613e-7
Identity = 67/297 (22.56%), Postives = 128/297 (43.10%), Query Frame = 1
Query:  667 PLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGAD--FSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYV 1551
            PL+   L+D ++ GD   ++  + S +  +LE    +   L +LAA      I+  L+  GV +N++  +  TALM A E    + + +L+  G+ +N      ++ L   C++     +++LL  GAD        ++ L   + + N+ + D   + ++H++ LS   +  I      +L L   + PI      E  D   L F   ++   +++   LFI     +          C  + +V LND  Q  +      I +F  +   NKL ++       K ++++ AY V
Sbjct:  488 PLSPSELRDAVKSGDYMAVKLALNSKEDYNLEQEDVSGMSLCMLAAAGGQDDILRLLIKKGVRVNARQKNGTTALMHAAEKNFLTTVAILLEAGSYVNAQTLGGETALMKACKRGNTDIVRLLLEYGADCNIQSKHKNTALYFAKVSNNLVVFD---LVKEHINVLSSVAEETIRGYFESRLVLLEPVFPIACHRLCEGPD-FSLEFGFKAQPQPESSGILLFIFHANFLNEITARLCGPC-SVHAVVLNDKFQLPIFLDSHFIYSFSPVPGINKLFIRLAEAPTAKVKLLICAYRV 779          
BLAST of SMED30034756 vs. Ensembl Medaka
Match: ankdd1b (ankyrin repeat and death domain containing 1B [Source:NCBI gene;Acc:101164158])

HSP 1 Score: 49.2914 bits (116), Expect = 9.360e-6
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNG 948
            L  + E+G+  L+Q  +       ++N     P    LA +N  +P++ SLL+ G NIN  D  S+TA+ FA E     L+++L+  G
Sbjct:  325 LHPVSERGEASLVQLLLQYKTDADVQNQHLEAP--LHLAVRNSRIPVIHSLLAAGCNINLTDKRSQTAMHFAAELAQTELVEMLLKAG 410          
BLAST of SMED30034756 vs. Ensembl Medaka
Match: ankdd1b (ankyrin repeat and death domain containing 1B [Source:NCBI gene;Acc:101164158])

HSP 1 Score: 48.9062 bits (115), Expect = 9.661e-6
Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  685 LKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNG 948
            L  + E+G+  L+Q  +       ++N     P    LA +N  +P++ SLL+ G NIN  D  S+TA+ FA E     L+++L+  G
Sbjct:  299 LHPVSERGEASLVQLLLQYKTDADVQNQHLEAP--LHLAVRNSRIPVIHSLLAAGCNINLTDKRSQTAMHFAAELAQTELVEMLLKAG 384          
BLAST of SMED30034756 vs. Planmine SMEST
Match: SMESG000043111.1 (SMESG000043111.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 515/515 (100.00%), Postives = 515/515 (100.00%), Query Frame = 1
Query:   16 MTQILNGRGESYIEKIISHRISANKSNYYEYHVKMSNTDSAIWLSEMEIIKLNTNLLKCYKKKAGLIALSGNDDENFHLVDFSKFIALNFNECMGIKLEIGVVCDEATMETSESIEQVTTAVKIKTENVEYVENESADNCNKMICNNSLKEDLITTRELNSSCLRNEPVIPEQNERNGDISQVPSNSFDLIDRFFDHLPIVSKVTNDLRNINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYVTTI 1560
            MTQILNGRGESYIEKIISHRISANKSNYYEYHVKMSNTDSAIWLSEMEIIKLNTNLLKCYKKKAGLIALSGNDDENFHLVDFSKFIALNFNECMGIKLEIGVVCDEATMETSESIEQVTTAVKIKTENVEYVENESADNCNKMICNNSLKEDLITTRELNSSCLRNEPVIPEQNERNGDISQVPSNSFDLIDRFFDHLPIVSKVTNDLRNINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGASLNNINSNNDSILFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYVTTI
Sbjct:    1 MTQILNGRGESYIEKIISHRISANKSNYYEYHVKMSNTDSAIWLSEMEIIKLNTNLLKCYKKKAGLIALSGNDDENFHLVDFSKFIALNFNECMGIKLEIGVVCDEATMETSESIEQVTTAVKIKTENVEYVENESADNCNKMICNNSLKEDLITTRELNSSCLRNEPVIPEQNERNGDISQVPSNSFDLIDRFFDHLPIVSKVTNDLRNINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGASLNNINSNNDSILFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKCRKTRIILAAYYVTTI 515          
BLAST of SMED30034756 vs. Planmine SMEST
Match: SMESG000043115.1 (SMESG000043115.1)

HSP 1 Score: 232.261 bits (591), Expect = 9.437e-69
Identity = 142/338 (42.01%), Postives = 217/338 (64.20%), Query Frame = 1
Query:  556 SQVPSNSFDLIDRFFDHLPIVSKVTNDLRNINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLENLISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDE-IHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQS-FKTITTFISLKKQNK-LSVKFENIKCRKTRIILAAYYVTTI 1560
            ++   N+ D +D  F HLPI +K+  D+   ++  L P+ ++IL  II KG+ +LLQ+Y+ S  ++ L  L+ + P LF+LAA+ + + IV  LL+LG +IN  D  S  ALM ACENE++ LID LV NGA++N I+++++  L +CC KNK ++   LLNLGA+F++I  +   SL  Y + M+L +I +I +KH++ LS +IK  IL  LG K+++  +IMPI VIS FEI+++ + L FD +   +K N  + L ++TGI++GS MK   SD  +I SV LN VEQ SL    +  +T+F  LK +N  L + +E   CRK R++LAA+ V  I
Sbjct:  277 NEAEGNNLDTVDELFMHLPITTKILIDVDKSSEIELNPITMDILISIINKGNTELLQSYINSCHKQLLGQLVQSKPWLFVLAAQCNHVHIVGLLLALGADINGFDDHSFNALMRACENENQLLIDFLVNNGAAMNLISNDSNIALLYCCLKNKVQSFNTLLNLGANFNKILIEPPCSLERYVRQMELKEIGQILDKHITNLSKNIKENILSLLGPKIKILNQIMPINVISLFEIQNKSVSLTFDADIPPVKPNHCNILSLVTGIVVGSGMKLLLSDSNKICSVILNGVEQQSLIPGNYNVMTSFSPLKGENNTLVLNYEKNSCRKIRLLLAAFNVIMI 614          

HSP 2 Score: 67.0106 bits (162), Expect = 1.739e-11
Identity = 56/159 (35.22%), Postives = 85/159 (53.46%), Query Frame = 1
Query:   43 ESYIEKIISHRISANKSNYYEYHVKMSNTDSAIWLSEMEIIKLNTNLLKCYKK------KAGLIALSGNDDENFHLVDFSKFIALNFNECMGIKLEIGVVCDEATMETSESIEQVTTAV-------KIKTENVEYVENESADNCNKMICNNSLKEDLIT 480
            E  ++ I+SHRI       +E++V ++N+ S +W+SE  + K + ++L+ YKK      + G  +LS   D    +++ SKFIALNFNE  GIKLEIGV       +  E I     +         IKTE+VE+  NE  D C+    N+  +ED I+
Sbjct:    3 ELSVDCILSHRID---EGIHEFYVSVNNSQSMLWISESYLQKYHFDILETYKKCHNINDELGKKSLSNEVD----VINHSKFIALNFNEEFGIKLEIGVRETPLENDILECIPSPGASTYLMNPIQDIKTESVEFDSNE--DFCSIEYTNSLKQEDYIS 152          
BLAST of SMED30034756 vs. Planmine SMEST
Match: SMESG000045245.1 (SMESG000045245.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.290e-11
Identity = 64/258 (24.81%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  787 LFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENESESLIDLLVTNGAXXXXXXXXXXXXXFFCCEKNKPKAIQILLNLGADFSRIKSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLDVRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMKCFFSDCYQIKSVALNDVEQGSLTQSFKTITTFIS--LKKQNKLSVKFENIK-CRKTRIILAAYYV 1551
            L +LA++     I+  ++  GV++N ++ +  T LM ACE   E +  LL+ NGA +N +N  ++S L     + + + + ILL  G D   ++++   S  + A+   L +++ +  ++   LS  +    +  +G  + +   I P+ ++S +E + E  L F+     +K++  + L I TG++   +++        I SV LN++ Q SL    +     +S  L  +N L++KF +   CR  R +   + V
Sbjct:  359 LLVLASRLGYSDIIGMIIRAGVDVNYQNEEGITPLMTACEYGHEIVCQLLINNGAHINFVNKKSESALLKVVTRGQKECLSILLQNGCDVFNLENEK--SPLQIARQRNLHEMEVMITEYHKNLSEKLSAKFIGLMGSMVSVSYIIFPLRILSLYE-ESEFVLEFETKFPPVKEDECNILIIFTGLVQEKQIQFCLEQIVPIVSVTLNEISQQSLVPENQNYLMSMSPILDGKNLLTIKFGSTADCRWIRSLAVGFRV 613          
The following BLAST results are available for this feature:
BLAST of SMED30034756 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MPHOSPH86.796e-722.26M-phase phosphoprotein 8 [Source:HGNC Symbol;Acc:H... [more]
KIDINS2202.653e-628.21kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2205.879e-628.21kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2206.040e-628.21kinase D interacting substrate 220 [Source:HGNC Sy... [more]
back to top
BLAST of SMED30034756 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034756 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034756 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034756 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MPHOSPH83.433e-622.73M-phase phosphoprotein 8 [Source:NCBI gene;Acc:100... [more]
FANK19.569e-641.38fibronectin type III and ankyrin repeat domains 1 ... [more]
FANK19.765e-641.38fibronectin type III and ankyrin repeat domains 1 ... [more]
back to top
BLAST of SMED30034756 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mphosph85.305e-722.11M-phase phosphoprotein 8 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30034756 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|G3V8T1|MPP8_RAT3.010e-622.11M-phase phosphoprotein 8 OS=Rattus norvegicus OX=1... [more]
sp|Q99549|MPP8_HUMAN3.263e-622.26M-phase phosphoprotein 8 OS=Homo sapiens OX=9606 G... [more]
sp|Q3TYA6|MPP8_MOUSE3.711e-622.11M-phase phosphoprotein 8 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of SMED30034756 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PS991.723e-1124.32M-phase phosphoprotein 8 OS=Crassostrea gigas OX=2... [more]
A0A210QD812.026e-1123.83M-phase phosphoprotein 8 OS=Mizuhopecten yessoensi... [more]
A0A1S3HJH84.793e-1126.03ankyrin repeat and KH domain-containing protein ma... [more]
A0A1S3HMJ65.136e-1126.03ankyrin repeat and KH domain-containing protein ma... [more]
A0A1S3HMK18.586e-1126.03M-phase phosphoprotein 8 isoform X7 OS=Lingula ung... [more]
back to top
BLAST of SMED30034756 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000034627.13.860e-623.17pep primary_assembly:Astyanax_mexicanus-2.0:19:215... [more]
back to top
BLAST of SMED30034756 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006173.14.047e-721.02pep scaffold:Pmarinus_7.0:GL476888:203576:225198:1... [more]
ENSPMAT00000006175.14.748e-721.77pep scaffold:Pmarinus_7.0:GL476888:203579:225198:1... [more]
back to top
BLAST of SMED30034756 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034756 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034756 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000016144.34.613e-722.56M-phase phosphoprotein 8 [Source:NCBI gene;Acc:101... [more]
ankdd1b9.360e-631.82ankyrin repeat and death domain containing 1B [Sou... [more]
ankdd1b9.661e-631.82ankyrin repeat and death domain containing 1B [Sou... [more]
back to top
BLAST of SMED30034756 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000043111.10.000e+0100.00SMESG000043111.1[more]
SMESG000043115.19.437e-6942.01SMESG000043115.1[more]
SMESG000045245.11.290e-1124.81SMESG000045245.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034756 ID=SMED30034756|Name=SMED30034756|organism=Schmidtea mediterranea sexual|type=transcript|length=1567bp
ATAACATAATTTTAAATGACTCAAATATTAAATGGAAGAGGCGAGTCTTA
TATTGAAAAAATTATATCGCATCGTATTAGTGCAAATAAATCTAACTATT
ATGAATATCATGTTAAAATGAGTAATACAGATTCTGCAATATGGTTATCT
GAAATGGAAATTATTAAATTAAATACTAATTTGTTAAAATGTTATAAAAA
AAAGGCTGGTTTGATTGCTCTTTCTGGTAATGATGATGAAAATTTTCATT
TGGTTGACTTTTCCAAATTTATCGCTTTAAATTTCAATGAATGTATGGGA
ATTAAGTTAGAAATTGGTGTAGTATGTGATGAAGCAACTATGGAAACTTC
TGAGTCGATAGAGCAGGTTACAACTGCTGTAAAAATTAAAACAGAAAATG
TTGAATATGTGGAAAACGAATCCGCTGATAACTGTAATAAAATGATTTGT
AATAACAGTTTAAAAGAAGATTTAATTACTACAAGGGAATTGAATAGTAG
CTGTTTGCGAAACGAACCTGTTATTCCTGAACAAAATGAACGAAACGGGG
ATATTTCACAAGTTCCATCCAACTCTTTCGATCTCATCGACAGATTCTTT
GATCATTTGCCAATCGTTTCTAAAGTCACCAATGATTTACGAAATATCAA
TAAATATTCTTTGCTTCCTTTAAATTTAGAAATTTTAAAAGACATAATTG
AGAAAGGTGACCTCGATTTGTTGCAGAATTACATGTACAGTGATCAAAGG
GAGTCATTGGAAAATCTCATTTCCAATTACCCGTGCCTGTTCATATTGGC
AGCAAAAAATGATGATCTACCAATCGTTTCATCACTGCTATCTCTCGGTG
TCAATATAAATTCCAAGGATACAGATTCCAAAACTGCATTAATGTTTGCA
TGCGAAAATGAAAGTGAAAGCTTAATTGATTTGCTGGTTACCAACGGGGC
TTCTCTGAATAATATAAATTCCAATAATGACAGTATATTGTTTTTCTGTT
GTGAGAAAAATAAACCGAAAGCAATTCAAATCCTTCTAAATCTTGGTGCC
GATTTTTCAAGAATAAAATCTGATTCGCTATTATCTTTGAATGAATATGC
GAAAAATATGAAACTGACAGATATTCAAAGAATAGCGGAAAAACATTTGT
CGAAACTTTCAATTAGCATCAAAAATGTCATATTATTACAACTGGGAGGA
AAATTACGACTCGATGTCCGGATAATGCCAATTTATGTGATTTCTCCGTT
CGAAATCAAAGACGAGATACATCTCAATTTTGACATCAACAGTAAACTAT
TGAAGAAAAATACTCCAAGCTTTCTCTTCATATTGACTGGAATTATTATT
GGATCAGAAATGAAGTGTTTTTTTAGTGATTGTTATCAAATAAAATCAGT
TGCATTAAATGATGTCGAGCAGGGCTCTCTCACTCAAAGTTTTAAAACAA
TTACGACTTTTATTTCTTTAAAGAAACAAAATAAACTTTCAGTCAAATTT
GAAAATATTAAATGCAGAAAGACACGAATAATACTGGCAGCTTATTATGT
AACTACTATATAATAAC
back to top

protein sequence of SMED30034756-orf-1

>SMED30034756-orf-1 ID=SMED30034756-orf-1|Name=SMED30034756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=516bp
MTQILNGRGESYIEKIISHRISANKSNYYEYHVKMSNTDSAIWLSEMEII
KLNTNLLKCYKKKAGLIALSGNDDENFHLVDFSKFIALNFNECMGIKLEI
GVVCDEATMETSESIEQVTTAVKIKTENVEYVENESADNCNKMICNNSLK
EDLITTRELNSSCLRNEPVIPEQNERNGDISQVPSNSFDLIDRFFDHLPI
VSKVTNDLRNINKYSLLPLNLEILKDIIEKGDLDLLQNYMYSDQRESLEN
LISNYPCLFILAAKNDDLPIVSSLLSLGVNINSKDTDSKTALMFACENES
ESLIDLLVTNGASLNNINSNNDSILFFCCEKNKPKAIQILLNLGADFSRI
KSDSLLSLNEYAKNMKLTDIQRIAEKHLSKLSISIKNVILLQLGGKLRLD
VRIMPIYVISPFEIKDEIHLNFDINSKLLKKNTPSFLFILTGIIIGSEMK
CFFSDCYQIKSVALNDVEQGSLTQSFKTITTFISLKKQNKLSVKFENIKC
RKTRIILAAYYVTTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR016197Chromo-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005184neuropeptide hormone activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 253..283
e-value: 240.0
score: 9.6
coord: 287..316
e-value: 0.038
score: 23.1
coord: 320..349
e-value: 4.8
score: 16.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 287..319
score: 9.938
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 260..348
e-value: 1.9E-10
score: 41.2
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 261..352
score: 21.349
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 203..373
e-value: 4.4E-22
score: 80.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 228..358
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 229..351
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 9..63