Dynamin-type G domain-containing protein

Overview
NameDynamin-type G domain-containing protein
Smed IDSMED30034752
Length (bp)1968
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-type G domain-containing protein (SMED30034752) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30034752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-type G domain-containing protein (SMED30034752) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-type G domain-containing protein (SMED30034752) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034752SMESG000014762.1 SMESG000014753.1 Contig44169newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034752SMESG000014762.1 SMESG000014753.1 Contig44169uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034752SMESG000014762.1 SMESG000014753.1 dd_Smed_v4_2080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034752SMESG000014753.1 dd_Smed_v4_2409_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 96.2857 bits (238), Expect = 8.071e-21
Identity = 75/303 (24.75%), Postives = 146/303 (48.18%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    S   H T+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+   R +    + +S   + +    R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 97.4413 bits (241), Expect = 2.207e-20
Identity = 75/303 (24.75%), Postives = 146/303 (48.18%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    S   H T+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+   R +    + +S   + +    R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN1 (mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262])

HSP 1 Score: 97.4413 bits (241), Expect = 2.207e-20
Identity = 75/303 (24.75%), Postives = 146/303 (48.18%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            K  +I E ++R  +K+  FG+ S GKS ++NAML D    S   H T+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+   R +    + +S   + +    R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:   63 KLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVRVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVNALEAQNRIFFVSAKEVLSARKQKAQGMPESGVALAEGFHARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 96.2857 bits (238), Expect = 5.125e-20
Identity = 69/274 (25.18%), Postives = 135/274 (49.27%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++               +++ +  + + +++  +  +K   A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   RI+    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHE-----AFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Match: MFN2 (mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877])

HSP 1 Score: 96.2857 bits (238), Expect = 5.125e-20
Identity = 69/274 (25.18%), Postives = 135/274 (49.27%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++               +++ +  + + +++  +  +K   A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   RI+    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHE-----AFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRSQAGDRIFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Match: fzo-1 (Transmembrane GTPase fzo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q23424])

HSP 1 Score: 85.5001 bits (210), Expect = 5.511e-17
Identity = 67/259 (25.87%), Postives = 116/259 (44.79%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKG--NKATANETIEVSICMDDETL---------------LKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRI 942
            +++ I    + I +   RD +K+  FG+ S GKS  +NAML +        HTT  F+ V+ SE +                 +  +  ++I   + G    A ++E  ++     D  L               L+  + I+D PG     +    I K+  +AD+F+ V N    LT  ++ FF       +KP+VFI+ N+WD S  + E    + K  +       + +LE+  E E+ DRI+F+S+RE+ + R+
Sbjct:   81 EIEAIGDSIKTIMDTFQRDNMKVVFFGRTSNGKSTTINAMLHEKVLPQGMGHTTCCFLQVEGSEGE-------------VGHLQLDDNPQKIDMKMLGKIGHALSDENSDLPAMGQDSLLKVFHPKKSESGECRLLQNDVVILDSPGVDLSPEFDSWIDKHCLDADVFVLVSNAESTLTQAEKNFFLRVAKKLSKPNVFILNNRWDASAAETENIEDVKKQHLTRFRQFLVDELEVCSEREVNDRIFFVSSREVLESRL 326          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: fzo (gene:FBgn0011596 transcript:FBtr0084399)

HSP 1 Score: 113.235 bits (282), Expect = 9.962e-26
Identity = 74/278 (26.62%), Postives = 137/278 (49.28%), Query Frame = 1
Query:  226 LDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFV-----------HVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEI-TKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFE 1014
            L    S+ E I + ++RD +K+  FG+ S GKS ++NA+L +    SA  HTTS F            HVK  ++D +                 +  + +++          +  ++V++  +  ++L   + ++D PG    +Q+ DC+     +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD++ + + E  Q  K +  E C   L  +L + +   E ++RIY +SA E   IR   N  + +     ++R+++F+RFE
Sbjct:   68 LCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEH---------------MELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR---NGQITNPSGQTQQRYQEFLRFE 327          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0343373)

HSP 1 Score: 109.383 bits (272), Expect = 2.224e-24
Identity = 79/276 (28.62%), Postives = 139/276 (50.36%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDE-ESTQMSKTKIK--EECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIE----NNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN 1038
            K   I E + RD +K+  FG+ S GKS ++NAML +    S   HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+ E + ++++K K +  E C  FL K L+++ E E  +R++F+SARE  Q RIE    N   +       + R+ +F  FE   ++ I+
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEPECQESELAKVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECIS 394          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070910)

HSP 1 Score: 108.227 bits (269), Expect = 4.421e-24
Identity = 78/273 (28.57%), Postives = 135/273 (49.45%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIE----NNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN 1038
            K   I E + RD +K+  FG+ S GKS ++NAML +    S   HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K++  E C  FL K L+++ E E  +R++F+SARE  Q RIE    N   +       + R+ +F  FE   ++ I+
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECIS 390          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Match: Marf (gene:FBgn0029870 transcript:FBtr0070909)

HSP 1 Score: 108.227 bits (269), Expect = 4.421e-24
Identity = 78/273 (28.57%), Postives = 135/273 (49.45%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIE----NNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN 1038
            K   I E + RD +K+  FG+ S GKS ++NAML +    S   HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K++  E C  FL K L+++ E E  +R++F+SARE  Q RIE    N   +       + R+ +F  FE   ++ I+
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECIS 390          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 98.9821 bits (245), Expect = 5.405e-21
Identity = 88/343 (25.66%), Postives = 166/343 (48.40%), Query Frame = 1
Query:   64 PETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFS-------SKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFED----FMRFEYNLKKYIN 1038
            P  LK+    +K +SE+     +   + CE             VK+T  N S        +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K    + C  FL  +L++    +  +RI+F+SA+E+   R++    + ++   + + F+D    F  FE + ++ I+
Sbjct:    6 PSPLKRFVLAKKKISEVFEQLLVYVQEGCEF------------VKETCANESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERSFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 98.9821 bits (245), Expect = 5.405e-21
Identity = 88/343 (25.66%), Postives = 166/343 (48.40%), Query Frame = 1
Query:   64 PETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFS-------SKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFED----FMRFEYNLKKYIN 1038
            P  LK+    +K +SE+     +   + CE             VK+T  N S        +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K    + C  FL  +L++    +  +RI+F+SA+E+   R++    + ++   + + F+D    F  FE + ++ I+
Sbjct:    6 PSPLKRFVLAKKKISEVFEQLLVYVQEGCEF------------VKETCANESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQH-TDRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQNFERSFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 95.5153 bits (236), Expect = 5.909e-21
Identity = 84/329 (25.53%), Postives = 160/329 (48.63%), Query Frame = 1
Query:   64 PETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFS-------SKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMR 1008
            P  LK+    +K +SE+     +   + CE             VK+T  N S        +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K    + C  FL  +L++    +  +RI+F+SA+E+   R++    + ++   + + F+D ++
Sbjct:    6 PSPLKRFVLAKKKISEVFEQLLVYVQEGCEF------------VKETCANESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHT-DRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLK 316          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn1b (mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553])

HSP 1 Score: 93.9745 bits (232), Expect = 1.670e-20
Identity = 87/331 (26.28%), Postives = 161/331 (48.64%), Query Frame = 1
Query:   64 PETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFS-------SKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREM--SQIRIENNDSLVDSDPNVKKRFEDFMR 1008
            P  LK+    +K +SE+     +   + CE             VK+T  N S        +LD IES   K  +I E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ +++D             +++ K I+ + +++  +  +++  A   ++V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S  + E    + K    + C  FL  +L++    +  +RI+F+SA+E+  S+++     +L +   +  K F++F R
Sbjct:    6 PSPLKRFVLAKKKISEVFEQLLVYVQEGCEF------------VKETCANESLENIANKDQLDEIESYTSKLSIIQEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDK-----AFLKTEGSEEEKSIKTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEKLSKPNIFILNNRWDASAAEPEYMEDVRKQHT-DRCVNFLVEELKVVDRAQAPNRIFFVSAKEVLNSRMQRAQGGALAEGFQDRLKEFQNFER 318          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 95.9005 bits (237), Expect = 4.826e-20
Identity = 69/263 (26.24%), Postives = 133/263 (50.57%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEY 1017
            SK   I E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ +             +D+ K ++ + +++  +  ++   A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S N+ E   ++ +  + + C+ FL  +L +       DRI+F+SA+E+ Q R++    + ++   + + F+  M FE+
Sbjct:   83 SKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNE-----SFLLTEGSDERKSVKTVNQLAHALHQDEDLDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASANEPEYMEEVRRQHM-DRCTSFLVDELRVVDRSHAGDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARM-FEF 338          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 96.2857 bits (238), Expect = 5.428e-20
Identity = 72/272 (26.47%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFE 1014
            K+   ++K   I E + R  +K+  FG+ S GKS ++N+ML D    S   HTT+ F+ V+ +E D             +++ K ++ + +++  +  +K   A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K  + E C  FL  +L++    E   RI+F+SA+E+   R+     + ++   + +    RF +F +FE
Sbjct:   75 KVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDK-----AYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFE 340          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 95.9005 bits (237), Expect = 6.253e-20
Identity = 72/272 (26.47%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFE 1014
            K+   ++K   I E + R  +K+  FG+ S GKS ++N+ML D    S   HTT+ F+ V+ +E D             +++ K ++ + +++  +  +K   A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K  + E C  FL  +L++    E   RI+F+SA+E+   R+     + ++   + +    RF +F +FE
Sbjct:   67 KVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDK-----AYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFE 332          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 95.9005 bits (237), Expect = 6.253e-20
Identity = 72/272 (26.47%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFE 1014
            K+   ++K   I E + R  +K+  FG+ S GKS ++N+ML D    S   HTT+ F+ V+ +E D             +++ K ++ + +++  +  +K   A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K  + E C  FL  +L++    E   RI+F+SA+E+   R+     + ++   + +    RF +F +FE
Sbjct:   72 KVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGDK-----AYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFE 337          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 95.9005 bits (237), Expect = 6.931e-20
Identity = 72/272 (26.47%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFE 1014
            K+   ++K   I E + R  +K+  FG+ S GKS ++N+ML D    S   HTT+ F+ V+ +E D             +++ K ++ + +++  +  +K   A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K  + E C  FL  +L++    E   RI+F+SA+E+   R+     + ++   + +    RF +F +FE
Sbjct:   72 KVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGD-----KAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFE 337          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Match: mfn1 (mitofusin 1 [Source:NCBI gene;Acc:548943])

HSP 1 Score: 95.9005 bits (237), Expect = 6.994e-20
Identity = 72/272 (26.47%), Postives = 136/272 (50.00%), Query Frame = 1
Query:  223 KLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFE 1014
            K+   ++K   I E + R  +K+  FG+ S GKS ++N+ML D    S   HTT+ F+ V+ +E D             +++ K ++ + +++  +  +K   A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K  + E C  FL  +L++    E   RI+F+SA+E+   R+     + ++   + +    RF +F +FE
Sbjct:   57 KVKASKTKLAGIGEVLARRNMKVAFFGRTSSGKSTVINSMLWDKVLPSGIGHTTNCFLSVEGTEGD-----KAYLMTEGSEEKKSVKTVNQLAHALHMDKDLGAGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFYKVNEKLSKPNIFILNNRWDASASEPEYMEDVRKQHM-ERCQSFLVDELKVVDSLEAQKRIFFVSAKEVLNARMHKAQGMPEAGAALAEGFHTRFLEFQKFE 322          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 100.138 bits (248), Expect = 2.141e-21
Identity = 95/382 (24.87%), Postives = 176/382 (46.07%), Query Frame = 1
Query:   61 LPETLKQLKNI---RKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIES------------KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREM-------SQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            + ET+  LK+    +K ++ I       +G++ E      +TE    V+ T  N   +LD I S            K  VI E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+       +Q   E   +L +     + R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:    1 MAETVSPLKHFVLAKKAITAI-------FGQLLEF-----VTEGSHFVEATYRN--PELDRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAE---GFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn1 (mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664])

HSP 1 Score: 100.138 bits (248), Expect = 2.141e-21
Identity = 95/382 (24.87%), Postives = 176/382 (46.07%), Query Frame = 1
Query:   61 LPETLKQLKNI---RKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIES------------KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREM-------SQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            + ET+  LK+    +K ++ I       +G++ E      +TE    V+ T  N   +LD I S            K  VI E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+       +Q   E   +L +     + R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:    1 MAETVSPLKHFVLAKKAITAI-------FGQLLEF-----VTEGSHFVEATYRN--PELDRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAE---GFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 93.9745 bits (232), Expect = 1.826e-19
Identity = 69/273 (25.27%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   R++    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 93.9745 bits (232), Expect = 1.826e-19
Identity = 69/273 (25.27%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   R++    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Match: Mfn2 (mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230])

HSP 1 Score: 93.9745 bits (232), Expect = 1.826e-19
Identity = 69/273 (25.27%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK  + ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   R++    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERQFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|O18412|FZO_DROME (Transmembrane GTPase fzo OS=Drosophila melanogaster OX=7227 GN=fzo PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 9.986e-25
Identity = 74/278 (26.62%), Postives = 137/278 (49.28%), Query Frame = 1
Query:  226 LDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFV-----------HVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEI-TKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFE 1014
            L    S+ E I + ++RD +K+  FG+ S GKS ++NA+L +    SA  HTTS F            HVK  ++D +                 +  + +++          +  ++V++  +  ++L   + ++D PG    +Q+ DC+     +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD++ + + E  Q  K +  E C   L  +L + +   E ++RIY +SA E   IR   N  + +     ++R+++F+RFE
Sbjct:   68 LCAFSSRVEAIAKVLSRDRMKVAFFGRTSNGKSAVINALLHEKILPSAMGHTTSCFCQVQANGSNETEHVKVEQEDEH---------------MELSALSQLASAHSPGALKPSTLLQVNMAKNRCSILDYDVVLMDTPGVDVTAQLDDCLDSYCMDADVFILVLNAESTVSRVERQFFKDVASKLSRPNLFILNNRWDKASSLEPEMEQKVKDQHMERCVNLLVDELGVYSTAQEAWERIYHVSALEALHIR---NGQITNPSGQTQQRYQEFLRFE 327          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7YU24|MARF_DROME (Transmembrane GTPase Marf OS=Drosophila melanogaster OX=7227 GN=Marf PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.432e-23
Identity = 78/273 (28.57%), Postives = 135/273 (49.45%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIE----NNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN 1038
            K   I E + RD +K+  FG+ S GKS ++NAML +    S   HTT+ F  V+ S   ++Y +     ++           I++++  +   K   +  + +    +  +LL+  +  VD PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N+  E  +  K++  E C  FL K L+++ E E  +R++F+SARE  Q RIE    N   +       + R+ +F  FE   ++ I+
Sbjct:  125 KVAAIREVLQRDHMKVAFFGRTSNGKSSVINAMLREKILPSGIGHTTNCFCQVEGSNGGEAYLMTEGSEEKLNVV------NIKQLANALCQEKLCESSLVRIFWPRERCSLLRDDVVFVDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHTVSQKLSKPNIFILNNRWDASANEP-ECQESVKSQHTERCIDFLTKELKVSNEKEAAERVFFVSARETLQARIEEAKGNPPHMGAIAEGFQIRYFEFQDFERKFEECIS 390          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q811U4|MFN1_MOUSE (Mitofusin-1 OS=Mus musculus OX=10090 GN=Mfn1 PE=1 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 1.498e-20
Identity = 95/382 (24.87%), Postives = 176/382 (46.07%), Query Frame = 1
Query:   61 LPETLKQLKNI---RKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIES------------KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREM-------SQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            + ET+  LK+    +K ++ I       +G++ E      +TE    V+ T  N   +LD I S            K  VI E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+       +Q   E   +L +     + R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:    1 MAETVSPLKHFVLAKKAITAI-------FGQLLEF-----VTEGSHFVEATYRN--PELDRIASEDDLVEIQGYRNKLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPSEARNRIFFVSAKEVLNSRKHKAQGMPEGGGALAE---GFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R4Z9|MFN1_RAT (Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.737e-20
Identity = 76/303 (25.08%), Postives = 146/303 (48.18%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNV----KKRFEDFMRFEYNLKKYIN--------DPQDNKTRRYMQEIKNIQDFLN 1104
            K  VI E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ D +Y +     ++        +     +  ++K     A   + V        LL+  + +VD PG+   +++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + +  + E C  FL  +L++    E  +RI+F+SA+E+   R+     + +    +    + R ++F  FE   ++ I+        +    + ++ +  +KNI D +N
Sbjct:   63 KLAVIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHTTNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLK-----AGCLVHVFWPKAKCALLRDDLVLVDSPGTDVTTELDIWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMEDVRRQHM-ERCLHFLVEELKVVSPLEARNRIFFVSAKEVLNSRMNKAQGMPEGGGALAEGFQARLQEFQNFEQTFEECISQSAVKTKFEQHTIRAKQILDTVKNILDSVN 359          
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R500|MFN2_RAT (Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.029e-19
Identity = 70/273 (25.64%), Postives = 130/273 (47.62%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLR-KLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            SK   I+E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V  +  D +               K + ++       +  +  A   + V        LLK G+ ++D PG    +++   I K   +AD+F+ V N    L   ++ FF    +  ++P++FI+ N+WD S ++ E   ++ +  + E C+ FL  +L +    +  DRI+F+SA+E+   R++    + +    + + F+    +F  FE   ++ I+
Sbjct:   83 SKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGT--DGHEAFLLTEGSEEKKSVKTVNQLAHALH--QDEQLHAGSLVSVMWPNSKCPLLKDGLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHM-ERCTSFLVDELGVVDRAQAGDRIFFVSAKEVLSARVQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECIS 350          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A5E4MV73 (Dynamin superfamily,Fzo/mitofusin HR2 domain,P-loop containing nucleoside triphosphate hydrolase,Dynamin OS=Cinara cedri OX=506608 GN=CINCED_3A012836 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.490e-24
Identity = 87/308 (28.25%), Postives = 147/308 (47.73%), Query Frame = 1
Query:  238 ESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLN-------YALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKK----RFEDFMRFEYNLK----------KYINDPQDNKTRRYMQEIKNIQ 1092
            ESK   I E + RD +K+  FG+ S GKS ++NAMLGD    +   HTT+ F+ V+ S+  D+Y +     ++         E I  ++  +   K     E + V    D   LL+  + +VD PG      + D I  +  +AD+F+ V N       Y +  + + F K     S KP++FI+ N+WD S N+ E   Q+ K  ++      +++L++   DE   RI+F+SA+E+ Q R++    L  +   + +    R+ +F  FE+  +          K++N  Q  K     QE KN++
Sbjct:   56 ESKVRGICEVLTRDHMKVAFFGRTSNGKSTVVNAMLGDKVLPTGIGHTTNCFLQVEGSQSGDAYLVIEGSNEKQNV------ESISHLAHALNHEKQLNEKELVHVYWPKDRCVLLRDDVALVDSPGVDVTPHLDDWIDNHCIDADVFVLVANAESXLYVYQINGEKKFFHKVSSKLS-KPNIFILNNRWDASANEPEFLDQVRKQHMERATDFLMKELKVCTADEASTRIFFISAKEVLQARVQERKGLALNSGALAEGFSTRYMEFKEFEHRFEECISKSAIKTKFLNHSQQGKHLIKSQEQKNLK 356          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1A9X2I7 (Dynamin-type G domain-containing protein OS=Glossina brevipalpis OX=37001 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.058e-23
Identity = 83/273 (30.40%), Postives = 143/273 (52.38%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFE----DFMRFEYNLKKYIN 1038
            K   I E + RD +K+  FG+ S GKS ++NAML +    +   HTT+ F  V+  +  ++Y IK    ++         ++I++++  +   K + N  I +    D  +LL+ G+  +D PG    + + D I  +   AD+F+ VLN    +T  ++ FF       +KP++FI+ N+WD S N ++E  +  K++  E C  FL K L+IT E+E  +R++F+SARE+ Q RIE       S   + + F+    +F  FE   ++ I+
Sbjct:  107 KVAGIREVLARDHMKVAFFGRTSNGKSSVINAMLREKILPNGIGHTTNCFCQVEGCDGSEAYLIKEGSDEKLNV------KDIKQLANALSQEKLSENSLIRIFWPRDRCSLLRDGVVFMDSPGVDVSANLDDWIDNHCLNADVFVLVLNAESTMTRAEKQFFHKVSQKLSKPNIFILNNRWDASAN-EQEFQESVKSQHTERCVDFLTKELKITNEEEAAERVFFVSAREVVQARIEKAKGNSPSSGAIAEGFQIRYFEFQDFERKFEECIS 372          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1W4V389 (transmembrane GTPase fzo isoform X2 OS=Drosophila ficusphila OX=30025 GN=LOC108091614 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.028e-22
Identity = 80/264 (30.30%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  235 IESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEI-TKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFE 1014
            +  K   I + + R  +K+  FG+ S GKS ++NAML +    SA  HTTS F  V+ + DD       + +    D +   E     S      +      I  S C    +LL   + ++D PG    +Q+ DC+ +   +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD + N + E  Q  K +  E C K L   L + + E++   RIY +SA E  Q+R   N    + +P  ++R+ +F RFE
Sbjct:   46 LADKISSIDKVLARKRMKVAFFGRTSNGKSAVINAMLHERILPSAMGHTTSCFCQVQANGDDEPEHVRIEEEEQQLDLSSLNELASAHSPRALKPRTLLYVNIPKSRC----SLLDYDVVLMDTPGVDVTAQLDDCLDRYCMDADVFILVLNAESTISRVERQFFKDVSSKLSRPNLFILNNRWDVASNQEPEMEQQVKDQHMERCLKLLIEDLRVYSDEEQAKKRIYHISALEALQLR---NGCKTNPNPQTQERYLEFQRFE 302          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A2H8TF58 (Transmembrane GTPase Marf OS=Melanaphis sacchari OX=742174 GN=Marf_0 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.529e-22
Identity = 82/279 (29.39%), Postives = 142/279 (50.90%), Query Frame = 1
Query:  142 KICEINNKCD--ITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSL 960
            ++ ++N KC   I E E K   ++L++ SK+  I    EV+T    RD +K+  FG+ S GKS ++NAMLGD    S   HTT+ F+ V+ S+  D+Y +     ++         E +  ++  +   K     E + V    D  +LL+  + +VD PG      + D I  +  +AD+F+ V N    L   ++ FF       +KP++FI+ N+WD S N+ E   Q+ K  ++      +++L++   +E   RI+F+SA+E+ Q R++    L
Sbjct:   58 RMIDVNLKCPDVINESELK---SMLDYRSKVKGI---CEVLT----RDHMKVAFFGRTSNGKSTVVNAMLGDKVLPSGIGHTTNCFLQVEGSQTGDAYLVTEGSNEKQNV------ESVTHLAHALNYEKQLNEKELVHVYWPKDKCSLLRDDVALVDSPGVDVTPHLDDWIDAHCIDADVFVLVANAESTLMVTEKNFFHKVSTKLSKPNIFILNNRWDASANEPEFLDQVRKQHMERATDFLVKELKVCTPEEAVSRIFFISAKEVLQARVKERSGL 320          
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Match: A0A1W4V2X5 (transmembrane GTPase fzo isoform X1 OS=Drosophila ficusphila OX=30025 GN=LOC108091614 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.610e-22
Identity = 80/264 (30.30%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  235 IESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEI-TKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFE 1014
            +  K   I + + R  +K+  FG+ S GKS ++NAML +    SA  HTTS F  V+ + DD       + +    D +   E     S      +      I  S C    +LL   + ++D PG    +Q+ DC+ +   +AD+FI VLN    ++  +R FFK      ++P++FI+ N+WD + N + E  Q  K +  E C K L   L + + E++   RIY +SA E  Q+R   N    + +P  ++R+ +F RFE
Sbjct:   74 LADKISSIDKVLARKRMKVAFFGRTSNGKSAVINAMLHERILPSAMGHTTSCFCQVQANGDDEPEHVRIEEEEQQLDLSSLNELASAHSPRALKPRTLLYVNIPKSRC----SLLDYDVVLMDTPGVDVTAQLDDCLDRYCMDADVFILVLNAESTISRVERQFFKDVSSKLSRPNLFILNNRWDVASNQEPEMEQQVKDQHMERCLKLLIEDLRVYSDEEQAKKRIYHISALEALQLR---NGCKTNPNPQTQERYLEFQRFE 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 99.7525 bits (247), Expect = 2.140e-21
Identity = 77/286 (26.92%), Postives = 144/286 (50.35%), Query Frame = 1
Query:  217 SSKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKS-EDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFED----FMRFEYNLKKYIN 1038
            S++L  IES   K  VI E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ + ED +Y       +          + + +++  +  +++  A   ++V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K    + C  FL  +L++   +E  + I+F+SA+E+   R++    + ++   + + F+D    F  FE   ++ I+
Sbjct:   52 STQLQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEEKSI------KTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHT-DRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn1b (mitofusin-1 [Source:NCBI gene;Acc:103030239])

HSP 1 Score: 99.7525 bits (247), Expect = 2.327e-21
Identity = 77/286 (26.92%), Postives = 144/286 (50.35%), Query Frame = 1
Query:  217 SSKLDNIES---KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKS-EDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKAT-ANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFED----FMRFEYNLKKYIN 1038
            S++L  IES   K  VI E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ + ED +Y       +          + + +++  +  +++  A   ++V        LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S ++ E    + K    + C  FL  +L++   +E  + I+F+SA+E+   R++    + ++   + + F+D    F  FE   ++ I+
Sbjct:   52 STQLQEIESYTEKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDEDKAYLKTEGSEEEKSI------KTVNQLAHALHMDESLDAGCLVKVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASASEPEYMDDVRKQHT-DRCVNFLVEELKVVDREEAPNHIFFVSAKEVLNSRMQRAQGMPETGGALAEGFQDRLKEFQSFERTFEECIS 330          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043809.1 (mitofusin-1-like [Source:NCBI gene;Acc:103034819])

HSP 1 Score: 98.5969 bits (244), Expect = 5.816e-21
Identity = 76/302 (25.17%), Postives = 140/302 (46.36%), Query Frame = 1
Query:  244 KYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFED----FMRFEYNLKKYINDPQ-----DNKTRRYMQ---EIKNIQDFLN 1104
            K E I E + R  +K+  FG+ S GKS ++NAML +    S   HTT+ F+ V+ ++ D ++       +R        +     +  N+      +   + V        LL+  + ++D PG+   S++   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S+ + E    + K  +    S  + +L++   D+  +RI+F+SA+E    RI     + ++   +   F+D    F  FE   +++I+        +  T R  Q    +K I D +N
Sbjct:   64 KLEAIWEVLARRQMKVAFFGRTSNGKSTVINAMLRERVLPSGIGHTTNCFISVEGTDGDQAFLTTENSEERKSIKTVNQLAHALHMDRNLD-----SGCLVRVFWPKTKCALLRDDLVLMDSPGTDVTSELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVSERISKPNIFILNNRWDASETEPEYLDGVRKQHMDRCVSFLVDELKVVSPDQAPNRIFFVSAKEALSARIHRAQGMPETGAALADGFQDRLQEFQSFERTFEEFISHSSVKTKFEQHTIRAWQITESLKTIMDAIN 360          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Match: mfn2 (mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44])

HSP 1 Score: 94.3597 bits (233), Expect = 1.187e-19
Identity = 68/263 (25.86%), Postives = 134/263 (50.95%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEY 1017
            SK   I E ++R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ +             +++ K ++ + +++  +  ++   A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S ++ E   ++ +  + + CS FL  +L +    +  DRI+F+SA+E+ Q R++    + ++   + + F+  M FE+
Sbjct:   83 SKVAGIGEVLSRRHMKVVFFGRTSNGKSSVINAMLWDKVLPSGIGHTTNCFLRVEGTDGNE-----AFLLTEGSEERKNVKTVNQLAHALHQDEDLDAGSLVCVMWPKAKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMEEVRRQHM-DRCSSFLVDELGVVDRAQASDRIFFVSAKEVLQARVQKAQGMPEAGGALAEGFQARM-FEF 338          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Match: EDO42379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L1])

HSP 1 Score: 93.5893 bits (231), Expect = 8.523e-20
Identity = 95/340 (27.94%), Postives = 159/340 (46.76%), Query Frame = 1
Query:   55 SILPETLKQLKNIRKTVSEIENN-DEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSED-DSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDND-DEESTQMSKTKIKEECSKFLRK-LEITKEDEIYDRIYFLSAREMSQIRIENNDSL--------VDSDPNVKKRFEDF-MRFEYNLKK 1029
            S L   +K  K I +TVSEI    DE N   IC     C+I E+    K  +  F+  +     +   ITE + RD +K+  FG+ S GKS ++NAML D        HTT+ F+ V  S+  D Y           +D+ + ++ + +I+  +   K   +  ++V        +L + + +VD PG      +   I K+  +AD+F+ V N    L   ++ FF       +KP++FI+ N+WD S  + D E  ++ K +  +    FL K L+   + +  DR++F+SA+E    R++ +  +        VD     K  FE+F  +FE  + K
Sbjct:   27 SPLHNFVKAKKKINETVSEIGKYLDEANR-FIC----GCEIAED---YKSNIKGFACDVAGFLGQVASITEVIARDQMKVAFFGRTSNGKSTVVNAMLQDRILPMGIGHTTNCFLSVNGSDSADPY------ILIPESDERRNVKTLGQIAHALFEEKLDHSSLVQVYWPKSRCKMLSEDVVLVDSPGIDVSPDLDLWIDKHCLDADVFVLVCNAESTLMVTEKNFFHKVNQKLSKPNIFILNNRWDASAGEPDVEMMELVKKQHLQRNVDFLSKELKCVDKKQAEDRVFFVSAKETLMSRMQKHQGMPEEGGAIHVDGFHGRKLEFENFEHKFEECISK 352          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 100.523 bits (249), Expect = 1.291e-21
Identity = 77/288 (26.74%), Postives = 141/288 (48.96%), Query Frame = 1
Query:  220 SKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICM-------DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNV----KKRFEDFMRFEYNLKKYIN 1038
            S++     K  VI E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++DD SY                  EE    + N   +    +E+++   C+           LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S N+ E    + K    + C  FL  +L++   ++  +RI+F+SA+E+   R++    + ++   +    ++R ++F  FE   ++ I+
Sbjct:   67 SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSD-----------EEKSIKTVNQMAHALHMDESLDAG-CLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHT-DRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECIS 341          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn1b (mitofusin 1 [Source:NCBI gene;Acc:101158009])

HSP 1 Score: 100.523 bits (249), Expect = 1.337e-21
Identity = 77/288 (26.74%), Postives = 141/288 (48.96%), Query Frame = 1
Query:  220 SKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDD-SYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICM-------DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNV----KKRFEDFMRFEYNLKKYIN 1038
            S++     K  VI E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++DD SY                  EE    + N   +    +E+++   C+           LL+  + +VD PG+   +Q+   I K   +AD+F+ V N    L + ++ FF    +  +KP++FI+ N+WD S N+ E    + K    + C  FL  +L++   ++  +RI+F+SA+E+   R++    + ++   +    ++R ++F  FE   ++ I+
Sbjct:   67 SEIQAYADKLAVIKEVLARRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDDDRSYLKTEGSD-----------EEKSIKTVNQMAHALHMDESLDAG-CLVRVFWPKTKCALLRDDLVLVDSPGTDVTTQLDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNERLSKPNIFILNNRWDASANEPEYMEDVRKQHT-DRCVNFLVEELKVVDREQAPNRIFFISAKEVLNSRMQRAQGMPETGGALAEGFQERLKEFQSFERRFEECIS 341          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000009003.2 (pep primary_assembly:ASM223467v1:17:11595384:11602171:-1 gene:ENSORLG00000007178.2 transcript:ENSORLT00000009003.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.420e-19
Identity = 74/290 (25.52%), Postives = 142/290 (48.97%), Query Frame = 1
Query:  217 SSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSE-DDSYXXXXXXXXXXXXXXXXXXEEIERISG-NIKGNKATANETIEVSICM-------DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVK----KRFEDFMRFE--YNLKKY 1032
            S ++ +  +K   I + + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++ D++Y                  EE   IS  N   +    + T++ S C+           LL+  + ++D PG+    ++   I K   +AD+F+ V N    L + +++FF    +  +KP++FI+ N+WD S  + +   ++ K  + + C  FL  +L +   +E   RI+F+SA+E+   R++    + ++   +     +R  +F RFE  + ++K+
Sbjct:   53 SLEMQSCATKLYTIRDVLLRRHMKVAFFGRTSNGKSTVINAMLRDRVLPSGIGHTTNCFLSVEGTDGDEAYLTSEAS------------EERRSISTVNQLAHALHMDPTLDSS-CLVKVFWPKSRCALLRNDLVLMDSPGTDVTLELDSWIDKFCLDADVFVLVGNAESTLMNTEKLFFHKVSERISKPNIFILHNRWDASVTEPDYIQEVRKQHL-DRCVGFLAEELGVVGPNEAPGRIFFISAKEVLSSRMQRAQGMPETGGALAEGFHERLTEFQRFERTFEVRKH 328          
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Match: mfn2 (mitofusin 2 [Source:NCBI gene;Acc:101170481])

HSP 1 Score: 92.0485 bits (227), Expect = 6.201e-19
Identity = 69/264 (26.14%), Postives = 132/264 (50.00%), Query Frame = 1
Query:  241 SKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNK-ATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNY--ALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFL-RKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYN 1020
            SK   I E + R  +K+  FG+ S GKS ++NAML D    S   HTT+ F+ V+ ++               +++ K I+ + +++  +  ++   A   + V        LL+  + +VD PG    +++   I K   +AD+F+ V N    L   ++ FF    +  + P++FI+ N+WD S ++ E   ++ +  + + CS FL  +L +    +  DRI+F+SA+E+ Q R++    + ++   + + F+  M FE+ 
Sbjct:   83 SKVAGIGEVLARRHMKVVFFGRTSNGKSTVINAMLCDKVLPSGIGHTTNCFLRVEGTDGSE-----GFLLTEGSEEKKSIKTVNQLAHALHQDQDLDAGSLVCVMWPKVKCALLRDDLVLVDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKSFFHKVNERLSSPNIFILNNRWDASASEPEYMDEVRRQHM-DRCSNFLVEELGVVDRAQASDRIFFVSAKEVLQARMQRVQGMPEAGGALAEGFQARM-FEFQ 339          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014753.1 (SMESG000014753.1)

HSP 1 Score: 1169.07 bits (3023), Expect = 0.000e+0
Identity = 598/606 (98.68%), Postives = 602/606 (99.34%), Query Frame = 1
Query:   46 MNISILPETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMENFKATILSKNDDVQNSLLKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFIHFIKTKDLINRKTYLSETKELNIKLMWNPIIVNPTDNVSKEACIVKEVMEKLAMIPIPNIPFQMFAQGVSLVGKLVIKRIEDSESEQHRQSIIQQLNSQRSNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKDFDKDGFS 1863
            MNISILPETLKQLKNIRKTVSEIENND+INYGKI EINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFAS TAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIERISG+IKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYF SAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDME+FKATILSKNDDVQNSLLKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFIHFIK+KDLIN KTYLSETKELNIKLMWNPIIVNPTDNVSKEACIVKEVMEKLAMIPIPNIPFQMFAQGVSLVGKLVIKRIEDSESEQHRQSIIQQLNSQRSNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKDFDKDGFS
Sbjct:    1 MNISILPETLKQLKNIRKTVSEIENNDKINYGKISEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIERISGDIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFFSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMEDFKATILSKNDDVQNSLLKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFIHFIKSKDLINGKTYLSETKELNIKLMWNPIIVNPTDNVSKEACIVKEVMEKLAMIPIPNIPFQMFAQGVSLVGKLVIKRIEDSESEQHRQSIIQQLNSQRSNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKDFDKDGFS 606          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014762.1 (SMESG000014762.1)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 370/623 (59.39%), Postives = 471/623 (75.60%), Query Frame = 1
Query:   46 MNISILPETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMENFKATILSKNDDVQNSLLKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFIHFIKTKDLINRKTYLSETKELNIKLMWNPIIVNPTD-----------NVSKEACIVKEVMEKLAMIPIPNIPFQMFAQGVS--LVGKLVIKR-----------IEDSESEQHRQSIIQQLNSQRSNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKD 1842
            MN  IL ET  + +NIRK V EI+  DEINYGKI E+N KCDITEEEWKV + +LNFSSKLDNI+SK+EVI EKVNRD+VKIFLFGKVSVGKS LLN MLGDNYFAS TAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDK +FI+EIE +SG+IKGNKATANE IEVSI MDDE+LLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSK KI EECSKFL+ L++ K++EI +RIYFLS+ EM Q RIEN+DSL+ S    KKRF++F RFEYNLKKYI+ PQDNKTRRY +EIK +Q +L  E   F+ +IF EK  SLI KY K ++D+++FK  I  K +   N+++ ++E++ N+I+ SP++ ++EWVT++L H  +E+ +  +E + KQYK+F+ F+K ++ I +++  S+  +   K MW   IV P+D           N +K   ++ + +E L +  +  +P ++FA   S  ++  L +             ++  E EQ +Q+IIQQL+S+++  +  I++NV  I E+++EKANEI  +FQ K  +FNEYW ++E I ++
Sbjct:    1 MNTEILTETENRFENIRKIVKEIKRYDEINYGKISEMNKKCDITEEEWKVDQILLNFSSKLDNIKSKFEVINEKVNRDIVKIFLFGKVSVGKSTLLNTMLGDNYFASGTAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKKEFIKEIEIMSGDIKGNKATANENIEVSIRMDDESLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKEKINEECSKFLQDLDLMKKEEISERIYFLSSSEMFQFRIENDDSLIKSSKTAKKRFDEFTRFEYNLKKYISAPQDNKTRRYTEEIKKLQTYLCKECKDFKENIFKEKRYSLISKYRKLIEDLKDFKKEIKLKGERKNNNIIIKVENLLNDIMTSPNVTNTEWVTTELGHVHAELDIMFKEVKDKQYKEFVSFLKNQEGIGKESNFSKEGKPAFKSMWRTSIVKPSDKGLDVETADAVNPAKTGDVLNKTVEILPL--LGQLPTKIFALASSALIISGLAMTAASAVYASYANDMKVKEQEQQKQNIIQQLDSKKNIFNSNIKDNVEAITEHFIEKANEINGIFQRKIDMFNEYWSKIEEIFRE 621          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014755.1 (SMESG000014755.1)

HSP 1 Score: 207.994 bits (528), Expect = 1.277e-59
Identity = 127/373 (34.05%), Postives = 219/373 (58.71%), Query Frame = 1
Query:  202 TVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGN---KATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVD--SDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMENFKATILSKNDDVQNSLLKRLEDIH-NEIIHSPDLRS 1302
            T+ NF  K + IE+K   I  KV +D +KI  FG VS GKSK+LN ++G+N F SA A TTS FV V+KS+   + ++ + ++  F   T    +++ ++ ++  N   +    +T++V + +++E ++K   EI DCPGS NK ++T+CI + S ++DIFIFV+   LT++++ FF+YQ   S+KPD+F+++N+WD+SD D    T+ S+ KIK E    L K      +E   RI+F+SA EM + RIE  +   +  +   ++ R+E+F+ FE +L +YI++P+ NK  R+ +E++     L +    F+ ++F  K+   +  Y     DM++    +    + +   LL+  ++IH N   +  DLR+
Sbjct:   47 TIENFVKKYEIIETKVRFIEGKVKKDSIKISFFGTVSAGKSKVLNTIIGENLFLSAVADTTSCFVAVRKSDRGRHYLRVEGSETNFDSLTNLKNKVKELTTHLSENTTGRLDTTKTVQVFLNIENE-IMKNNTEIFDCPGSNNKREVTECIMQQSLDSDIFIFVMTCTLTNEEKDFFEYQSKLSSKPDIFVLVNKWDKSDQDKTAVTEKSRIKIKREIVNLLTKDGNFSSEEASKRIFFVSALEMFKCRIERKEIFGNQRTRRAIEMRYEEFLSFEESLSRYIDNPEINKLERHDREVRETTRNLESIIESFKTELFKHKDLRELKTY-----DMKDLSGRLDKAYECILKDLLRETKEIHMNLSTNCHDLRT 413          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000014759.1 (SMESG000014759.1)

HSP 1 Score: 205.682 bits (522), Expect = 5.704e-58
Identity = 123/305 (40.33%), Postives = 188/305 (61.64%), Query Frame = 1
Query:  184 EWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERI----SGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVD--SDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEI 1080
            E K+   + +F  K + IE+K   I  KV +D +KI  FGKVS GKS++LN +LG N F SA A TTS FV V KS+   + ++   ++  F       ++++ +    S NI     TA +T++V + + +E +LK   EIVDCPGS NK ++T+CIKK S ++DIFIFV+   LTD+++ FF+YQ   S+KPD+F+++N+WD SD D +E+T  S+ KIK+E    L K       E  +RI+F+SA EM + R+EN D  V+  +   +  R  +F  FE +L  YI++P+  KT+R+ +E+
Sbjct:   41 ESKILHLIEDFIKKFEIIETKIGFIEGKVKKDSIKISFFGKVSAGKSRVLNTILGGNIFVSAVADTTSCFVSVTKSDRRCHYLRVDGSEDNFGSLENLKDKVKELTTYLSKNINRRLDTA-KTVQVFLNIKNE-ILKNKTEIVDCPGSNNKGEVTECIKKQSLDSDIFIFVMTCTLTDEEKDFFEYQSKLSSKPDIFVLVNKWDNSDKDRQENTNKSRDKIKKEIINLLTKNGNFSSKEASERIFFVSALEMFKSRVENADVFVNKKNQEAIAMRNYEFTSFEKSLSNYIDNPEKKKTKRHFREV 343          
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Match: SMESG000070111.1 (SMESG000070111.1)

HSP 1 Score: 198.364 bits (503), Expect = 4.991e-56
Identity = 130/381 (34.12%), Postives = 224/381 (58.79%), Query Frame = 1
Query:   40 KKMNISILPETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKVKKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAMLGDNYFASATAHTTSSFVHVKKSEDDSYXXXXXXXXXXXXXXXXXXEEIERISGNIKGNKATANETIEVSICM-DDETLLKKGIEIVDCPGSGNKSQITDCIKKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDNDDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIENNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQDFLNTEFMKFQADIFNEKNNSLIPKYEKW 1179
            KKM+ +I  +  ++++  +K ++E+EN   I + ++C+          EWKV+K +  F  +   +E++   I E++++  +KIF FG VS GK++L+NA+LG  +F S   HTT  FVH+ KS D  Y+I  K+ +  +  K K IEE+E+IS   K   + + E+++V I + DD  +LK  +E++D PG+G+  ++ +C++ +  +ADI I++L   ++++D  FF  + + +TKPD+FI++N+WD+SD D +     +   +  +C   + K    K  +I  RI F+SA E+   RI+N +    S+ N K R+ DF RFE  +++YI +PQ  KTRRY +EIK +   LN   ++    I N    S + +YE +
Sbjct:   13 KKMSQNIDSDARQEMRKAKKLLTELENY--IGFEELCK----------EWKVQKKIKKFKDRFVELENQLNDIQEEISKKNIKIFFFGSVSSGKTRLINAILGGEFFMSTMNHTTKCFVHIMKSPDAKYKIVHKNQEFIYESKNKIIEEVEKISTFNKETSSMSQESVKVFIPIGDDNKILKGNVELIDSPGTGDIEELIECVQNHLSDADICIYLLCNDVSEEDERFFNIRINRTTKPDIFILVNKWDQSDQDQDSRLCETYKNLVGKCFGLVGKFGGPKTKDIDKRIIFISAIEVFGYRIKNKEP---SNRNQKIRYADFERFEDQIEEYIQNPQQLKTRRYKREIKTLLKELNIIIVELSKQINNIDFESCVKRYEGY 378          
The following BLAST results are available for this feature:
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFN18.071e-2124.75mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN12.207e-2024.75mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN12.207e-2024.75mitofusin 1 [Source:HGNC Symbol;Acc:HGNC:18262][more]
MFN25.125e-2025.18mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
MFN25.125e-2025.18mitofusin 2 [Source:HGNC Symbol;Acc:HGNC:16877][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fzo-15.511e-1725.87Transmembrane GTPase fzo-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fzo9.962e-2626.62gene:FBgn0011596 transcript:FBtr0084399[more]
Marf2.224e-2428.62gene:FBgn0029870 transcript:FBtr0343373[more]
Marf4.421e-2428.57gene:FBgn0029870 transcript:FBtr0070910[more]
Marf4.421e-2428.57gene:FBgn0029870 transcript:FBtr0070909[more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn1b5.405e-2125.66mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b5.405e-2125.66mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b5.909e-2125.53mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn1b1.670e-2026.28mitofusin 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1553... [more]
mfn24.826e-2026.24mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfn15.428e-2026.47mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.253e-2026.47mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.253e-2026.47mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.931e-2026.47mitofusin 1 [Source:NCBI gene;Acc:548943][more]
mfn16.994e-2026.47mitofusin 1 [Source:NCBI gene;Acc:548943][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfn12.141e-2124.87mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
Mfn12.141e-2124.87mitofusin 1 [Source:MGI Symbol;Acc:MGI:1914664][more]
Mfn21.826e-1925.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn21.826e-1925.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
Mfn21.826e-1925.27mitofusin 2 [Source:MGI Symbol;Acc:MGI:2442230][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18412|FZO_DROME9.986e-2526.62Transmembrane GTPase fzo OS=Drosophila melanogaste... [more]
sp|Q7YU24|MARF_DROME4.432e-2328.57Transmembrane GTPase Marf OS=Drosophila melanogast... [more]
sp|Q811U4|MFN1_MOUSE1.498e-2024.87Mitofusin-1 OS=Mus musculus OX=10090 GN=Mfn1 PE=1 ... [more]
sp|Q8R4Z9|MFN1_RAT2.737e-2025.08Mitofusin-1 OS=Rattus norvegicus OX=10116 GN=Mfn1 ... [more]
sp|Q8R500|MFN2_RAT1.029e-1925.64Mitofusin-2 OS=Rattus norvegicus OX=10116 GN=Mfn2 ... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4MV732.490e-2428.25Dynamin superfamily,Fzo/mitofusin HR2 domain,P-loo... [more]
A0A1A9X2I71.058e-2330.40Dynamin-type G domain-containing protein OS=Glossi... [more]
A0A1W4V3891.028e-2230.30transmembrane GTPase fzo isoform X2 OS=Drosophila ... [more]
A0A2H8TF581.529e-2229.39Transmembrane GTPase Marf OS=Melanaphis sacchari O... [more]
A0A1W4V2X51.610e-2230.30transmembrane GTPase fzo isoform X1 OS=Drosophila ... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b2.140e-2126.92mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
mfn1b2.327e-2126.92mitofusin-1 [Source:NCBI gene;Acc:103030239][more]
ENSAMXT00000043809.15.816e-2125.17mitofusin-1-like [Source:NCBI gene;Acc:103034819][more]
mfn21.187e-1925.86mitofusin 2 [Source:ZFIN;Acc:ZDB-GENE-081105-44][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO423798.523e-2027.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfn1b1.291e-2126.74mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
mfn1b1.337e-2126.74mitofusin 1 [Source:NCBI gene;Acc:101158009][more]
ENSORLT00000009003.21.420e-1925.52pep primary_assembly:ASM223467v1:17:11595384:11602... [more]
mfn26.201e-1926.14mitofusin 2 [Source:NCBI gene;Acc:101170481][more]
back to top
BLAST of Dynamin-type G domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014753.10.000e+098.68SMESG000014753.1[more]
SMESG000014762.10.000e+059.39SMESG000014762.1[more]
SMESG000014755.11.277e-5934.05SMESG000014755.1[more]
SMESG000014759.15.704e-5840.33SMESG000014759.1[more]
SMESG000070111.14.991e-5634.12SMESG000070111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034752 ID=SMED30034752|Name=Dynamin-type G domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1968bp
ATTTATTGTTAGAATTTTTATATCCGCATTTCAGATTTGAAAAAAATGAA
TATTTCAATTTTACCCGAAACATTAAAGCAATTGAAGAATATAAGAAAAA
CTGTCAGCGAAATAGAAAATAACGATGAAATTAATTATGGAAAAATATGC
GAAATAAATAACAAATGTGATATAACAGAAGAAGAGTGGAAAGTAAAAAA
GACCGTATTAAATTTCTCAAGCAAATTAGACAACATCGAAAGTAAATACG
AAGTCATCACCGAAAAAGTCAACAGAGATGTTGTCAAAATATTTCTTTTT
GGAAAAGTTTCAGTTGGCAAAAGCAAACTCCTGAATGCGATGTTGGGCGA
CAATTACTTTGCCTCGGCCACGGCTCACACAACGAGCAGTTTTGTCCATG
TCAAGAAATCGGAGGACGACAGCTACAGGATCAAAACTAAGGATACTGAT
CGAACGTTCACTGACAAAACAAAGTTCATTGAAGAAATTGAACGCATTTC
CGGAAACATAAAAGGTAATAAAGCCACGGCTAATGAAACCATTGAAGTGT
CGATATGCATGGATGACGAGACTCTATTGAAAAAAGGCATAGAAATTGTC
GACTGCCCCGGATCCGGAAACAAATCTCAAATTACAGACTGCATTAAGAA
AAATTCTCAAGAAGCGGATATATTCATATTTGTGTTGAATTACGCATTGA
CGGACGATGATAGGGTATTCTTCAAATATCAAGAGGATTCTTCAACTAAA
CCGGACGTTTTCATTGTTATAAATCAGTGGGACGAGTCTGATAATGATGA
TGAGGAGTCAACTCAAATGAGTAAAACTAAAATAAAAGAAGAATGTTCCA
AATTCCTGAGGAAATTAGAAATTACGAAGGAAGACGAAATTTATGACCGA
ATTTATTTTTTGTCAGCCCGTGAAATGTCTCAAATTCGAATTGAAAATAA
TGACAGTTTAGTCGACTCTGATCCTAATGTTAAAAAGCGATTCGAAGACT
TCATGCGGTTTGAATACAACCTAAAAAAATATATCAACGATCCTCAAGAC
AATAAAACCCGACGATATATGCAAGAGATCAAAAACATACAGGATTTCTT
GAACACAGAATTTATGAAATTTCAAGCTGATATTTTTAATGAAAAAAATA
ATTCCTTAATCCCAAAATATGAAAAATGGATGAAGGACATGGAGAACTTC
AAAGCGACAATACTGTCCAAAAATGACGATGTTCAGAATTCTTTGTTAAA
AAGATTGGAAGACATTCATAATGAAATTATCCACAGTCCAGATCTGAGGA
GCTCAGAATGGGTCACAAGTCAACTGGAACATTTCACCTCGGAAATGAAA
CTTAAGCTGCAAGAGGCTCAATTAAAACAATATAAAGATTTTATTCACTT
CATAAAAACAAAAGACCTAATAAATCGAAAAACTTATTTATCTGAGACAA
AAGAACTGAATATTAAGCTCATGTGGAATCCAATAATAGTCAATCCGACG
GATAATGTGTCCAAGGAGGCATGCATTGTGAAGGAAGTGATGGAGAAATT
GGCAATGATTCCTATTCCAAATATACCGTTTCAAATGTTTGCACAAGGAG
TGTCTCTTGTAGGGAAACTGGTCATAAAACGTATTGAAGATTCGGAGTCG
GAACAACATAGACAAAGCATTATACAACAATTGAATTCTCAACGGAGCAA
TATGTCCCGGATTATAGAAGAAAACGTGAATGAAATAAAGGAATATTATA
TGGAAAAGGCAAATGAAATAATTCAATTATTTCAAGAGAAAAGTAAATTG
TTCAACGAGTATTGGCGAAGGCTTGAAGGAATTTTGAAAGACTTTGATAA
GGATGGATTTAGTTAAAGTTTATTTAATGAATAATTGATATAAATAATAA
ATAATATTTACAATTTATTTATAATTAGCATGGATGTTGTAATCGTTTCA
CTTTTAGTTTGAATATTT
back to top

protein sequence of SMED30034752-orf-1

>SMED30034752-orf-1 ID=SMED30034752-orf-1|Name=SMED30034752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MNISILPETLKQLKNIRKTVSEIENNDEINYGKICEINNKCDITEEEWKV
KKTVLNFSSKLDNIESKYEVITEKVNRDVVKIFLFGKVSVGKSKLLNAML
GDNYFASATAHTTSSFVHVKKSEDDSYRIKTKDTDRTFTDKTKFIEEIER
ISGNIKGNKATANETIEVSICMDDETLLKKGIEIVDCPGSGNKSQITDCI
KKNSQEADIFIFVLNYALTDDDRVFFKYQEDSSTKPDVFIVINQWDESDN
DDEESTQMSKTKIKEECSKFLRKLEITKEDEIYDRIYFLSAREMSQIRIE
NNDSLVDSDPNVKKRFEDFMRFEYNLKKYINDPQDNKTRRYMQEIKNIQD
FLNTEFMKFQADIFNEKNNSLIPKYEKWMKDMENFKATILSKNDDVQNSL
LKRLEDIHNEIIHSPDLRSSEWVTSQLEHFTSEMKLKLQEAQLKQYKDFI
HFIKTKDLINRKTYLSETKELNIKLMWNPIIVNPTDNVSKEACIVKEVME
KLAMIPIPNIPFQMFAQGVSLVGKLVIKRIEDSESEQHRQSIIQQLNSQR
SNMSRIIEENVNEIKEYYMEKANEIIQLFQEKSKLFNEYWRRLEGILKDF
DKDGFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0048662negative regulation of smooth muscle cell proliferation
GO:0006697ecdysone biosynthetic process
GO:0007005mitochondrion organization
GO:0007029endoplasmic reticulum organization
GO:0008053mitochondrial fusion
GO:0008344adult locomotory behavior
GO:0010636positive regulation of mitochondrial fusion
GO:0019896axonal transport of mitochondrion
GO:0034389lipid particle organization
GO:0034976response to endoplasmic reticulum stress
GO:0070584mitochondrion morphogenesis
GO:0090140regulation of mitochondrial fission
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR027094Mitofusin_fam
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005740mitochondrial envelope
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031306intrinsic component of mitochondrial outer membrane
GO:1904115axon cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 6..26
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 82..328
e-value: 7.8E-23
score: 83.2
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 82..243
e-value: 1.3E-18
score: 67.6
IPR027094Mitofusin familyPANTHERPTHR10465TRANSMEMBRANE GTPASE FZO1coord: 5..406
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 64..293