nanos-like protein

Overview
Namenanos-like protein (ABO52809.1)
Smed IDSMED30034750
Length (bp)791
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nanos-like protein (SMED30034750) t-SNE clustered cells

Violin plots show distribution of expression levels for nanos-like protein (SMED30034750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nanos-like protein (SMED30034750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nanos-like protein (SMED30034750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
prepharyngeal regionSMED30034750SMESG000018169.1 SmedASXL_070230SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30034750SMESG000018169.1 SmedASXL_070230SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034750SMESG000018169.1 CUFF.280331.2be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30034750SMESG000018169.1 isotig19923be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
ovarySMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
ovarySMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
gonad primoridiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17376870
Wang et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
ovarySMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oogonial cellSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
eye primordiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
ovarySMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatogoniumSMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oogonial cellSMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30034750SMESG000018169.1 EF153633smed_ncbi_20200123PMID:17390146
Handberg-Thorsager et al., 2007
whole organism juvenile colorimetric in situ hybridization evidence
testisSMED30034750SMESG000018169.1 EF035555.1smed_ncbi_20200123PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30034750SMESG000018169.1 Smed_nanosGPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034750SMESG000018169.1 SMED_04665_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30034750SMESG000018169.1 SMED_04665_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nanos-like protein vs. Ensembl Human
Match: NANOS1 (nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:23044])

HSP 1 Score: 88.9669 bits (219), Expect = 2.787e-22
Identity = 35/58 (60.34%), Postives = 46/58 (79.31%), Query Frame = 2
Query:  452 IELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            +++CVFCRNN E   +Y +H +K  +G+V CPVLR YTCPLC ++GD AHTIKYCP+S
Sbjct:    3 LQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLS 60          
BLAST of nanos-like protein vs. Ensembl Human
Match: NANOS1 (nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:23044])

HSP 1 Score: 90.5077 bits (223), Expect = 9.679e-21
Identity = 35/61 (57.38%), Postives = 47/61 (77.05%), Query Frame = 2
Query:  443 ESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            +  +++CVFCRNN E   +Y +H +K  +G+V CPVLR YTCPLC ++GD AHTIKYCP+S
Sbjct:  208 KPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLS 268          
BLAST of nanos-like protein vs. Ensembl Human
Match: NANOS2 (nanos C2HC-type zinc finger 2 [Source:NCBI gene;Acc:339345])

HSP 1 Score: 77.7962 bits (190), Expect = 2.343e-17
Identity = 30/58 (51.72%), Postives = 43/58 (74.14%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMN 631
            LC FC++N E   +Y SH++K  +G V CP+LR+Y CP+C +TGD AHT+KYCP++  
Sbjct:   62 LCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGG 119          
BLAST of nanos-like protein vs. Ensembl Human
Match: NANOS3 (nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:22048])

HSP 1 Score: 72.7886 bits (177), Expect = 3.580e-15
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIK 694
            LC FC++N E   +Y SH +KD  G+V CP+LR+Y CP C +T + AHT ++CP+    T Q   +     TRN    K
Sbjct:   57 LCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPL----TGQGYTSVYSHTTRNSAGKK 131          
BLAST of nanos-like protein vs. Ensembl Human
Match: NANOS3 (nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:22048])

HSP 1 Score: 72.7886 bits (177), Expect = 3.580e-15
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIK 694
            LC FC++N E   +Y SH +KD  G+V CP+LR+Y CP C +T + AHT ++CP+    T Q   +     TRN    K
Sbjct:   57 LCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATRERAHTRRFCPL----TGQGYTSVYSHTTRNSAGKK 131          
BLAST of nanos-like protein vs. Ensembl Fly
Match: nos (gene:FBgn0002962 transcript:FBtr0083732)

HSP 1 Score: 78.9518 bits (193), Expect = 1.541e-16
Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCP 619
            CVFC NNNEP  +  SH V+D   +V CP LR Y CP+C ++GD AHTIKYCP
Sbjct:  319 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 371          
BLAST of nanos-like protein vs. Ensembl Fly
Match: nos (gene:FBgn0002962 transcript:FBtr0335019)

HSP 1 Score: 78.9518 bits (193), Expect = 1.671e-16
Identity = 32/53 (60.38%), Postives = 38/53 (71.70%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCP 619
            CVFC NNNEP  +  SH V+D   +V CP LR Y CP+C ++GD AHTIKYCP
Sbjct:  300 CVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCP 352          
BLAST of nanos-like protein vs. Ensembl Zebrafish
Match: nanos1 (nanos homolog 1 [Source:NCBI gene;Acc:322903])

HSP 1 Score: 91.2781 bits (225), Expect = 1.039e-21
Identity = 38/69 (55.07%), Postives = 50/69 (72.46%), Query Frame = 2
Query:  437 RKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQ 643
            R +   ++CVFCRNN  P E+Y SH +K  +G+V CP+LR YTCPLC++ GD AHTIKYCP+S +   Q
Sbjct:  143 RNKQEPKICVFCRNNGAPEEVYGSHVLKTPDGRVVCPILRAYTCPLCSANGDNAHTIKYCPLSKDQPAQ 211          
BLAST of nanos-like protein vs. Ensembl Zebrafish
Match: nanos2 (nanos homolog 2 [Source:ZFIN;Acc:ZDB-GENE-130321-1])

HSP 1 Score: 78.9518 bits (193), Expect = 6.285e-18
Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVS 649
            C FCR N E  ++Y SH++K  +G+V CP+LR+Y CPLC++TGD AHT  YCP   N TK+ S
Sbjct:   83 CGFCRQNGETAQIYRSHRLKARDGRVLCPILRSYVCPLCSATGDRAHTRYYCP-RRNITKKNS 144          
BLAST of nanos-like protein vs. Ensembl Zebrafish
Match: nanos3 (nanos homolog 3 [Source:ZFIN;Acc:ZDB-GENE-011221-1])

HSP 1 Score: 70.8626 bits (172), Expect = 9.232e-15
Identity = 27/56 (48.21%), Postives = 38/56 (67.86%), Query Frame = 2
Query:  455 ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            + C FC++N E   +Y SH +K+ +G V CP LR Y CPLC +TG  AHT ++CP+
Sbjct:   90 KFCSFCKHNGETEAVYTSHYLKNRDGDVMCPYLRQYKCPLCGATGAKAHTKRFCPM 145          
BLAST of nanos-like protein vs. Ensembl Xenopus
Match: dag1 (dystroglycan 1 [Source:Xenbase;Acc:XB-GENE-1015769])

HSP 1 Score: 80.4925 bits (197), Expect = 1.386e-18
Identity = 30/54 (55.56%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            C FCR+N E   +Y SH+++  +G+V CPVLR YTCPLC + GD+AHT++YCP+
Sbjct:   61 CGFCRSNREAQSLYSSHRLRAPDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPL 114          
BLAST of nanos-like protein vs. Ensembl Xenopus
Match: NANOS3 (nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:22048])

HSP 1 Score: 77.7962 bits (190), Expect = 3.000e-17
Identity = 37/98 (37.76%), Postives = 52/98 (53.06%), Query Frame = 2
Query:  437 RKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 730
            R E  +  C FC++N E   +Y  H +KD  G+V CP+LRNY C  C +TGD AHT ++CP++      V   +L    RN I +   S+    L I 
Sbjct:   38 RGEESVAGCTFCKHNGESKHIYSKHSLKDKQGRVVCPILRNYVCSQCGATGDTAHTRRFCPLTQKDYCSVYQGTL----RNSIPVSLISLEPQFLYIV 131          
BLAST of nanos-like protein vs. Ensembl Xenopus
Match: ENSXETT00000051581.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:14929187:14937418:1 gene:ENSXETG00000018509.1 transcript:ENSXETT00000051581.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 8.804e-15
Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  455 ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            + C FC++N E   +Y +H +++ NG + CPVLR YTCPLC +TG  +HT KYCP 
Sbjct:  196 KFCKFCKHNGESSRVYSTHTLRNSNGIIICPVLRKYTCPLCGATGALSHTRKYCPF 251          
BLAST of nanos-like protein vs. Ensembl Xenopus
Match: ENSXETT00000051579.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:14928537:14937418:1 gene:ENSXETG00000018509.1 transcript:ENSXETT00000051579.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.135e-14
Identity = 28/56 (50.00%), Postives = 39/56 (69.64%), Query Frame = 2
Query:  455 ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            + C FC++N E   +Y +H +++ NG + CPVLR YTCPLC +TG  +HT KYCP 
Sbjct:  213 KFCKFCKHNGESSRVYSTHTLRNSNGIIICPVLRKYTCPLCGATGALSHTRKYCPF 268          
BLAST of nanos-like protein vs. Ensembl Mouse
Match: Nanos1 (nanos C2HC-type zinc finger 1 [Source:MGI Symbol;Acc:MGI:2669254])

HSP 1 Score: 91.2781 bits (225), Expect = 2.159e-21
Identity = 38/74 (51.35%), Postives = 51/74 (68.92%), Query Frame = 2
Query:  407 LHKLRTSNQIRK-ESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            LH    +   R  +  +++CVFCRNN E   +Y +H +K  +G+V CPVLR YTCPLC ++GD AHTIKYCP+S
Sbjct:  170 LHAASGATAARLLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLS 243          
BLAST of nanos-like protein vs. Ensembl Mouse
Match: Nanos2 (nanos C2HC-type zinc finger 2 [Source:MGI Symbol;Acc:MGI:2676627])

HSP 1 Score: 78.5666 bits (192), Expect = 7.712e-18
Identity = 32/62 (51.61%), Postives = 46/62 (74.19%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQ 643
            +C FC++N E   +Y SH++K   G V CP+LR+Y CPLC +TGD AHT+KYCP  +N+++Q
Sbjct:   60 ICNFCKHNGESRHVYTSHQLKTPEGVVVCPILRHYVCPLCGATGDQAHTLKYCP--LNSSQQ 119          
BLAST of nanos-like protein vs. Ensembl Mouse
Match: Nanos3 (nanos C2HC-type zinc finger 3 [Source:MGI Symbol;Acc:MGI:2675387])

HSP 1 Score: 73.559 bits (179), Expect = 1.332e-15
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  425 SNQIRKESHI---ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQV 646
            S Q  KES      LC FC++N E   +Y SH +KD  G+V CP+LR+Y CP C +T + AHT ++CP++      V
Sbjct:   42 SQQASKESSAAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSV 118          
BLAST of nanos-like protein vs. Ensembl Mouse
Match: Nanos3 (nanos C2HC-type zinc finger 3 [Source:MGI Symbol;Acc:MGI:2675387])

HSP 1 Score: 73.559 bits (179), Expect = 1.389e-15
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  425 SNQIRKESHI---ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQV 646
            S Q  KES      LC FC++N E   +Y SH +KD  G+V CP+LR+Y CP C +T + AHT ++CP++      V
Sbjct:   42 SQQASKESSAAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSV 118          
BLAST of nanos-like protein vs. UniProt/SwissProt
Match: sp|E7FDB3|NANO1_DANRE (Nanos homolog 1 OS=Danio rerio OX=7955 GN=nanos1 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 7.843e-21
Identity = 38/69 (55.07%), Postives = 50/69 (72.46%), Query Frame = 2
Query:  437 RKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQ 643
            R +   ++CVFCRNN  P E+Y SH +K  +G+V CP+LR YTCPLC++ GD AHTIKYCP+S +   Q
Sbjct:  143 RNKQEPKICVFCRNNGAPEEVYGSHVLKTPDGRVVCPILRAYTCPLCSANGDNAHTIKYCPLSKDQPAQ 211          
BLAST of nanos-like protein vs. UniProt/SwissProt
Match: sp|Q80WY3|NANO1_MOUSE (Nanos homolog 1 OS=Mus musculus OX=10090 GN=Nanos1 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.510e-20
Identity = 38/74 (51.35%), Postives = 51/74 (68.92%), Query Frame = 2
Query:  407 LHKLRTSNQIRK-ESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            LH    +   R  +  +++CVFCRNN E   +Y +H +K  +G+V CPVLR YTCPLC ++GD AHTIKYCP+S
Sbjct:  170 LHAASGATAARLLKPELQVCVFCRNNKEAVALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLS 243          
BLAST of nanos-like protein vs. UniProt/SwissProt
Match: sp|Q8WY41|NANO1_HUMAN (Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 4.648e-20
Identity = 35/61 (57.38%), Postives = 47/61 (77.05%), Query Frame = 2
Query:  443 ESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            +  +++CVFCRNN E   +Y +H +K  +G+V CPVLR YTCPLC ++GD AHTIKYCP+S
Sbjct:  208 KPELQVCVFCRNNKEAMALYTTHILKGPDGRVLCPVLRRYTCPLCGASGDNAHTIKYCPLS 268          
BLAST of nanos-like protein vs. UniProt/SwissProt
Match: sp|Q07937|NANO1_XENLA (Nanos homolog 1 OS=Xenopus laevis OX=8355 GN=nanos1 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.348e-19
Identity = 31/54 (57.41%), Postives = 43/54 (79.63%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            C FCR+N E   +Y SH+++ L+G+V CPVLR YTCPLC + GD+AHT++YCP+
Sbjct:   57 CGFCRSNREALSLYTSHRLRALDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPL 110          
BLAST of nanos-like protein vs. UniProt/SwissProt
Match: sp|Q90ZZ5|NANO1_XENBO (Nanos homolog 1 OS=Xenopus borealis OX=8354 GN=nanos1 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.119e-19
Identity = 31/54 (57.41%), Postives = 43/54 (79.63%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPI 622
            C FCR+N E   +Y SH+++ L+G+V CPVLR YTCPLC + GD+AHT++YCP+
Sbjct:   61 CGFCRSNKEAMSLYSSHRLRSLDGRVLCPVLRGYTCPLCGANGDWAHTMRYCPL 114          
BLAST of nanos-like protein vs. TrEMBL
Match: A4UCR6 (Nanos-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 2.015e-156
Identity = 232/233 (99.57%), Postives = 233/233 (100.00%), Query Frame = 2
Query:   32 MRTGESYFVLIHHTLKLNLMLNHPESLKMANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 730
            MRTGESYFVLIHHTLKLNLMLN+PESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA
Sbjct:    1 MRTGESYFVLIHHTLKLNLMLNYPESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 233          
BLAST of nanos-like protein vs. TrEMBL
Match: A5Y5A4 (Nanos-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.093e-141
Identity = 213/214 (99.53%), Postives = 214/214 (100.00%), Query Frame = 2
Query:   89 MLNHPESLKMANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 730
            MLNHPESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACI+PNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA
Sbjct:    1 MLNHPESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACIIPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 214          
BLAST of nanos-like protein vs. TrEMBL
Match: F8WTH7 (Nanos-related protein OS=Dugesia ryukyuensis OX=79738 GN=nanos PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 4.024e-96
Identity = 144/177 (81.36%), Postives = 162/177 (91.53%), Query Frame = 2
Query:  116 MANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQV 646
            M N +P +WQSVTSN +  +S+K+  N  RTNVACILPNLLQK ++KTDF+LL E+D+D++FRSD+KLSKELDRWVALLEAWPE+HITLDRS WLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS N++K +
Sbjct:    1 MTNMNPSLWQSVTSNVMCLNSSKTGSNMSRTNVACILPNLLQKTVSKTDFTLLAEDDHDNVFRSDVKLSKELDRWVALLEAWPERHITLDRSTWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISSNSSKGL 177          
BLAST of nanos-like protein vs. TrEMBL
Match: Q5H7Z0 (Nanos-related protein OS=Dugesia japonica OX=6161 GN=Djnos PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 7.187e-96
Identity = 144/177 (81.36%), Postives = 162/177 (91.53%), Query Frame = 2
Query:  116 MANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQV 646
            M N +P +WQSVTSN +  +S+KS  N  RTNVACILPNLLQK ++KTDF+LL E+D+D++FRSD+KLSKELDRWVALLEAWPE+HITLDRS WLRLLHK+RTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS N++K +
Sbjct:    1 MTNMNPSLWQSVTSNIMCLNSSKSGSNMSRTNVACILPNLLQKTVSKTDFTLLAEDDHDNVFRSDVKLSKELDRWVALLEAWPERHITLDRSTWLRLLHKVRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISSNSSKSL 177          
BLAST of nanos-like protein vs. TrEMBL
Match: A0A068W982 (Nanos protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000861500 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.844e-28
Identity = 53/104 (50.96%), Postives = 76/104 (73.08%), Query Frame = 2
Query:  323 KELDRWVALLEAWPEKHITLDRSIWLRL---LHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            ++++RW  L++ + E+ I +D  +  RL   L +L    +   E++++LCVFCRNNNE FEMY SHKVKD  G+V CPVLR + CPLC++TGD+AHTI+YCP+S
Sbjct:   51 EQINRWRDLIKTYYEQGIPMDNPLLYRLTNFLGQLVPLIRHLSEANMDLCVFCRNNNETFEMYTSHKVKDRAGRVICPVLRRFVCPLCSATGDYAHTIRYCPLS 154          
BLAST of nanos-like protein vs. Ensembl Cavefish
Match: NANOS1 (nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:23044])

HSP 1 Score: 92.0485 bits (227), Expect = 1.909e-22
Identity = 37/71 (52.11%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  431 QIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQ 643
            ++ +++  ++CVFCRNN  P E+Y SH +K   G+V CP+LR YTCPLC++ GD AHTIKYCP+S     Q
Sbjct:   97 RLERDAEPKICVFCRNNGAPEEVYGSHVLKTPEGRVVCPILRAYTCPLCSANGDNAHTIKYCPLSKEQPAQ 167          
BLAST of nanos-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000053799.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:9379857:9381793:1 gene:ENSAMXG00000043091.1 transcript:ENSAMXT00000053799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 1.432e-21
Identity = 37/63 (58.73%), Postives = 46/63 (73.02%), Query Frame = 2
Query:  455 ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQ 643
            ++CVFCRNN  P E+Y SH +K   G+V CP+LR YTCPLC++ GD AHTIKYCP+S     Q
Sbjct:  104 KICVFCRNNGAPEEVYGSHVLKTPEGRVVCPILRAYTCPLCSANGDNAHTIKYCPLSKEQPAQ 166          
BLAST of nanos-like protein vs. Ensembl Cavefish
Match: nanos2 (nanos homolog 2 [Source:ZFIN;Acc:ZDB-GENE-130321-1])

HSP 1 Score: 79.7221 bits (195), Expect = 4.943e-18
Identity = 33/63 (52.38%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVS 649
            C FCR N E  E+Y SH+++  +G+V CPVLR+Y CPLC +TGD AHT  YCP   +T  + S
Sbjct:   96 CAFCRRNGESTEVYRSHRLRRRDGRVMCPVLRSYMCPLCGATGDTAHTRLYCPNRSDTEPRRS 158          
BLAST of nanos-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000056869.1 (nanos homolog 1 [Source:NCBI gene;Acc:103030775])

HSP 1 Score: 71.2478 bits (173), Expect = 6.354e-14
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  461 CVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQV 646
            C FC++N E   +Y SH++KD +G V CP LR Y CP C +TG  AHT ++CP+  +T   V
Sbjct:  250 CSFCKHNGEAESVYTSHRLKDRSGCVICPYLRRYACPQCGATGASAHTRRFCPLVDSTYSSV 311          
BLAST of nanos-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011356.1 (pep scaffold:Pmarinus_7.0:GL477149:1779:2000:1 gene:ENSPMAG00000010329.1 transcript:ENSPMAT00000011356.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.988e-20
Identity = 34/56 (60.71%), Postives = 40/56 (71.43%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPIS 625
            +CVFCRNN E   +Y  H +K  +G+V CP LR YTCPLC   GD AHTIKYCP+S
Sbjct:    5 VCVFCRNNGEAEAVYAGHVLKAPDGRVLCPRLRAYTCPLCGVNGDRAHTIKYCPLS 60          
BLAST of nanos-like protein vs. Ensembl Nematostella
Match: NOS1 (Nanos 1; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q4PLU3])

HSP 1 Score: 88.9669 bits (219), Expect = 1.955e-21
Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 2
Query:  419 RTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTK 640
            R + + +K  +  +CVFCRNN E  ++Y SH +KD  G  TCP+LR YTCPLC ++G  +HTIKYCP + N +K
Sbjct:  138 RKNRENKKNRNANVCVFCRNNGESKKVYSSHVLKDAEGNTTCPILRAYTCPLCKASGSQSHTIKYCPKNKNGSK 211          
BLAST of nanos-like protein vs. Ensembl Nematostella
Match: EDO49152 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH35])

HSP 1 Score: 63.929 bits (154), Expect = 2.828e-12
Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = 2
Query:  455 ELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPL 574
            ++CVFCRNN E  E+Y SH +K  +GK TCP+LR YTCP+
Sbjct:  154 QVCVFCRNNGESEEVYASHVLKSADGKTTCPILRAYTCPI 193          
BLAST of nanos-like protein vs. Ensembl Medaka
Match: nanos1a (nanos1 [Source:NCBI gene;Acc:100144352])

HSP 1 Score: 87.0409 bits (214), Expect = 1.260e-20
Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 2
Query:  437 RKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMN 631
            R +    +CVFCRNN  P E+Y +H +K   G+V CP+LR YTCPLC++ GD AHTIKYCP+S +
Sbjct:  104 RDKPEPRVCVFCRNNGAPEEVYGTHILKTGEGRVLCPILRAYTCPLCSANGDNAHTIKYCPLSRD 168          
BLAST of nanos-like protein vs. Ensembl Medaka
Match: nanos2 (nanos2 protein [Source:NCBI gene;Acc:100301601])

HSP 1 Score: 78.9518 bits (193), Expect = 7.588e-18
Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 2
Query:  446 SHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCP 619
            S  + C FC+ N E  ++Y SH ++  + KVTCP+LRNYTCP+C +TGD AHT KYCP
Sbjct:   81 SPADYCRFCKQNGETRQVYRSHALRSDDRKVTCPILRNYTCPICGATGDRAHTRKYCP 138          
BLAST of nanos-like protein vs. Ensembl Medaka
Match: nanos3 (nanos C2HC-type zinc finger 3 [Source:NCBI gene;Acc:100144282])

HSP 1 Score: 67.3958 bits (163), Expect = 2.714e-13
Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  458 LCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCP 619
            +C FCR+N E   +Y SH +K+  G V CP LR Y CPLC +TG  AHT ++CP
Sbjct:  133 VCSFCRHNGESEMVYRSHWLKNQKGDVLCPYLRQYVCPLCGATGAKAHTKRFCP 186          
BLAST of nanos-like protein vs. Planmine SMEST
Match: SMESG000018169.1 (SMESG000018169.1)

HSP 1 Score: 443.736 bits (1140), Expect = 5.603e-160
Identity = 232/233 (99.57%), Postives = 233/233 (100.00%), Query Frame = 2
Query:   32 MRTGESYFVLIHHTLKLNLMLNHPESLKMANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 730
            MRTGESYFVLIHHTLKLNLMLN+PESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA
Sbjct:    1 MRTGESYFVLIHHTLKLNLMLNYPESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 233          
BLAST of nanos-like protein vs. Planmine SMEST
Match: SMESG000018169.1 (SMESG000018169.1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.163e-153
Identity = 227/233 (97.42%), Postives = 228/233 (97.85%), Query Frame = 2
Query:   32 MRTGESYFVLIHHTLKLNLMLNHPESLKMANTSPFIWQXXXXXXXXXXXXXXXXXYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 730
            MRTGESYFVLIHHTLKLNLMLN+PESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTD     EEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA
Sbjct:    1 MRTGESYFVLIHHTLKLNLMLNYPESLKMANTSPFIWQSVTSNNVSYSSNKSNVNYPRTNVACILPNLLQKNIAKTD-----EEDNDSLFRSDLKLSKELDRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNNNEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMNTTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA 228          
The following BLAST results are available for this feature:
BLAST of nanos-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NANOS12.787e-2260.34nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;... [more]
NANOS19.679e-2157.38nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;... [more]
NANOS22.343e-1751.72nanos C2HC-type zinc finger 2 [Source:NCBI gene;Ac... [more]
NANOS33.580e-1541.77nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;... [more]
NANOS33.580e-1541.77nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nanos-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nos1.541e-1660.38gene:FBgn0002962 transcript:FBtr0083732[more]
nos1.671e-1660.38gene:FBgn0002962 transcript:FBtr0335019[more]
back to top
BLAST of nanos-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nanos11.039e-2155.07nanos homolog 1 [Source:NCBI gene;Acc:322903][more]
nanos26.285e-1853.97nanos homolog 2 [Source:ZFIN;Acc:ZDB-GENE-130321-1... [more]
nanos39.232e-1548.21nanos homolog 3 [Source:ZFIN;Acc:ZDB-GENE-011221-1... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dag11.386e-1855.56dystroglycan 1 [Source:Xenbase;Acc:XB-GENE-1015769... [more]
NANOS33.000e-1737.76nanos C2HC-type zinc finger 3 [Source:HGNC Symbol;... [more]
ENSXETT00000051581.18.804e-1550.00pep primary_assembly:Xenopus_tropicalis_v9.1:1:149... [more]
ENSXETT00000051579.11.135e-1450.00pep primary_assembly:Xenopus_tropicalis_v9.1:1:149... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nanos12.159e-2151.35nanos C2HC-type zinc finger 1 [Source:MGI Symbol;A... [more]
Nanos27.712e-1851.61nanos C2HC-type zinc finger 2 [Source:MGI Symbol;A... [more]
Nanos31.332e-1542.86nanos C2HC-type zinc finger 3 [Source:MGI Symbol;A... [more]
Nanos31.389e-1542.86nanos C2HC-type zinc finger 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of nanos-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7FDB3|NANO1_DANRE7.843e-2155.07Nanos homolog 1 OS=Danio rerio OX=7955 GN=nanos1 P... [more]
sp|Q80WY3|NANO1_MOUSE1.510e-2051.35Nanos homolog 1 OS=Mus musculus OX=10090 GN=Nanos1... [more]
sp|Q8WY41|NANO1_HUMAN4.648e-2057.38Nanos homolog 1 OS=Homo sapiens OX=9606 GN=NANOS1 ... [more]
sp|Q07937|NANO1_XENLA1.348e-1957.41Nanos homolog 1 OS=Xenopus laevis OX=8355 GN=nanos... [more]
sp|Q90ZZ5|NANO1_XENBO3.119e-1957.41Nanos homolog 1 OS=Xenopus borealis OX=8354 GN=nan... [more]
back to top
BLAST of nanos-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4UCR62.015e-15699.57Nanos-like protein OS=Schmidtea mediterranea OX=79... [more]
A5Y5A42.093e-14199.53Nanos-like protein OS=Schmidtea mediterranea OX=79... [more]
F8WTH74.024e-9681.36Nanos-related protein OS=Dugesia ryukyuensis OX=79... [more]
Q5H7Z07.187e-9681.36Nanos-related protein OS=Dugesia japonica OX=6161 ... [more]
A0A068W9821.844e-2850.96Nanos protein OS=Echinococcus granulosus OX=6210 G... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NANOS11.909e-2252.11nanos C2HC-type zinc finger 1 [Source:HGNC Symbol;... [more]
ENSAMXT00000053799.11.432e-2158.73pep primary_assembly:Astyanax_mexicanus-2.0:24:937... [more]
nanos24.943e-1852.38nanos homolog 2 [Source:ZFIN;Acc:ZDB-GENE-130321-1... [more]
ENSAMXT00000056869.16.354e-1446.77nanos homolog 1 [Source:NCBI gene;Acc:103030775][more]
back to top
BLAST of nanos-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000011356.11.988e-2060.71pep scaffold:Pmarinus_7.0:GL477149:1779:2000:1 gen... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nanos-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
NOS11.955e-2150.00Nanos 1; Predicted protein [Source:UniProtKB/TrEM... [more]
EDO491522.828e-1260.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nanos-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nanos1a1.260e-2055.38nanos1 [Source:NCBI gene;Acc:100144352][more]
nanos27.588e-1855.17nanos2 protein [Source:NCBI gene;Acc:100301601][more]
nanos32.714e-1351.85nanos C2HC-type zinc finger 3 [Source:NCBI gene;Ac... [more]
back to top
BLAST of nanos-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000018169.15.603e-16099.57SMESG000018169.1[more]
SMESG000018169.11.163e-15397.42SMESG000018169.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034750
GenBankABO52809.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034750 ID=SMED30034750|Name=nanos-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=791bp
CAATTTTATAATTTGAATTGGTTTTTTTCTCATGCGCACAGGCGAATCAT
ATTTCGTTTTAATTCATCACACACTAAAGCTTAATTTAATGTTAAATCAT
CCTGAATCATTGAAGATGGCTAATACGTCTCCATTTATTTGGCAATCAGT
GACATCTAACAATGTGTCTTATAGTAGCAATAAATCCAATGTTAATTATC
CAAGGACAAATGTTGCCTGTATATTACCGAATTTATTGCAAAAAAATATT
GCAAAGACAGATTTTTCACTGTTAGATGAAGAAGATAATGACAGTTTATT
TCGCAGCGATTTAAAATTATCAAAGGAGTTGGATCGATGGGTTGCATTGT
TGGAAGCATGGCCTGAAAAGCATATTACTCTGGATAGAAGTATATGGCTA
AGGTTATTGCACAAACTTAGAACATCTAATCAAATTCGCAAAGAAAGTCA
TATTGAACTATGTGTCTTCTGTAGGAATAACAATGAACCTTTTGAAATGT
ATGTTAGTCATAAAGTTAAAGACCTAAATGGTAAGGTTACATGTCCAGTT
CTACGTAATTATACATGCCCATTGTGTAACAGTACAGGTGACTTTGCTCA
TACAATCAAATATTGTCCCATTTCTATGAATACAACAAAACAAGTGTCAG
ATAATTCTTTGGAAGAAATTACAAGAAATCAAATTGCTATTAAATCAAGA
AGCATGTCACAATCCACTCTTGGTATAGCTTAAAGGAAGAAATTGTTAAA
TGTTTTAAGGCTTATGAATCAATGTTATATGATTGTCAATG
back to top

protein sequence of SMED30034750-orf-1

>SMED30034750-orf-1 ID=SMED30034750-orf-1|Name=SMED30034750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MRTGESYFVLIHHTLKLNLMLNHPESLKMANTSPFIWQSVTSNNVSYSSN
KSNVNYPRTNVACILPNLLQKNIAKTDFSLLDEEDNDSLFRSDLKLSKEL
DRWVALLEAWPEKHITLDRSIWLRLLHKLRTSNQIRKESHIELCVFCRNN
NEPFEMYVSHKVKDLNGKVTCPVLRNYTCPLCNSTGDFAHTIKYCPISMN
TTKQVSDNSLEEITRNQIAIKSRSMSQSTLGIA*
back to top
Aliases
The feature 'nanos-like protein' has the following synonyms
Synonym
nos
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0000239oogonial cell
PLANA:0000419prepharyngeal region
PLANA:0000429neoblast
PLANA:0002030early male germ cell
PLANA:0002109X1 cell
PLANA:0003301eye primordium
PLANA:0003304testis primordium
PLANA:0003305gonad primoridium
Vocabulary: INTERPRO
TermDefinition
IPR038129Nanos_sf
IPR008705Nanos/Xcar2
IPR024161Znf_nanos-typ
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0008270zinc ion binding
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038129Nanos domain superfamilyGENE3DG3DSA:1.10.150.680coord: 141..210
e-value: 2.7E-28
score: 99.7
IPR024161Zinc finger, nanos-typePFAMPF05741zf-nanoscoord: 144..196
e-value: 1.9E-24
score: 85.6
IPR024161Zinc finger, nanos-typePROSITEPS51522ZF_NANOScoord: 143..197
score: 23.867
IPR008705Nanos/Xcat2PANTHERPTHR12887NANOS PROTEINcoord: 138..211