Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30034737
Length (bp)3701
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30034737) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30034737) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30034737) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30034737) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034737

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynx progenitor cellSMED30034737SMESG000005378.1 SMED30034737smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034737SMESG000005378.1 dd_Smed_v4_10467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034737SMESG000005378.1 dd_Smed_v6_10467_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30034737SMESG000005378.1 Contig35337newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30034737SMESG000005378.1 Contig35337uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 231.876 bits (590), Expect = 1.236e-61
Identity = 213/787 (27.06%), Postives = 360/787 (45.74%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQQK--------DNDCSHIVIISFGS-FIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ++ E +P ++ + +L A     F +  H + +  G   LR    ++  TG +    +S+DRE L  CQ +        + + S   ++  GS  + E    + D+ND  P FA   I L+I E+  IG +  +P+ASD D+   G+ASY+++             ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E       +  +KA D+D     N+++++    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+S+ E    EN+     I  ++A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  +++ + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:   63 KVPEEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLR----VDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ--------AGPEAQELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENAQVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL--LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 797          

HSP 2 Score: 162.54 bits (410), Expect = 9.580e-40
Identity = 159/602 (26.41%), Postives = 255/602 (42.36%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG----LIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +IE  F     +  R     + + +           + V   +DRE      F+++A D  T  K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G +   Q++T    S DRE+ + Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG     + A D D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQG----ANAEIEYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLE-------PEPAAKGLFTIS--PETGEI---QVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSN----TSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 814          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 231.876 bits (590), Expect = 2.221e-61
Identity = 214/787 (27.19%), Postives = 361/787 (45.87%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQQK--DNDC------SHIVIISFGS-FIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ++ E +P ++ + +L A     F +  H + +  G   LR    ++  TG +    +S+DRE L  CQ +   + C      S   ++  GS  + E    + D+ND  P FA   I L+I E+  IG +  +P+ASD D+   G+ASY+++             ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E +     +  +KA D+D     N+++++    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+S+ E    EN+     I  ++A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  +++ + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:   63 KVPEEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLR----VDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ--------AGPEAQELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENAQVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL--LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 797          

HSP 2 Score: 162.54 bits (410), Expect = 1.265e-39
Identity = 159/602 (26.41%), Postives = 255/602 (42.36%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG----LIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +IE  F     +  R     + + +           + V   +DRE      F+++A D  T  K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G +   Q++T    S DRE+ + Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG     + A D D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQG----ANAEIEYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLE-------PEPAAKGLFTIS--PETGEI---QVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSN----TSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 814          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.001 bits (541), Expect = 2.735e-55
Identity = 222/799 (27.78%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
             C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NAKI Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   15 ACVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.001 bits (541), Expect = 2.850e-55
Identity = 222/799 (27.78%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
             C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NAKI Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   15 ACVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 211.846 bits (538), Expect = 3.137e-55
Identity = 222/798 (27.82%), Postives = 360/798 (45.11%), Query Frame = 1
Query:  259 CLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
            C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NAKI Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   16 CVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 152.525 bits (384), Expect = 8.665e-37
Identity = 169/622 (27.17%), Postives = 274/622 (44.05%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY------GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI-GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLA 2403
            LT  +ID+ND  PT    +  +++ E+V IG  +    A D DS   GI  Y +E         +E F        I D +  +I    K  K +DRET  +YS  + A D  T        I + +KDINDN+P +    Y +T+ +E     +I +LKA D D+    + K+ ++I+ A   +    S +       ++ + G LK   + K+ V +   D GGLQ    + + I D N +AP  +    S KI E+      +  L  +D D   N      ++ + +  +              P  G + +       +   DRE    +SV++   D  SP L +S Q  VI+ D NDNSP FT S Y   I E+  VG+S +  VSA D D   N  + Y L+E  +   SI ++      G +    K DREQ ++    + A D G PS S+ + I + + D ND  P F +  Y+  I E   N  V + +G I A D D  +N  + + I G     + + + +  +   V+I    +       D E ++  +   +    G+  LS+++ V + ++D+ND+KP           F N+    + G++ A
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG--------SEDF--------IIDEDSGLI----KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEEA---DREVFSILDIGDQGAILSVSGELK-RQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID-------------PSSGDISV-------SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNE-SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAE---NSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF------DYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPA 1024          

HSP 2 Score: 149.058 bits (375), Expect = 9.236e-36
Identity = 183/742 (24.66%), Postives = 308/742 (41.51%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI-ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMK---LVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGL----IEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE 2496
            EL E+ PI + + ++KA    A  +  +  ++   + R +NL  L+ ++G + L  S+DRE L +      ++  +    S    +   ++D+ D  P F K      I ED PIG  +    A DLDS + G   Y + E   K+                   L +      ++    +DRET       ++A D  T  +     + + + D+NDN+P +    Y +T+ E  T    I ++KA D D   N            K+  S   S  +   + +    E  L+   + K   +   ++  DG    L +T  LTI++ D ND+AP +    +   ++EN    E +  +   DED   N      +  +    + E               G++          K  DRE    YS+ +   D G+P L +S   +V++ D NDN+P F K  Y   I E     S+I ++ A D D  E+ KI Y ++E     FSI      G I +     + Q       + A+D G        ++ +   D  +  P F   + F++      +  H+ +G     ++A D D  +N  + Y I ++  +  +P              +G +S+   +DRE+++T  + V A DH  PPL+ S  + V L+D+ND+ P FT  S A+     IS +   G    ++ A D D   NG V + L  NES S  +I+
Sbjct:  173 ELPEDTPIETIIASVKAS--HASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL------------------LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTN-----------GKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-------------DSGLI-------KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYF-NDHPFSV-----KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDP-------------SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFL--NESSSSPSIQ 833          

HSP 3 Score: 142.124 bits (357), Expect = 1.178e-33
Identity = 110/350 (31.43%), Postives = 172/350 (49.14%), Query Frame = 1
Query: 1537 KSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI-GNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVR 2577
            KS DRE +D + + +   ++  P +++S    V VLD  DNSPIF K  Y  EI E++   + + SV A D DS EN +I+YSL E  G    +IN   GVI T    DRE  SL    VIASD G P R STA + + V+D ND  P+F    Y   I+E   N+ +   +  ++A DED   NG V Y + ++S               +  +  G+++L   ID  + S I   + A+D  +P LS+++ +T+ + D+NDH P       A+   + +      G  + ++ A D+D   NG + + + G+E      I++D  +I    +  R      S ++  R
Sbjct:  226 KSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILE---NITIPAVIATVKATDEDFGTNGKVHYSMASSS---------GIGGLTIDYS-TGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI----AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF---IIDEDSGLIKTTKLLDRETTARYSLKVTAR 554          

HSP 4 Score: 135.191 bits (339), Expect = 1.867e-31
Identity = 115/453 (25.39%), Postives = 197/453 (43.49%), Query Frame = 1
Query: 1243 LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE---IGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVI-LKESIKSRSHRITQSDRILVRASDQ 2589
            +  +T + + + D  DN+P+    S   +I+E+      +  +  +D D   N E    L +    +L  + ++S   +   P                  DRE +    + +I  DKG+P+  S+    + V+D NDN+P+F    Y   I+EN    + I +V A D+D   N K+ YS+     IG +    +  G +  +E+ D  + S     + A D  +P+ SST  + + V+D ND  P      +   +E   N+A+   +G + A DED   NG++ Y +  +  ++ + D+   K  K+             +DRE  +   + V ARD G P L+ S T+ V L D+ND+ P F          V IS E   G  +  L A D D     +   E    E  S + I   G ++ +   +K + H++    R+ + A+DQ
Sbjct:  250 ISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAP-----------------LDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYST-GEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE--NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL-------------LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF----DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV----RVEISATDQ 660          

HSP 5 Score: 133.265 bits (334), Expect = 7.297e-31
Identity = 176/748 (23.53%), Postives = 316/748 (42.25%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLI----IDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKR----GHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLDFKIDT-AKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKEN-KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDG 2505
            E++E+ PI + ++++ A+   + +  +  + +  GN +  NL+ +N  +G +   + +DRE L   + +    ++    G+   E T ++    +D+ND  P FA     ++ILE++ I  VI    A+D D    G   Y + +                  S I  L +     ++ + ++ID +       T V    +G +      V + +N+ DIND++P  I     IT++E      E+  + A D D   N      +    DF ID  + L  + KL                  +  A   L V  + +    L  +T + + +KD NDNAP       +  I E   R  +I+T+  V +++            D    +  E   R + +  +   +G ++    E        R       V I   D+G  Q    +    + +D+ +++P F    +  +I E+S     + ++ A D D  +NA+I YS+D   + +F I+   G I      DRE ++ ++  V ASD+  P  +++  I V + D ND  P F    Y   I E   ++ V  +   + A D D+  NG+V Y +  +S       +   + F++  T +G L +   +DRE+ + I + + ARD G P LS +  +T+TL+D+ND+ P F   S      + I+     G  +  + A D D   N  + F + G        IE+D 
Sbjct:  278 EIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGK--NLLAINAKSGVIQTAAPLDRETLSLIRLD----VIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-----------------SGIGGLTIDYSTGEVTLRERIDAKNS---PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDR---------------ETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE------------DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVR-------VEISATDQGGLQ---GRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE---DIPVGTSFLQVSAIDADIGPNGIVDYFLNESS------SSPSIQLFRLDRT-SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD----LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 946          

HSP 6 Score: 107.842 bits (268), Expect = 4.034e-23
Identity = 151/625 (24.16%), Postives = 261/625 (41.76%), Query Frame = 1
Query:  616 FAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDF----YSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGK-LSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            F +++    + ED PI  +I    AS   SQ           Y+        R ++ F   ++          ++++ K +DRE  +K+   + A +           +V+++ D+ DNSP +    Y   ++E       + S+ A D D   N   ++++ +     GN + L  I   S           + ++ ++L V          ++T  + I++ D NDNAP+ +  S +  I EN     ++  +   DED   N +          +H     S  +         G+ I Y   T E     RE++D      + +I   D   P L+S+   ++ V+D ND++P    +     + EN     E+G V A D+DS  N  IKYS++  G+  F I+   G+I T +  DRE  + Y+  V A D G PS +++ +I V + D ND  P F +K+Y   I E    M   + +  ++A D D D+   + Y I          +A++     + I   G  LS+ G + R++   + +++ A D G   L     V V ++D+N        P S     V I      GY +  L AED D   N  +V+ +
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKASHASSQPL---------YYSMVAPQDSRSQNLFTLDTMSG--------EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGEN--GEIEYSLGE---GNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGK----------VHYSMASSSGIG--------GLTIDYS--TGEVTL--RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISE---EMPRGSQIITLKAVDNDEDQK--ITYRI---------EEADREVFSILDIGDQGAILSVSGELKRQDHK-VRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFS-----VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI 721          

HSP 7 Score: 101.293 bits (251), Expect = 3.765e-21
Identity = 132/526 (25.10%), Postives = 237/526 (45.06%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIG-HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECT-TSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKR--GMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-----DEIGNIYFSINMYGV--IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIV-ESYGNMAVHNNLGLIEANDED--------LDENGLV 2091
            +  ++ D+ND  PTF K+E  ++I E++P G  +I L    + + QK    +Y+IE          E   + F    I D     I      +K+ D + R + S    A D  G +G   + + I D+N ++P +   P+ + + E +     + +LKA D D  +N  +++ + ID+++        RI   S +  +  +   +  A   ++V         L  +T + + + D NDN+P  + +S +A I E+         ++  D D+  N      LN++         S S S +  R  R  G + +       +   DRE+     + I   D+G+P L+++ + ++ + D NDN+P F +  Y+  I ENS   S +G++ A D D  +NA I + +      ++ +I       GV  I T+ +FD E K+   F  + + +G+   SST  + + V D ND KP  +   +F I+   + N+ +   +G I A D D        L+EN L+
Sbjct:  567 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKI---TYRIE----------EADREVFSILDIGD--QGAILSVSGELKRQDHKVRVEIS----ATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN--ARIVYSIDSSQF------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNES---------SSSPSIQLFRLDRTSGTLRV-------SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALK---DFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLEENDLI 1043          

HSP 8 Score: 98.2117 bits (243), Expect = 3.682e-20
Identity = 93/327 (28.44%), Postives = 150/327 (45.87%), Query Frame = 1
Query: 1657 NSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL----DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSF-VNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE-KDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEV 2616
            N+  F +  Y  E+ E++   + I SV A    SQ    + YS+    D      F+++ M G I   +  DRE    +   V A +  +P+ S++ +++V VLD  D  PIF K   F   E   +  +   +  + A D D  ENG + Y +G  +           K       K+G +     +DRE  S I +DVIA D G P   ++  V +T+ D+ND+ PVF     AS S+ V I        ++A + A D+D+  NG V + +  +  +  +TI+   G V L+E I +++  IT     ++RA D  +    S V
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQ---PLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFG--EIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGN----------GKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVF-----ASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITA----VIRAKDGAQPALSSTV 463          

HSP 9 Score: 52.7582 bits (125), Expect = 2.296e-6
Identity = 63/273 (23.08%), Postives = 109/273 (39.93%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKI 1098
            F +++ E+ PI   +I LKA+       A+  + I S         +++  +G + + S +DRE+         +  VI++             ++  ++ D+ND  P F       +I ED+P+G       A D D    GI  Y +     S  I   R +                   L+V  K+DRE        + A D  T        I L + D+NDN+P +  L Y + + E       + ++ A DAD+ +  N+ + F+I
Sbjct:  687 FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-----FFRIDPSSGDISVSSDLDRED-------RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR--------------TSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD--NADISFRI 931          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 151.754 bits (382), Expect = 1.261e-36
Identity = 169/622 (27.17%), Postives = 274/622 (44.05%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY------GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI-GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLA 2403
            LT  +ID+ND  PT    +  +++ E+V IG  +    A D DS   GI  Y +E         +E F        I D +  +I    K  K +DRET  +YS  + A D  T        I + +KDINDN+P +    Y +T+ +E     +I +LKA D D+    + K+ ++I+ A   +    S +       ++ + G LK   + K+ V +   D GGLQ    + + I D N +AP  +    S KI E+      +  L  +D D   N      ++ + +  +              P  G + +       +   DRE    +SV++   D  SP L +S Q  VI+ D NDNSP FT S Y   I E+  VG+S +  VSA D D   N  + Y L+E  +   SI ++      G +    K DREQ ++    + A D G PS S+ + I + + D ND  P F +  Y+  I E   N  V + +G I A D D  +N  + + I G     + + + +  +   V+I    +       D E ++  +   +    G+  LS+++ V + ++D+ND+KP           F N+    + G++ A
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG--------SEDF--------IIDEDSGLI----KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE----DQKITYRIEEA---DREVFSILDIGDQGAILSVSGELK-RQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRID-------------PSSGDISV-------SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNE-SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAE---NSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEF------DYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPA 665          

HSP 2 Score: 122.865 bits (307), Expect = 8.913e-28
Identity = 158/655 (24.12%), Postives = 271/655 (41.37%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKR----GHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLDFKIDT-AKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKEN-KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDG 2505
            ++D+ND  P FA     ++ILE++ I  VI    A+D D    G   Y + +                  S I  L +     ++ + ++ID +       T V    +G +      V + +N+ DIND++P  I     IT++E      E+  + A D D   N      +    DF ID  + L  + KL                  +  A   L V  + +    L  +T + + +KD NDNAP       +  I E   R  +I+T+  V +++            D    +  E   R + +  +   +G ++    E        R       V I   D+G  Q    +    + +D+ +++P F    +  +I E+S     + ++ A D D  +NA+I YS+D   + +F I+   G I      DRE ++ ++  V ASD+  P  +++  I V + D ND  P F    Y   I E   ++ V  +   + A D D+  NG+V Y +  +S       +   + F++  T +G L +   +DRE+ + I + + ARD G P LS +  +T+TL+D+ND+ P F   S      + I+     G  +  + A D D   N  + F + G        IE+D 
Sbjct:    6 VVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-----------------SGIGGLTIDYSTGEVTLRERIDAKNS---PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDR---------------ETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE------------DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVR-------VEISATDQGGLQ---GRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISE---DIPVGTSFLQVSAIDADIGPNGIVDYFLNESS------SSPSIQLFRLDRT-SGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYD----LYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDA 587          

HSP 3 Score: 117.472 bits (293), Expect = 4.226e-26
Identity = 135/532 (25.38%), Postives = 224/532 (42.11%), Query Frame = 1
Query:  940 LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMK---LVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG----LIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE 2496
            + + D+NDN+P +    Y +T+ E  T    I ++KA D D   N            K+  S   S  +   + +    E  L+   + K   +   ++  DG    L +T  LTI++ D ND+AP +    +   ++EN    E +  +   DED   N      +  +    + E               G++          K  DRE    YS+ +   D G+P L +S   +V++ D NDN+P F K  Y   I E     S+I ++ A D D  E+ KI Y ++E     FSI      G I +     + Q       + A+D G        ++ +   D  +  P F   + F++      +  H+ +G     ++A D D  +N  + Y I ++  +  +P +             G +S+   +DRE+++T  + V A DH  PPL+ S  + V L+D+ND+ P FT  S A+     IS +   G    ++ A D D   NG V + L  NES S  +I+
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTN-----------GKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDE-------------DSGLI-------KTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFI---DDVNSAPYF-NDHPFSV-----KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSS-------------GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFL--NESSSSPSIQ 474          

HSP 4 Score: 112.464 bits (280), Expect = 1.500e-24
Identity = 90/323 (27.86%), Postives = 147/323 (45.51%), Query Frame = 1
Query: 1633 VIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE---IGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVI-LKESIKSRSHRITQSDRILVRASDQ 2589
            + V+D NDN+P+F    Y   I+EN    + I +V A D+D   N K+ YS+     IG +    +  G +  +E+ D  + S     + A D  +P+ SST  + + V+D ND  P      +   +E   N+A+   +G + A DED   NG++ Y +  +  ++ + D+   K  K             ++DRE  +   + V ARD G P L+ S T+ V L D+ND+ P F          V IS E   G  +  L A D D     +   E    E  S + I   G ++ +   +K + H++    R+ + A+DQ
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYST-GEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEE--NVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTK-------------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF----DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKV----RVEISATDQ 301          

HSP 5 Score: 100.523 bits (249), Expect = 6.417e-21
Identity = 132/526 (25.10%), Postives = 237/526 (45.06%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIG-HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECT-TSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKR--GMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-----DEIGNIYFSINMYGV--IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIV-ESYGNMAVHNNLGLIEANDED--------LDENGLV 2091
            +  ++ D+ND  PTF K+E  ++I E++P G  +I L    + + QK    +Y+IE          E   + F    I D     I      +K+ D + R + S    A D  G +G   + + I D+N ++P +   P+ + + E +     + +LKA D D  +N  +++ + ID+++        RI   S +  +  +   +  A   ++V         L  +T + + + D NDN+P  + +S +A I E+         ++  D D+  N      LN++         S S S +  R  R  G + +       +   DRE+     + I   D+G+P L+++ + ++ + D NDN+P F +  Y+  I ENS   S +G++ A D D  +NA I + +      ++ +I       GV  I T+ +FD E K+   F  + + +G+   SST  + + V D ND KP  +   +F I+   + N+ +   +G I A D D        L+EN L+
Sbjct:  208 IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKI---TYRIE----------EADREVFSILDIGD--QGAILSVSGELKRQDHKVRVEIS----ATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN--ARIVYSIDSSQF------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNES---------SSSPSIQLFRLDRTSGTLRV-------SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALK---DFVILMNRFDNVQMARQIGFIPAFDPDQNATLEYFLEENDLI 684          

HSP 6 Score: 52.7582 bits (125), Expect = 2.362e-6
Identity = 63/273 (23.08%), Postives = 110/273 (40.29%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKI 1098
            F +++ E+ PI   +I LKA+       A+  + I S         +++  +G + + S +DRE+         +  VI++             ++  ++ D+ND  P F       +I ED+P+G       A D D    GI  Y +     S               SI+   +      L+V  K+DRE        + A D  T        I L + D+NDN+P +  L Y + + E       + ++ A DAD+ +  N+ + F+I
Sbjct:  328 FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-----FFRIDPSSGDISVSSDLDRED-------RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSS--------------PSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGD--NADISFRI 572          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 117.857 bits (294), Expect = 2.955e-26
Identity = 163/674 (24.18%), Postives = 270/674 (40.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFEL-TFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH--VNIVLNIKDINDNSPQWIGLPYKITVKE-----------CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE-----FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKP 2265
            +L+++E+ E+ PI + L+ + A         + R+ + + +  L     ++ ++G++ +  + D E   +QK    + I   +       L +  + D+ND  P F   E  L++ E       + +  ASD+DS  +G  SY I               +   FS         I P    +       R ++   + A D  G+      NI + + D +  +PQ+    Y+I   E              S+  +S+ + D D   +I+       DT K+  +R                   L       +++ ++     G  N T + I I+D NDN P  S +     I+E+ +  E   ++   D+D + N E      S H   +  +   +  +  LST       G ++ Y+   N            Y + +   D G P  +S+    + VLD NDN+P F KS Y  E++ENS   + +G V A DKDS EN +I Y +   G+ YF I+   G ++TK   DRE  S  + +++A D G P RSSTAS  + VLD ND  P          +       +   +G I A D D   NG V Y     S             F V+   NG + L   ++  ++    + VI  D G P
Sbjct:  543 ALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHL----TVDTMSGTVCIQKTFDFE---KQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-------------LSESSSFS---------INPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFSIDE------DTGKIYVTR------------------YLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEI---DQFTGQLST-------GSLLDYEATRN------------YKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN-GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP---SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSL-----------FVVK--SNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 2 Score: 98.2117 bits (243), Expect = 3.729e-20
Identity = 117/458 (25.55%), Postives = 199/458 (43.45%), Query Frame = 1
Query: 1210 VVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEI---GNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLS-------------LYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESI 2529
            +V +KV + G    T D+ + + D NDNAP  +      +I E  +      + TV D D     +F  H       ++  V   +    NE+ +  +V+        N   DRE  D Y +LI   D G P      + S+ ++D NDN+P+F++S Y   +  N S+GS  I +V A D D  EN++I Y + +     N  F+I+  GVI T         S ++  V+ASD+G PS SS+A + + VL      P                    + + L+E+N   L EN  +   +   S       A++ +  K+++  +  L              L G++DRE  S  ++  +    G+  + +   +T+   D+ND+ P +        S ++IS     G     L A+D D   NG + + ++  E    V+I+K+ GR+ +  +I
Sbjct:   94 IVAVKVEESG---ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGD---GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVV--------NGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLI-TVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPL------------------DIIWLVESNSAHLMENSTLGSIVARVS------IAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTI--GDINDNAPQW------HSSQIHISLNRTQGG-SRTLTAKDPDLGQNGWIRYSVLDTEL---VSIDKETGRIFVPNTI 498          

HSP 3 Score: 97.4413 bits (241), Expect = 6.241e-20
Identity = 134/575 (23.30%), Postives = 241/575 (41.91%), Query Frame = 1
Query:  853 KIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQW-IGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLD-ENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPY---VNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLS--NSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRI 2550
            ++DRE  E+YS  ++   + G++    + + + ++NDN P + +  P ++  +       + ++ A D D+     + L + + +   G +     I   +    +      + + E  L +  K  DG      T+LTI + D NDNAP  S            + L   T+        +   +   H  D        +   S S     P+ G + +  +     +         Y V +   D G P  ++S   SVI+ + E  + P F K+ + FE+MENS    +IG++S      +E+ +  Y + D   +  FSI+ +G +F     DREQ++ + F V   +    S+       V VLD+ND  P+F    Y  ++ +S   MA    +G I A+D+D  ENG V Y I + +       NPD   T   ++    + +L      D    +T  I V ARDHG P  +    + V++ ++  +   P F  P       V++  +   G +L K+ A ++    N  +++ L  ++    + + K G + LK  +   S  I
Sbjct: 1887 ELDREILERYSLKVIGTGS-GQQIGTRVDVRVNNLNDNVPSFPMSKPRRVP-ENLRVGSYVATVGAKDVDNL----APLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTI--KATDGS-FDTFTNLTIFVSDINDNAPTFS------------KPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGER---------YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSG-----EESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDS---MAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPD---TGSIQLNEWNDAQL------DEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYE----VHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV-KTGELTLKTHLDWESEPI 2409          

HSP 4 Score: 88.1965 bits (217), Expect = 3.472e-17
Identity = 112/435 (25.75%), Postives = 194/435 (44.60%), Query Frame = 1
Query: 1249 NTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL---DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIAS-DNGEPSRSSTASILVKVLDQNDCKPIFRKQY-EFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITK-NGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GNESLSPVTIEKDGRVILKESI 2529
            +T+ ++I +KD NDN P+         ++E  +  E L +++  D D     E S H+       L E  S S++     P  G V          K   R +   + +++   D G     +S    + V+D++  +P F++S YE    E+ +    IGSV A        +K+KYS+   D+  N  FSI+   G I+     D +        + A+  +GE   S+   +++ + D ND  P F     E +I E   ++ +H    +++A+D+D  +NG V Y I ++ P  +           ++I +  G+LS   ++D E      + V A D G PP S+++T+ + + D+ND+ P F      S   + +        ++ K+ A DKD   NG +V+ +  G+E       EK G V  K SI
Sbjct:  623 STSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-------LSESSSFSIN-----PVTGEVF-------AQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGA-------MSKVKYSIYSGDQDHN--FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPPQFSSSLVEISIRE---DLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSS-----------IEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF----EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFG--IDEKLGNVYTKRSI 1003          

HSP 5 Score: 80.1073 bits (196), Expect = 9.402e-15
Identity = 157/690 (22.75%), Postives = 279/690 (40.43%), Query Frame = 1
Query:  592 DMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISIT----SRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSL-STKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGS-----PQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE---SLSPVTIEKDGRVILKESI-KSRSHRITQSDRILVRASDQCENCH 2604
            D ND  P+FA Q ++L I E   +G    LP  +D D  K+ +  +          I+     + FK +S K  E   +Q  L V  ++DRE R+KY   + A D     K G +   + I D NDN+P +    Y  +V    +    + +++A DAD   N     D K  T+   NS        IS + +I    +L   +   ++V         L ++  +TI++     ++P + I     S SA + EN     I+  +++  +             DT    L+ + S +L   + ++    ++++  I        DRE    + +  +    G      PQL       + + D NDN+P +  S     +     GS    +++A D D  +N  I+YS+  +     SI+   G IF     D    S   F V A D G P+ S+   ++  +LD     P F K  ++  I E   +  +   L  + AN+     +  + Y +        N D   T       T +G + +    D E+Q +    VIA +      +++  +++ L D+ND+ P+F +P+      + +    +    L  + A D D    G V + ++      S++PVT    G V  ++ + + R H +  +     ++S+   N H
Sbjct:  114 DENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFV---------ILQGNVNNVFKLASRKVNEQ--LQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK-KTSAPSNSN-----FAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ-----------YRDT---KLRLIGSSALCPQQTDQAHVYLLLLCGI-------LDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAPQWHSSQIHISLNRTQGGSR---TLTAKDPDLGQNGWIRYSV--LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPE---DTPIGTCLVKVVANNSQCGNSKRIRYSL-------QNQDEHLTVD-----TMSGTVCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIF-YPNEY---HLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVT----GEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIH 728          

HSP 6 Score: 69.3218 bits (168), Expect = 1.811e-11
Identity = 90/346 (26.01%), Postives = 139/346 (40.17%), Query Frame = 1
Query: 1267 ISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI-GATSPYVNNPDAEKTKRFKVQITKNGKLSLY------GVIDREEQSTIYIDVIARDHGKPPLSNS 2280
            ++I D NDNAP     S    I  N RT      LT KD DL  N      + DT  + + +   R           G  I +++                       D GSP L++  Q    +LD     P F K++++ EI E++   + +  V A +     + +I+YSL           M G +  ++ FD E++  Y  TVIA++    S +ST+ I +++ D ND  PIF   +Y   + E          L ++ A+D D    G V Y I   +S +  NP   +   F  +    G+  L       G    E  + I+I VI +D   P  S S
Sbjct:  429 LTIGDINDNAP--QWHSSQIHISLN-RTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAE--------------------DGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIFYPNEYHLTVRE---GPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEV--FAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRS 744          

HSP 7 Score: 67.3958 bits (163), Expect = 8.616e-11
Identity = 77/315 (24.44%), Postives = 144/315 (45.71%), Query Frame = 1
Query: 1633 VIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM---YGVI----FTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILV--KVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDE-DLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQI-TKNGKLSLYGVIDREEQSTIYIDVIARD-HGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSR 2538
            VIVLDENDN P+FT   Y   + ++     +IG + A D+DS EN ++ Y +   GN    + +    G I    +   + D    + +   V A D+G P+R++   + V  K+   +   P F    YE +++E   + +V   L  I A++   +  +GL++              + K  + K+ I  K G+L+L   +D E +  I + +   D +G+   S  + + + +  +++  PVFT     S   + I      G  + ++ A D+D  ++G V + +   +S   +  E  G + L++ + SR
Sbjct: 2218 VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILS-GNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLE---DTSVGTVLQKIRASNRLGMRNDGLLY--------------SLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGR---SAVVPLKIVVEPVDEFAPVFT----KSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIE-EHTGIIRLQKPLVSR 2506          

HSP 8 Score: 57.7658 bits (138), Expect = 6.168e-8
Identity = 95/419 (22.67%), Postives = 181/419 (43.20%), Query Frame = 1
Query: 1225 VVDGGGLQNTTDLTISIKDCNDNAPLISITSRSA-KIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAP--DKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKV-QITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNIS-SEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            + DGG   ++  + +++ D NDN P +  ++ S  +I E+ R  ++L      D D+  N +FS            E++  S  + +  P+ G +++ ++ + ++          + + +  +D G P L   +   +     N N     K+  EF + +  + + + G        K   E A + YS+ E GNI   FS++  GVI T  + DRE    Y+  VI + +G+        + V+V + ND  P F       + E   N+ V + +  + A  +D+D    + Y +      V++   +    F + Q T  G + L   +D E      + + A D      +N   +T+ ++D+ND+ P F+ P   +     +S + F  G   AK++A D D    G++ + L
Sbjct: 1701 LTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSF-----------ELLEDSSGSLDLVPETGDLVLRRLSSLQS----------WKIKLRVVDHGVPGLYVEKNLEI----SNRNPQTEAKAPLEF-LKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVE-GNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGSGQ---QIGTRVDVRVNNLNDNVPSFPMSKPRRVPE---NLRVGSYVATVGA--KDVDNLAPLRYFL------VSDSSGQTPTHFNIDQFT--GTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQT----TVSPATFSPGQPFAKIEAHDLD--ARGALTYSL 2067          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 117.472 bits (293), Expect = 4.916e-26
Identity = 173/713 (24.26%), Postives = 299/713 (41.94%), Query Frame = 1
Query:  598 NDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDL------EMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSK--------------LDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLD--ENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAK---IKYSL-DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNG-----EPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGV--IDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLIL 2631
            N   P F+     + + ED PIG V+    A+D D+   G   Y I +   S+  +    E   + +   DL      +++++  QLKV   ID  T  K S   + L              IKD+N++SPQ+  + Y + + E     ++IF + A D D  NN   K              +D K    KL  S         +   +   EG            P++V       + T+LTIS++D NDN P   +    A+I E+      ++ +   DED+  N +    LN           S  +  + +    G + I+  E       D  K  F+++ I   D G P L++S    V ++D   N  +  F     E  + ENS   +E+  + A +   ++  K   ++Y +    G  +FSI+  G + T    DRE KS Y  TV A D+      +P R     + +++LD+ND +P+ +K  Y  ++ E+     V   +   +A+D D D    + ++I    P            F++ +T +G ++  G+  +DRE+QS   + V   D G+P L +++ V V + D ND+ P FT     +    ++ S+F     L ++ A D D   N  + + +   E  +  +I+ +G +I  E+I        +S  + V+A+D      Q     ++L
Sbjct:  602 NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKV-SAIDAGTPVKSSVKTMKL-------------RIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEG-----------FPMRV-------SVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN-----------SEKVPFRIDH-HSGCIFIHAPEY----PLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDP---------QSFFRIDLT-SGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFT----QAIHHYSVRSKFAGK--LCRIFAVDADEGENARLTYNI--TEGDARFSIDNNGNIIASEAIHG-----DESYALTVQATDHGTPGQQFAATRVVL 1243          

HSP 2 Score: 97.0561 bits (240), Expect = 7.160e-20
Identity = 107/431 (24.83%), Postives = 176/431 (40.84%), Query Frame = 1
Query: 1225 VVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGV--IDREEQSTIYIDVIARD-HGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYA-LNGSVVFELVGNESLSP 2484
            V   G  ++   + +++ D NDNAP    ++ S K+ E++     L        D     E+    +D T            S  N   + G++ +        K  D E +    + ++  D G P L +  Q  + V+DENDN+P F K  Y  ++ ENS    ++ +V A D DS+    + Y L+ +         + F+IN  G +   +  D E+   YN  VIA D G P   S A + + V D+ND  P F       +V+     A+ + L     +D D  +NG         +P+      +  K FKV    N KL L     ++  ++    + VIA+D  GK   +    +T+ +   + H P              + +E   G ++ +L A D+D    NG + F LV     SP
Sbjct: 3087 VASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVT------------SFVNLNAQTGILTLA-------KPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQE--GEAIGHRLLKFSVSDLDGPKNG---------APFTVEIQGDGAKSFKV----NEKLELLTAKKLEYRKKDKYLLTVIAKDVKGK---TTDCPLTIFIRQTSRHAPTM---KPMKIQINTLQNELPEG-IIGRLKASDEDEEDQNGLLRFGLVEGSIQSP 3476          

HSP 3 Score: 93.5893 bits (231), Expect = 8.327e-19
Identity = 171/732 (23.36%), Postives = 294/732 (40.16%), Query Frame = 1
Query:  403 RFVIISGNVRLRNLIQLNF--VTGSLHLISSVDREELCQQKDNDCSHIVIISFGSF--IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI--ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREI-FSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGL-QNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIY---QIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSE----IGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL------VGNESLSPVTIEKDGRVILKESI 2529
            RF I+ G+    + +  +    TG + + SS+DRE   Q K      I   + G    I  +T  I D+ND  P F       +I ED  +G  + +  A D D    G   + +  EN +                      ++      L V  ++DRE  + Y     A D  G    +   + + D+ND+ PQ+    + I +   +TS  + FS+K    DD  + N+   F I     GN   +  I   +   L   E     + E K+   LKV    G+ + +T + I++K   D+       +++  + EN +     T++  +   L  N  F    ND     +               + G+V +    QI+  +N+  +  ++       +C           +  +V++ + NDN P   + + +  I EN   S +    I  + A D D  E   IK+ + D+ G ++   ++ GV+   +  D E    +N TV+ASD GE      A+ILV V+DQND  P F K  Y   ++ES    ++   L    A+  D +E    + +    + +VN               + G L+L   +D E  S + + V+A+D G PPL     V +++ D ND+ P F            +    ++G  +  + A D D    G+V +EL        +  + P  I  +G V++ +SI
Sbjct: 2641 RFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWK----MTIRADAAGGVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPY---------------------FDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPILHFSIK----DDDLSPNNVSQFFIPK---GNEEGVFWIDSNNDLLLKRPE-----IVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKK---GTVVLGESSLLGPNVTFKLSDNDGNVFVVNF-------------RNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVC----------KELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDE---IKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GE--FEDKATILVTVIDQNDNAPTFEKSTYSMKVMESE---SIGYELAHFRASGGDQNETIEYYLKPSDVTSFVN------------LNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVG----KVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSI 3284          

HSP 4 Score: 92.0485 bits (227), Expect = 2.577e-18
Identity = 83/270 (30.74%), Postives = 130/270 (48.15%), Query Frame = 1
Query: 1519 IETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKP---------IFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP----YVNNPDAEKTKRFKVQITKNGKLSL-YGVIDRE--EQSTIYIDVIARDHGKPPLSNS 2280
            I T+  +  DREK   + + +   D G PQL S+    V VLDENDNSP FT++I+ + +     G  ++  + A D D  ENA++ Y++ E G+  FSI+  G I   E    ++   Y  TV A+D+G P +   A+ +V   +    KP         I  K+ ++ I  S  +  V   +G +EA+D D DE   +W+ I +  P     V     +     KV++ K G+L L   V D +  + ST+ I V  +   +P  S S
Sbjct: 1106 ITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAG--KLCRIFAVDADEGENARLTYNITE-GDARFSIDNNGNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQ-VGLTVGKLEASDADGDE---LWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSAS 1366          

HSP 5 Score: 87.8113 bits (216), Expect = 4.842e-17
Identity = 132/547 (24.13%), Postives = 230/547 (42.05%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFE-DCFKFSSIKDL----EMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNEN----KSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQEN-AKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQN--DCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDED-LDENGLVWY---EIGATSPYVNNPDAEKTKRFKV 2163
            +T +I ++ND  P   ++ +++SI E++P             D+++Y             T I+ E  + D  KF  + D     ++  I   + V+K +D E    ++ T+VA D E +     I++ + D NDN+P +    Y + V E  +   E+   +A   D    I   L       K  +      +   +    +      + ++ +KL V  K      L+    + IS+ D NDNAP         K+KEN ++ E   +LTVK  D++     S H    +Y    E++S    T  + P    V+ + I +N +    +S D EK+  Y++ +I  D G P L S     + V DEND++P F        + E       +   S  D D  +N A     +   G   F +N    + T +K +  +K  Y  TVIA D    +     +I ++   ++    KP+   + + N ++   N      +G ++A+DED  D+NGL+ +   E    SP     ++  T  F+V
Sbjct: 2997 ITVVIENLNDNRPKIIEKLLKVSIDENLPTSE----------DARQY------------ITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFE-DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYL-------KPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGE--KVLTVKALDVD-----SEHFGAVSY--ELEIVSE---TTTDTP----VLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPM---KIQINTLQ---NELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRV 3491          

HSP 6 Score: 79.7221 bits (195), Expect = 1.568e-14
Identity = 89/381 (23.36%), Postives = 164/381 (43.04%), Query Frame = 1
Query: 1213 VPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-----DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYE-FNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKN-GKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            +PL V D  G +  + LT+S+ D ND  P   +   S  I E+ +  + + +++  D+D     E+S  L D +      V           P++G + +        K  + +     S+ I   D  +P   ++    V +  E+   P F+ S Y F +ME++   + IG V   + +  E   I++++     +    + FS+    G I  K   DRE+K+ +  T+ A   G     +  ++ V + D ND  P F   YE F I E   + AV  ++ +  A D D   +G + + +   +PY +             + +N G L++   +DRE+    +  +IAR   +   +  +  T+ ++D+ND  P F
Sbjct: 2475 IPLVVEDATGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYS--LLDGSESQFFSV----------HPRQGTITVA-------KKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDE---IRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISE---DAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFD-------------LNENSGWLTVASQLDREKID--HYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQF 2813          

HSP 7 Score: 67.781 bits (164), Expect = 7.015e-11
Identity = 99/419 (23.63%), Postives = 176/419 (42.00%), Query Frame = 1
Query: 1258 DLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRG---MVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI--------------GNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            D++I I D ND+AP+ S            +  ++L  +   D+D   N +       T+ L L+   +    T  E PK+G      ++ I+     S         S L +   K   ++ +  +  +I   EN +SP+F+      E+ E++   + +  + A D+D+  N  I+Y + +I              G I  + ++  ++  KEK +     L    V A D G P +SS  ++ +++ D N+  P F +  Y   I E   N     ++  + AND D   NG + + +G      NN   EK+    +   K G + L   +DRE+Q      +IA D G P   +   +T+++ D+ND+ P      S +     I  +   G  ++ + A D+D   N  + F L
Sbjct:  477 DVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKF--TSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSR-------MSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLM--KEKLEVLDVQL---KVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISE---NEKPGKDIFKVTANDFDGGNNGKIKFSLG------NN--QEKSSVISID-AKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRA----RIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL 865          

HSP 8 Score: 59.6918 bits (143), Expect = 1.628e-8
Identity = 93/361 (25.76%), Postives = 154/361 (42.66%), Query Frame = 1
Query: 1567 YSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFT-KSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASIL---------------VKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWY---EIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            Y+  +I    G  +  + +  S+ +LD ND++P+F+ K + +  I+    G   +  V A D+D  EN KI Y       +   IN      T  +  ++  S +  TV A D G P SR S  +++               +    +N   P+F    E  IVE   +  +   +  ++ANDED   NG + Y   +I  +S  V   D +       +IT    LS   + ++ E   + + V A D G P  S+  T+ + + D+N+H P F   S     ++ IS   + G  + K+ A D D   NG + F L  N+  S V I  D +  + + +KS            + ASD+
Sbjct:  458 YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLV-KVDATDQDEGENGKIVYKF--TSELPLEINANTGEITLVEVPKKGNS-WPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPE--IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSG-----EITVASDLSKL-MKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVS----YYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSV-ISIDAKTGIVKLLKSLDREDQDVHTFAIIASDE 801          

HSP 9 Score: 59.6918 bits (143), Expect = 1.757e-8
Identity = 45/125 (36.00%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 1639 VLDENDNSPIFTKSIYEFEIMENSVGSSEIGS-------VSAPDKDSQENAKIKYS-LDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSS--TASILVKVLDQNDCKPIF 1980
            ++  N +SPIF + +Y   I EN    S + S       VSA D+D   N  + Y  L       FS++ Y G I T+  FD E+   Y+F V A D G+P R S   + I+V V+D+ND  P F
Sbjct: 1660 IIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF 1784          

HSP 10 Score: 58.151 bits (139), Expect = 5.953e-8
Identity = 68/288 (23.61%), Postives = 124/288 (43.06%), Query Frame = 1
Query: 1735 VSAPDKDSQENAKIKYSLDEIGN--IYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFN---IVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVID----REEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF-TFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNG---SVVFELVG--------NESLSPVTIEKDGRVILKESIK 2532
            V  PD  S     ++YS  ++ N  + F+I    G++    K +R ++ +YNF VIAS +G   + +   + +++LD ND  P+F  ++      ++   G++ V      ++A D+D  ENG + Y+  +  P   N +  +    +V    N   +    ID        S + +         P     I +       N H PVF +FP       V ++ +   G ++AKL A D+D   NG    V+ ++ G        +E    +T+  D   ++KE ++
Sbjct:  409 VENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINRSER-VYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVK-----VDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQ---ESENKHSPVFSSFP-----EIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLE 682          

HSP 11 Score: 56.225 bits (134), Expect = 1.934e-7
Identity = 118/514 (22.96%), Postives = 211/514 (41.05%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTA---FKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLI--IDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVA-------LDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMN-CEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICID-KGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQ-ENAKIKYSLDE 1794
            L ++ + EN P   +      ++      F E K R V   G      L Q++ + G + ++  +D E L        +  V+ S G F  + T L+  ID ND  PTF K    + ++E   IG+ +    AS  D  +       IE Y K +D+ +  F +    + I           L + K +D ET      T+VA       L+TE +     + +++ D NDN+P++    Y   VKE + S E + ++KA D D ++      + +I +    ++  L   +  + + LI      + + +  L V  K  DGG   L++   L I ++D ND+AP     + +A ++E +     L   +V D D   N   F+  +        K          NE+          +E    K  +  K D Y + +I  D KG    T+    ++ +   + ++P       +   ++N +    IG + A D+D + +N  +++ L E
Sbjct: 3015 LLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGG-----LFQIDDINGVVTVVKPLDSEIL-----GFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNE------TIEYYLKPSDVTS--FVNLNAQTGI-----------LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQ-----VEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAK--DGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFK---------VNEK----------LELLTAKKLEYRKKDKYLLTVIAKDVKGK---TTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVE 3470          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-8 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:U4PRG1])

HSP 1 Score: 96.6709 bits (239), Expect = 8.993e-20
Identity = 145/602 (24.09%), Postives = 260/602 (43.19%), Query Frame = 1
Query:  391 EAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG-----SFIFELTFLIIDMNDEVPTFAKQE-IELSILEDVPIGHVIDLP--VASDLDSQKYGIASYKI---ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH----VNIVLNIKDINDNSP--QWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISI---KDCNDNAPLISITSRSAKIK---ENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQI--ETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAP-DKD-SQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNG----EPSRSSTASI--LVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVW 2094
            E K+   I SG    R  +Q++   G++ +I S+D E   +Q        +++  G     SFI      I+D ND  P F       +S+LE   +G V+DLP  +A+D DS K+    Y +   E YFK  +  +                       ++++  +D ET+  +S ++  +D +G+  H     ++ + + D+NDN+P      L +    ++    + +  L   D+D+     +++D      +  + +KL  I             +LKG A  ++   +   D GGL+ T+   +++   K+ + N PL+ IT +   I    EN    E+L +  ++++    N  F           L E+  +            M  I +I    +  ++FD EK   + + I+     +   TS+  F + V D NDN P+F K      ++EN  G  ++G + A  D D   +N K+ Y+ D     +FS     ++FT   FDRE K  +  ++ A D      +P +    +I  L+ VLD ND  P F  K Y   +V+  G++   +++  ++A D D +  GL +
Sbjct:  886 EIKYSLKITSGP---RGKLQIDRY-GTIKIIKSLDFE--TEQIIKGIVEGMVVKNGKAAKSSFILT----ILDANDNRPIFKNSSNFAVSLLESSVLGTVLDLPYPLATDRDSSKFSTLKYSMTGDEGYFKIDESNS----------------------TIRLVAPLDFETQRVHSLSIKCVDNQGREPHHEVFASVTVTVIDVNDNAPVIHNTDLTHLSIEEDAQVGQVVTVLVISDSDEGGVQKTEIDVNSTLFRADSDKKLVVI------------ASLKGHAGQRICSTVTATDVGGLRATSPYCVTVYPAKNTHHN-PLV-ITPKQNSIHYFDENIVYDELLKVKVLEEDGDIGNVTF----------RLDEMFKKDWQ---------MFTIGEINGSLHARQAFDFEKKTVHEIKILACRINN--CTSTHLF-ISVNDRNDNCPMFPKQDVRLTVLENEKGKRQVGRIPAALDSDFHSDNTKVCYTTD-TPLFFFSDPTLPILFTNSSFDREHKKQHQISITAYDCHLSCRDPHKPINGTIVALIDVLDINDNFPKFSEKIYTSTVVQ--GHVTTGSHILTVQATDLDEEPEGLKY 1416          

HSP 2 Score: 94.3597 bits (233), Expect = 4.723e-19
Identity = 84/268 (31.34%), Postives = 133/268 (49.63%), Query Frame = 1
Query: 1543 FDREKVDFYSVLIICID-KGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-IGNIYFSINMYGVIFTKEKFDREQ---KSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPV 2328
             DRE  + + +++   D  GS   +   Q  + V DENDNSPIF K  Y   + E   G SE   ++A D DS +N +I YS+D+ I N+   I+  G++F     DRE     +  N TV ASD+GEP RS++A++ ++V D ND  P+F   +Y   +     N++    +G +EA D D            +TSP  NN     +   K  ++ +G++   G    E+ +++  +V A+D G P   NS    V +N+    K +
Sbjct:  508 IDRETYEKFELIVKATDLNGS---SGKSQLIIHVKDENDNSPIFDKEHYFITVDE---GKSEKLKITATDADSGKNGQIVYSIDQKIDNLPIDISPDGMLFIG-AIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPL---DANISPGGIIGRLEATDAD------------STSP--NNYVTYTSGDPKFTVSDSGEILFTGPGTLEKSASLEFNVTAQDGGDP--MNSANALVVINEHRSMKSI 749          

HSP 3 Score: 81.2629 bits (199), Expect = 4.763e-15
Identity = 75/259 (28.96%), Postives = 117/259 (45.17%), Query Frame = 1
Query: 1663 PIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASD-NGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQST---IYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            P F KS Y+F+++EN    + +G V         +  + Y +       F I+  G I   E  DRE    +   V A+D NG   +S    +++ V D+ND  PIF K++ F  V+   +  +      I A D D  +NG + Y I            +K     + I+ +G L   G IDRE       + + V A D G+P  S S TVT+ + D+ND+ PVF    S S   + + +    G ++ +L+A D D
Sbjct:  451 PKFEKSEYQFQVVENR-EPTVLGEVKV-----ISDGPVTYEILGENGEKFQISNDGEIQNLEPIDRETYEKFELIVKATDLNGSSGKSQ---LIIHVKDENDNSPIFDKEHYFITVDEGKSEKLK-----ITATDADSGKNGQIVYSID-----------QKIDNLPIDISPDGML-FIGAIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVF----SNSRYSIPLDANISPGGIIGRLEATDAD 679          

HSP 4 Score: 58.5362 bits (140), Expect = 3.209e-8
Identity = 150/642 (23.36%), Postives = 257/642 (40.03%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPV-ASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRET---REKYSFTLVALDT-EGKR-GHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFS-LKAFDADDQNNIN----SKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSV----LIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTV--IASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEF--NIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARD-HGKPPLSNSI-TVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            +L   + D ND  P F K+   +++ E    G    L + A+D DS K G   Y I+                     I +L + I    +  I  IDRE      + + T+ A D+ E KR     + + +KDINDNSP +    Y I +    +   I   L+A DAD  +  N    +  D K   +  G               L    G L+  A ++  V  +  DGG   N+ +  + I +            RS K  EN+ T +I +  T   E  E+       LN     +  E++  S    ++     +     I++   + +  +KVD   V    L I + KG  ++    +  + V+D +D +PI++    +  + E++   + +  V  P +  +E  +IKYSL           I+ YG I   +  D E + +    V  +   NG+ ++S   S ++ +LD ND +PIF+    F  +++ES   +    +L    A D D  +   + Y +     Y           FK+    N  + L   +D E Q    + +   D  G+ P      +VTVT+ D+ND+ PV     +   + ++I  + + G ++  L   D D
Sbjct:  533 QLIIHVKDENDNSPIFDKEHYFITVDE----GKSEKLKITATDADSGKNGQIVYSIDQ-------------------KIDNLPIDISPDGMLFIGAIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPLDANISPGGIIGRLEATDADSTSPNNYVTYTSGDPKFTVSDSGE-------------ILFTGPGTLEKSASLEFNVTAQ--DGGDPMNSANALVVINE-----------HRSMKSIENELTTQINSNDT-GGEKSEIKW-----LNAGMPGYTYEIIRASADGFSDSE---VATWISIDSKSGRIYTLKKVDPSRVKQIKLHISMRKGKREV--PVELIINVMDTDDVTPIYSTPTRKLSVTESATLGTTV--VDMPVEGIKEQNEIKYSLKITSGPRGKLQIDRYGTIKIIKSLDFETEQIIKGIVEGMVVKNGKAAKS---SFILTILDANDNRPIFKNSSNFAVSLLES-SVLGTVLDLPYPLATDRDSSKFSTLKYSMTGDEGY-----------FKID-ESNSTIRLVAPLDFETQRVHSLSIKCVDNQGREPHHEVFASVTVTVIDVNDNAPVI---HNTDLTHLSIEEDAQVGQVVTVLVISDSD 1093          

HSP 5 Score: 56.225 bits (134), Expect = 2.074e-7
Identity = 70/263 (26.62%), Postives = 108/263 (41.06%), Query Frame = 1
Query:  607 VPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDED 1389
            +P F K E +  ++E+     + ++ V SD      G  +Y+I              E+  KF    D E++ ++P       IDRET EK+   + A D  G  G   +++++KD NDNSP +    Y ITV E  +  E   + A DAD   N  I   +D KID   +  S      +             +    E+ L V            +  +TI +KD NDN+P+ S +  S  +  N     I+  L   D D
Sbjct:  450 IPKFEKSEYQFQVVENREPTVLGEVKVISD------GPVTYEILG------------ENGEKFQISNDGEIQNLEP-------IDRETYEKFELIVKATDLNGSSGKSQLIIHVKDENDNSPIFDKEHYFITVDEGKS--EKLKITATDADSGKNGQIVYSIDQKIDNLPIDISPDGMLFIGAIDREN------MGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPLDANISPGGIIGRLEATDAD 679          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 180.259 bits (456), Expect = 4.113e-45
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  394 AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIIS------FGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD--EIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            A  R+ II GN +  +   ++ ++G + L+  +D E +   +      +VI +        S   +L   +ID ND  P F   + + S+LE+VP+G+ I    A D D       +Y I          +ER +D F  +   D     +Q     IK +DRE + +++F +VA D     K    ++V+ ++D+NDN P +    Y+  V E       + ++ A D D+    +S+L ++I T   GN+R    I   +   LI I  +L    E + ++ +   D GG  +T  + I+I D N+ AP+      SA + E+      + +++  D D+ +N + +  LN+ +   L      S++     P+ G ++        N   DRE    Y + +   D G+P L+ +    + V D NDN+P F   +Y+  I+E+++  + +  V+A D D   N +IKY L   +I +  F I+   G I T +  DRE  ++++ T IA D G P  SST  + +++ D ND  P F   +    + E   N  V + +G I A+D D   N +V Y I      +   D+          ++  +L     +D E     + +++ R    PPL N   + + + D+ND+ PV 
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYESVRSYR------LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----------SER-DDNFPLAV--DPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE----DSRLHYEITT---GNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSIN-----PQTGAIVT-------NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPE---NSPVGSVVGEIHAHDPDEGVNAVVHYSI------IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRF-ELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 166.007 bits (419), Expect = 9.418e-41
Identity = 183/757 (24.17%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISG-NVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII----SFG--SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-----TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE----CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE--------IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            +L+   + E +P  + +  ++A+ P   +++   + ++S  + R ++L +++  TG +   +S+DRE +      D  +  ++    SF   S    L   ++D ND  PTF  ++ E SI E   +G  +    A+D D  K     Y IE       +  ++    F+  S   +        +     +DRET + Y   + A D     +E +    ++ + + D NDN PQ+    Y + V E     T    +  ++A DAD  N  N+ + + I     GN++    I  +S +  ++     + +   +LV+  +  DGG     NTT L +++ D NDNAP    +     + EN      +  +   D D   N E        TY         S+S +++       P+ G V          K  DRE+   ++  ++  D G P  ++S    + V D NDN P F    YE  + E+    + + +V+A D D  E++++ Y +   GN    F+I   N  G+I   +  D +Q+  +  TV A+D+G   RS TA++ + + D N+  PIF    Y  ++ E   +  V   + ++ A D D+  N  + Y         +G+  P+  NP             + G +     +DRE  S   + V A+D G P LS++  V + + D+ND+ P F  P   +    +I  +   G  + ++ A D D  LNG + + L
Sbjct:  362 ALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELM------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV--------ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIG---GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVI--RAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-------TY---------SISERDDNFPLAVDPRTGWVQTI-------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI-TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFE---DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-------------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLL 1046          

HSP 3 Score: 144.05 bits (362), Expect = 4.023e-34
Identity = 175/754 (23.21%), Postives = 319/754 (42.31%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVI--ISGNVRLRN-----LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG---------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIG---HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-----IGNI-YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE 2472
            FE  ++E   + S +I L+A      K A+  + I  ++    L       + +++  +G +   SS+DRE       +D  H+++ +           +    +   ++D ND  P F+++   + + ED   G   + +    A+D D        Y I         +    +  F   S+           + ++K +D E+   Y   + A D  +  +     +++N+ D NDN+P++    ++ +V E       I  ++A+D+D+  N  I   +  + D   L  + R          +       A + +A+   V P           ++ + I+++D NDN P  +     A + E++     +T +T  D D +    +     +T          R       +  RG++ I Q       S D ++   + + +   D G    T++   ++   D N+ +PIF  + Y   + E++   + +  VSA D D   NA+I YSL+E     +G+   FSIN   G I T    DRE  S Y  TV A D G PS S T  + + V D ND  P F+   Y+ +I+E   +  V  ++  + A+D D+  NG + Y        +++ D E    F +  T +G +     +DRE  +  ++  IA D G PPLS+++ V + L D+ND  P  TF S     +V  +S    G ++ ++ A D D  +N  V + ++G +
Sbjct:  469 FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---------IGGNTQSQFSIDSMSG--------DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--------SSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT----------RGRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-------LLSDRDIEDGS-FVIDPT-SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP--TFASDKITLYVPENS--PVGSVVGEIHAHDPDEGVNAVVHYSIIGGD 1156          

HSP 4 Score: 112.079 bits (279), Expect = 2.270e-24
Identity = 92/348 (26.44%), Postives = 151/348 (43.39%), Query Frame = 1
Query: 1534 NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-----------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPS---RSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK 2532
            + S DRE +D +   ++  D   P  + +    V VLD ND+SP F    +E  I E +   S + ++ A D+D  +NA+I+Y ++ + +           I+   +  GVI T+   DRE    Y+  V A+D        R++TAS+ VKVLD ND  P F  + Y   + E        N +  I A D D   N  + Y I                +F +  + +G +SL   +D E   +  + + A+D G P  SN+  + V + D ND+ P F           N+      GY + ++ A D D   N  + + +   +   P+ +  D R    ++IK
Sbjct:  419 SASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG---------GNTQSQFSID-SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP----VGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAV--DPRTGWVQTIK 750          

HSP 5 Score: 110.923 bits (276), Expect = 6.359e-24
Identity = 136/606 (22.44%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNL-IQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGV----IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVH---NNLGLIEANDEDLDE 2079
            +S F+  + EN P+   +I ++A       E  +  +  S + R  N  + ++  TG +  I  +DREE  +      +    +   S    +   + D+ND  P F  +  E ++ ED P G  +    A+D D           E+     +I T      F  +S     +      + + + +D +  +++  T+ A D+ G+     + +NI D N+ +P +   PY  +V ++      +  + A D+D    +N+++ + ++   +                 I+    L        ++ +   DGG   L +TTD+ I + D NDNAP        A I E+      +  +   D D+ +N      L+D      +++   S       P  G +         NK  DRE V  + +  I +DKGSP L+S+ +  + + D ND+ P F        + ENS   S +G + A D D   NA + YS+   +  N +  +   G     + T  + D E  +   F ++      P R+  A I + V D ND  P+ R   +F ++  + N   H     +G I A D D+ +
Sbjct:  691 TSQFQESVLENVPVGYNIIRVQAY---DSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-----------EDSRLHYEITTGNTRGRFAITSQNGRGL------ITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVID---PTSGTI-------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYE-STRKRFELVVRAASPPLRND-AHIEILVTDVNDNAPVLR---DFQVI--FNNFRDHFPSGEIGRIPAFDADVSD 1251          

HSP 6 Score: 90.5077 bits (223), Expect = 9.995e-18
Identity = 84/324 (25.93%), Postives = 152/324 (46.91%), Query Frame = 1
Query: 1654 DNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS----LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPP---LSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGY---LLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + SP F +++Y   ++E     + + +V A D    E++ + YS    LD      F ++   GV+ T    DRE   ++ F V+A+D+  P RS T ++ V VLD ND  P F  +Q+E +I E      V + +  + A D+D+ +N  + Y I A +        ++   F++  +++G +S    +DRE   + ++ V A D         + + +V V + D ND+ P F    S     V +  +   G     +A + A D D   N ++ + ++G  + S  +I+   G V L   +K   +   +S R+++RA D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIRE---GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRID-SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL---VKPLDYESVRSYRLVIRAQD 663          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 180.259 bits (456), Expect = 4.113e-45
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  394 AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIIS------FGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD--EIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            A  R+ II GN +  +   ++ ++G + L+  +D E +   +      +VI +        S   +L   +ID ND  P F   + + S+LE+VP+G+ I    A D D       +Y I          +ER +D F  +   D     +Q     IK +DRE + +++F +VA D     K    ++V+ ++D+NDN P +    Y+  V E       + ++ A D D+    +S+L ++I T   GN+R    I   +   LI I  +L    E + ++ +   D GG  +T  + I+I D N+ AP+      SA + E+      + +++  D D+ +N + +  LN+ +   L      S++     P+ G ++        N   DRE    Y + +   D G+P L+ +    + V D NDN+P F   +Y+  I+E+++  + +  V+A D D   N +IKY L   +I +  F I+   G I T +  DRE  ++++ T IA D G P  SST  + +++ D ND  P F   +    + E   N  V + +G I A+D D   N +V Y I      +   D+          ++  +L     +D E     + +++ R    PPL N   + + + D+ND+ PV 
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYESVRSYR------LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----------SER-DDNFPLAV--DPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE----DSRLHYEITT---GNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSIN-----PQTGAIVT-------NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPE---NSPVGSVVGEIHAHDPDEGVNAVVHYSI------IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRF-ELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 166.007 bits (419), Expect = 9.418e-41
Identity = 183/757 (24.17%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISG-NVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII----SFG--SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-----TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE----CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE--------IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            +L+   + E +P  + +  ++A+ P   +++   + ++S  + R ++L +++  TG +   +S+DRE +      D  +  ++    SF   S    L   ++D ND  PTF  ++ E SI E   +G  +    A+D D  K     Y IE       +  ++    F+  S   +        +     +DRET + Y   + A D     +E +    ++ + + D NDN PQ+    Y + V E     T    +  ++A DAD  N  N+ + + I     GN++    I  +S +  ++     + +   +LV+  +  DGG     NTT L +++ D NDNAP    +     + EN      +  +   D D   N E        TY         S+S +++       P+ G V          K  DRE+   ++  ++  D G P  ++S    + V D NDN P F    YE  + E+    + + +V+A D D  E++++ Y +   GN    F+I   N  G+I   +  D +Q+  +  TV A+D+G   RS TA++ + + D N+  PIF    Y  ++ E   +  V   + ++ A D D+  N  + Y         +G+  P+  NP             + G +     +DRE  S   + V A+D G P LS++  V + + D+ND+ P F  P   +    +I  +   G  + ++ A D D  LNG + + L
Sbjct:  362 ALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELM------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV--------ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIG---GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVI--RAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-------TY---------SISERDDNFPLAVDPRTGWVQTI-------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI-TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFE---DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-------------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLL 1046          

HSP 3 Score: 144.05 bits (362), Expect = 4.023e-34
Identity = 175/754 (23.21%), Postives = 319/754 (42.31%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVI--ISGNVRLRN-----LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG---------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIG---HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-----IGNI-YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE 2472
            FE  ++E   + S +I L+A      K A+  + I  ++    L       + +++  +G +   SS+DRE       +D  H+++ +           +    +   ++D ND  P F+++   + + ED   G   + +    A+D D        Y I         +    +  F   S+           + ++K +D E+   Y   + A D  +  +     +++N+ D NDN+P++    ++ +V E       I  ++A+D+D+  N  I   +  + D   L  + R          +       A + +A+   V P           ++ + I+++D NDN P  +     A + E++     +T +T  D D +    +     +T          R       +  RG++ I Q       S D ++   + + +   D G    T++   ++   D N+ +PIF  + Y   + E++   + +  VSA D D   NA+I YSL+E     +G+   FSIN   G I T    DRE  S Y  TV A D G PS S T  + + V D ND  P F+   Y+ +I+E   +  V  ++  + A+D D+  NG + Y        +++ D E    F +  T +G +     +DRE  +  ++  IA D G PPLS+++ V + L D+ND  P  TF S     +V  +S    G ++ ++ A D D  +N  V + ++G +
Sbjct:  469 FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---------IGGNTQSQFSIDSMSG--------DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--------SSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT----------RGRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-------LLSDRDIEDGS-FVIDPT-SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP--TFASDKITLYVPENS--PVGSVVGEIHAHDPDEGVNAVVHYSIIGGD 1156          

HSP 4 Score: 112.079 bits (279), Expect = 2.270e-24
Identity = 92/348 (26.44%), Postives = 151/348 (43.39%), Query Frame = 1
Query: 1534 NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-----------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPS---RSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK 2532
            + S DRE +D +   ++  D   P  + +    V VLD ND+SP F    +E  I E +   S + ++ A D+D  +NA+I+Y ++ + +           I+   +  GVI T+   DRE    Y+  V A+D        R++TAS+ VKVLD ND  P F  + Y   + E        N +  I A D D   N  + Y I                +F +  + +G +SL   +D E   +  + + A+D G P  SN+  + V + D ND+ P F           N+      GY + ++ A D D   N  + + +   +   P+ +  D R    ++IK
Sbjct:  419 SASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG---------GNTQSQFSID-SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP----VGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAV--DPRTGWVQTIK 750          

HSP 5 Score: 110.923 bits (276), Expect = 6.359e-24
Identity = 136/606 (22.44%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNL-IQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGV----IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVH---NNLGLIEANDEDLDE 2079
            +S F+  + EN P+   +I ++A       E  +  +  S + R  N  + ++  TG +  I  +DREE  +      +    +   S    +   + D+ND  P F  +  E ++ ED P G  +    A+D D           E+     +I T      F  +S     +      + + + +D +  +++  T+ A D+ G+     + +NI D N+ +P +   PY  +V ++      +  + A D+D    +N+++ + ++   +                 I+    L        ++ +   DGG   L +TTD+ I + D NDNAP        A I E+      +  +   D D+ +N      L+D      +++   S       P  G +         NK  DRE V  + +  I +DKGSP L+S+ +  + + D ND+ P F        + ENS   S +G + A D D   NA + YS+   +  N +  +   G     + T  + D E  +   F ++      P R+  A I + V D ND  P+ R   +F ++  + N   H     +G I A D D+ +
Sbjct:  691 TSQFQESVLENVPVGYNIIRVQAY---DSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-----------EDSRLHYEITTGNTRGRFAITSQNGRGL------ITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVID---PTSGTI-------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYE-STRKRFELVVRAASPPLRND-AHIEILVTDVNDNAPVLR---DFQVI--FNNFRDHFPSGEIGRIPAFDADVSD 1251          

HSP 6 Score: 90.5077 bits (223), Expect = 9.995e-18
Identity = 84/324 (25.93%), Postives = 152/324 (46.91%), Query Frame = 1
Query: 1654 DNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS----LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPP---LSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGY---LLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + SP F +++Y   ++E     + + +V A D    E++ + YS    LD      F ++   GV+ T    DRE   ++ F V+A+D+  P RS T ++ V VLD ND  P F  +Q+E +I E      V + +  + A D+D+ +N  + Y I A +        ++   F++  +++G +S    +DRE   + ++ V A D         + + +V V + D ND+ P F    S     V +  +   G     +A + A D D   N ++ + ++G  + S  +I+   G V L   +K   +   +S R+++RA D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIRE---GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRID-SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL---VKPLDYESVRSYRLVIRAQD 663          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 179.874 bits (455), Expect = 4.738e-45
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  394 AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIIS------FGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD--EIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            A  R+ II GN +  +   ++ ++G + L+  +D E +   +      +VI +        S   +L   +ID ND  P F   + + S+LE+VP+G+ I    A D D       +Y I          +ER +D F  +   D     +Q     IK +DRE + +++F +VA D     K    ++V+ ++D+NDN P +    Y+  V E       + ++ A D D+    +S+L ++I T   GN+R    I   +   LI I  +L    E + ++ +   D GG  +T  + I+I D N+ AP+      SA + E+      + +++  D D+ +N + +  LN+ +   L      S++     P+ G ++        N   DRE    Y + +   D G+P L+ +    + V D NDN+P F   +Y+  I+E+++  + +  V+A D D   N +IKY L   +I +  F I+   G I T +  DRE  ++++ T IA D G P  SST  + +++ D ND  P F   +    + E   N  V + +G I A+D D   N +V Y I      +   D+          ++  +L     +D E     + +++ R    PPL N   + + + D+ND+ PV 
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYESVRSYR------LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----------SER-DDNFPLAV--DPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE----DSRLHYEITT---GNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSIN-----PQTGAIVT-------NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPE---NSPVGSVVGEIHAHDPDEGVNAVVHYSI------IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRF-ELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 166.007 bits (419), Expect = 1.004e-40
Identity = 183/757 (24.17%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISG-NVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII----SFG--SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-----TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE----CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE--------IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            +L+   + E +P  + +  ++A+ P   +++   + ++S  + R ++L +++  TG +   +S+DRE +      D  +  ++    SF   S    L   ++D ND  PTF  ++ E SI E   +G  +    A+D D  K     Y IE       +  ++    F+  S   +        +     +DRET + Y   + A D     +E +    ++ + + D NDN PQ+    Y + V E     T    +  ++A DAD  N  N+ + + I     GN++    I  +S +  ++     + +   +LV+  +  DGG     NTT L +++ D NDNAP    +     + EN      +  +   D D   N E        TY         S+S +++       P+ G V          K  DRE+   ++  ++  D G P  ++S    + V D NDN P F    YE  + E+    + + +V+A D D  E++++ Y +   GN    F+I   N  G+I   +  D +Q+  +  TV A+D+G   RS TA++ + + D N+  PIF    Y  ++ E   +  V   + ++ A D D+  N  + Y         +G+  P+  NP             + G +     +DRE  S   + V A+D G P LS++  V + + D+ND+ P F  P   +    +I  +   G  + ++ A D D  LNG + + L
Sbjct:  362 ALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELM------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV--------ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIG---GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVI--RAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-------TY---------SISERDDNFPLAVDPRTGWVQTI-------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI-TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFE---DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-------------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLL 1046          

HSP 3 Score: 144.05 bits (362), Expect = 4.704e-34
Identity = 175/754 (23.21%), Postives = 319/754 (42.31%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVI--ISGNVRLRN-----LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG---------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIG---HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-----IGNI-YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE 2472
            FE  ++E   + S +I L+A      K A+  + I  ++    L       + +++  +G +   SS+DRE       +D  H+++ +           +    +   ++D ND  P F+++   + + ED   G   + +    A+D D        Y I         +    +  F   S+           + ++K +D E+   Y   + A D  +  +     +++N+ D NDN+P++    ++ +V E       I  ++A+D+D+  N  I   +  + D   L  + R          +       A + +A+   V P           ++ + I+++D NDN P  +     A + E++     +T +T  D D +    +     +T          R       +  RG++ I Q       S D ++   + + +   D G    T++   ++   D N+ +PIF  + Y   + E++   + +  VSA D D   NA+I YSL+E     +G+   FSIN   G I T    DRE  S Y  TV A D G PS S T  + + V D ND  P F+   Y+ +I+E   +  V  ++  + A+D D+  NG + Y        +++ D E    F +  T +G +     +DRE  +  ++  IA D G PPLS+++ V + L D+ND  P  TF S     +V  +S    G ++ ++ A D D  +N  V + ++G +
Sbjct:  469 FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---------IGGNTQSQFSIDSMSG--------DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--------SSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT----------RGRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-------LLSDRDIEDGS-FVIDPT-SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP--TFASDKITLYVPENS--PVGSVVGEIHAHDPDEGVNAVVHYSIIGGD 1156          

HSP 4 Score: 112.079 bits (279), Expect = 2.277e-24
Identity = 92/348 (26.44%), Postives = 151/348 (43.39%), Query Frame = 1
Query: 1534 NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-----------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPS---RSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK 2532
            + S DRE +D +   ++  D   P  + +    V VLD ND+SP F    +E  I E +   S + ++ A D+D  +NA+I+Y ++ + +           I+   +  GVI T+   DRE    Y+  V A+D        R++TAS+ VKVLD ND  P F  + Y   + E        N +  I A D D   N  + Y I                +F +  + +G +SL   +D E   +  + + A+D G P  SN+  + V + D ND+ P F           N+      GY + ++ A D D   N  + + +   +   P+ +  D R    ++IK
Sbjct:  419 SASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG---------GNTQSQFSID-SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP----VGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAV--DPRTGWVQTIK 750          

HSP 5 Score: 110.923 bits (276), Expect = 6.378e-24
Identity = 136/606 (22.44%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNL-IQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGV----IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVH---NNLGLIEANDEDLDE 2079
            +S F+  + EN P+   +I ++A       E  +  +  S + R  N  + ++  TG +  I  +DREE  +      +    +   S    +   + D+ND  P F  +  E ++ ED P G  +    A+D D           E+     +I T      F  +S     +      + + + +D +  +++  T+ A D+ G+     + +NI D N+ +P +   PY  +V ++      +  + A D+D    +N+++ + ++   +                 I+    L        ++ +   DGG   L +TTD+ I + D NDNAP        A I E+      +  +   D D+ +N      L+D      +++   S       P  G +         NK  DRE V  + +  I +DKGSP L+S+ +  + + D ND+ P F        + ENS   S +G + A D D   NA + YS+   +  N +  +   G     + T  + D E  +   F ++      P R+  A I + V D ND  P+ R   +F ++  + N   H     +G I A D D+ +
Sbjct:  691 TSQFQESVLENVPVGYNIIRVQAY---DSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-----------EDSRLHYEITTGNTRGRFAITSQNGRGL------ITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVID---PTSGTI-------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYE-STRKRFELVVRAASPPLRND-AHIEILVTDVNDNAPVLR---DFQVI--FNNFRDHFPSGEIGRIPAFDADVSD 1251          

HSP 6 Score: 90.5077 bits (223), Expect = 1.010e-17
Identity = 84/324 (25.93%), Postives = 152/324 (46.91%), Query Frame = 1
Query: 1654 DNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS----LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPP---LSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGY---LLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + SP F +++Y   ++E     + + +V A D    E++ + YS    LD      F ++   GV+ T    DRE   ++ F V+A+D+  P RS T ++ V VLD ND  P F  +Q+E +I E      V + +  + A D+D+ +N  + Y I A +        ++   F++  +++G +S    +DRE   + ++ V A D         + + +V V + D ND+ P F    S     V +  +   G     +A + A D D   N ++ + ++G  + S  +I+   G V L   +K   +   +S R+++RA D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIRE---GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRID-SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL---VKPLDYESVRSYRLVIRAQD 663          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 179.874 bits (455), Expect = 5.098e-45
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  394 AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIIS------FGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD--EIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            A  R+ II GN +  +   ++ ++G + L+  +D E +   +      +VI +        S   +L   +ID ND  P F   + + S+LE+VP+G+ I    A D D       +Y I          +ER +D F  +   D     +Q     IK +DRE + +++F +VA D     K    ++V+ ++D+NDN P +    Y+  V E       + ++ A D D+    +S+L ++I T   GN+R    I   +   LI I  +L    E + ++ +   D GG  +T  + I+I D N+ AP+      SA + E+      + +++  D D+ +N + +  LN+ +   L      S++     P+ G ++        N   DRE    Y + +   D G+P L+ +    + V D NDN+P F   +Y+  I+E+++  + +  V+A D D   N +IKY L   +I +  F I+   G I T +  DRE  ++++ T IA D G P  SST  + +++ D ND  P F   +    + E   N  V + +G I A+D D   N +V Y I      +   D+          ++  +L     +D E     + +++ R    PPL N   + + + D+ND+ PV 
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYESVRSYR------LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----------SER-DDNFPLAV--DPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE----DSRLHYEITT---GNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSIN-----PQTGAIVT-------NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPE---NSPVGSVVGEIHAHDPDEGVNAVVHYSI------IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRF-ELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 165.622 bits (418), Expect = 1.207e-40
Identity = 183/757 (24.17%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISG-NVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII----SFG--SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-----TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE----CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE--------IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            +L+   + E +P  + +  ++A+ P   +++   + ++S  + R ++L +++  TG +   +S+DRE +      D  +  ++    SF   S    L   ++D ND  PTF  ++ E SI E   +G  +    A+D D  K     Y IE       +  ++    F+  S   +        +     +DRET + Y   + A D     +E +    ++ + + D NDN PQ+    Y + V E     T    +  ++A DAD  N  N+ + + I     GN++    I  +S +  ++     + +   +LV+  +  DGG     NTT L +++ D NDNAP    +     + EN      +  +   D D   N E        TY         S+S +++       P+ G V          K  DRE+   ++  ++  D G P  ++S    + V D NDN P F    YE  + E+    + + +V+A D D  E++++ Y +   GN    F+I   N  G+I   +  D +Q+  +  TV A+D+G   RS TA++ + + D N+  PIF    Y  ++ E   +  V   + ++ A D D+  N  + Y         +G+  P+  NP             + G +     +DRE  S   + V A+D G P LS++  V + + D+ND+ P F  P   +    +I  +   G  + ++ A D D  LNG + + L
Sbjct:  362 ALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELM------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV--------ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIG---GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVI--RAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-------TY---------SISERDDNFPLAVDPRTGWVQTI-------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI-TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFE---DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-------------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLL 1046          

HSP 3 Score: 144.05 bits (362), Expect = 5.150e-34
Identity = 175/754 (23.21%), Postives = 319/754 (42.31%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVI--ISGNVRLRN-----LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG---------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIG---HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-----IGNI-YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE 2472
            FE  ++E   + S +I L+A      K A+  + I  ++    L       + +++  +G +   SS+DRE       +D  H+++ +           +    +   ++D ND  P F+++   + + ED   G   + +    A+D D        Y I         +    +  F   S+           + ++K +D E+   Y   + A D  +  +     +++N+ D NDN+P++    ++ +V E       I  ++A+D+D+  N  I   +  + D   L  + R          +       A + +A+   V P           ++ + I+++D NDN P  +     A + E++     +T +T  D D +    +     +T          R       +  RG++ I Q       S D ++   + + +   D G    T++   ++   D N+ +PIF  + Y   + E++   + +  VSA D D   NA+I YSL+E     +G+   FSIN   G I T    DRE  S Y  TV A D G PS S T  + + V D ND  P F+   Y+ +I+E   +  V  ++  + A+D D+  NG + Y        +++ D E    F +  T +G +     +DRE  +  ++  IA D G PPLS+++ V + L D+ND  P  TF S     +V  +S    G ++ ++ A D D  +N  V + ++G +
Sbjct:  469 FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---------IGGNTQSQFSIDSMSG--------DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--------SSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT----------RGRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-------LLSDRDIEDGS-FVIDPT-SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP--TFASDKITLYVPENS--PVGSVVGEIHAHDPDEGVNAVVHYSIIGGD 1156          

HSP 4 Score: 112.079 bits (279), Expect = 2.331e-24
Identity = 92/348 (26.44%), Postives = 151/348 (43.39%), Query Frame = 1
Query: 1534 NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-----------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPS---RSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK 2532
            + S DRE +D +   ++  D   P  + +    V VLD ND+SP F    +E  I E +   S + ++ A D+D  +NA+I+Y ++ + +           I+   +  GVI T+   DRE    Y+  V A+D        R++TAS+ VKVLD ND  P F  + Y   + E        N +  I A D D   N  + Y I                +F +  + +G +SL   +D E   +  + + A+D G P  SN+  + V + D ND+ P F           N+      GY + ++ A D D   N  + + +   +   P+ +  D R    ++IK
Sbjct:  419 SASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG---------GNTQSQFSID-SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP----VGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAV--DPRTGWVQTIK 750          

HSP 5 Score: 110.538 bits (275), Expect = 7.410e-24
Identity = 136/606 (22.44%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNL-IQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGV----IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVH---NNLGLIEANDEDLDE 2079
            +S F+  + EN P+   +I ++A       E  +  +  S + R  N  + ++  TG +  I  +DREE  +      +    +   S    +   + D+ND  P F  +  E ++ ED P G  +    A+D D           E+     +I T      F  +S     +      + + + +D +  +++  T+ A D+ G+     + +NI D N+ +P +   PY  +V ++      +  + A D+D    +N+++ + ++   +                 I+    L        ++ +   DGG   L +TTD+ I + D NDNAP        A I E+      +  +   D D+ +N      L+D      +++   S       P  G +         NK  DRE V  + +  I +DKGSP L+S+ +  + + D ND+ P F        + ENS   S +G + A D D   NA + YS+   +  N +  +   G     + T  + D E  +   F ++      P R+  A I + V D ND  P+ R   +F ++  + N   H     +G I A D D+ +
Sbjct:  691 TSQFQESVLENVPVGYNIIRVQAY---DSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-----------EDSRLHYEITTGNTRGRFAITSQNGRGL------ITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVID---PTSGTI-------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYE-STRKRFELVVRAASPPLRND-AHIEILVTDVNDNAPVLR---DFQVI--FNNFRDHFPSGEIGRIPAFDADVSD 1251          

HSP 6 Score: 90.5077 bits (223), Expect = 1.052e-17
Identity = 84/324 (25.93%), Postives = 152/324 (46.91%), Query Frame = 1
Query: 1654 DNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS----LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPP---LSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGY---LLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + SP F +++Y   ++E     + + +V A D    E++ + YS    LD      F ++   GV+ T    DRE   ++ F V+A+D+  P RS T ++ V VLD ND  P F  +Q+E +I E      V + +  + A D+D+ +N  + Y I A +        ++   F++  +++G +S    +DRE   + ++ V A D         + + +V V + D ND+ P F    S     V +  +   G     +A + A D D   N ++ + ++G  + S  +I+   G V L   +K   +   +S R+++RA D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIRE---GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRID-SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL---VKPLDYESVRSYRLVIRAQD 663          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 179.874 bits (455), Expect = 5.174e-45
Identity = 172/659 (26.10%), Postives = 300/659 (45.52%), Query Frame = 1
Query:  394 AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIIS------FGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD--EIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            A  R+ II GN +  +   ++ ++G + L+  +D E +   +      +VI +        S   +L   +ID ND  P F   + + S+LE+VP+G+ I    A D D       +Y I          +ER +D F  +   D     +Q     IK +DRE + +++F +VA D     K    ++V+ ++D+NDN P +    Y+  V E       + ++ A D D+    +S+L ++I T   GN+R    I   +   LI I  +L    E + ++ +   D GG  +T  + I+I D N+ AP+      SA + E+      + +++  D D+ +N + +  LN+ +   L      S++     P+ G ++        N   DRE    Y + +   D G+P L+ +    + V D NDN+P F   +Y+  I+E+++  + +  V+A D D   N +IKY L   +I +  F I+   G I T +  DRE  ++++ T IA D G P  SST  + +++ D ND  P F   +    + E   N  V + +G I A+D D   N +V Y I      +   D+          ++  +L     +D E     + +++ R    PPL N   + + + D+ND+ PV 
Sbjct:  617 AAIRYAIIGGNTQ--SQFSIDSMSGDVSLVKPLDYESVRSYR------LVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----------SER-DDNFPLAV--DPRTGWVQ----TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE----DSRLHYEITT---GNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSIN-----PQTGAIVT-------NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPE---NSPVGSVVGEIHAHDPDEGVNAVVHYSI------IGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRF-ELVVR-AASPPLRNDAHIEILVTDVNDNAPVL 1220          

HSP 2 Score: 165.622 bits (418), Expect = 1.267e-40
Identity = 183/757 (24.17%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISG-NVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII----SFG--SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-----TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE----CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI---NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE--------IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            +L+   + E +P  + +  ++A+ P   +++   + ++S  + R ++L +++  TG +   +S+DRE +      D  +  ++    SF   S    L   ++D ND  PTF  ++ E SI E   +G  +    A+D D  K     Y IE       +  ++    F+  S   +        +     +DRET + Y   + A D     +E +    ++ + + D NDN PQ+    Y + V E     T    +  ++A DAD  N  N+ + + I     GN++    I  +S +  ++     + +   +LV+  +  DGG     NTT L +++ D NDNAP    +     + EN      +  +   D D   N E        TY         S+S +++       P+ G V          K  DRE+   ++  ++  D G P  ++S    + V D NDN P F    YE  + E+    + + +V+A D D  E++++ Y +   GN    F+I   N  G+I   +  D +Q+  +  TV A+D+G   RS TA++ + + D N+  PIF    Y  ++ E   +  V   + ++ A D D+  N  + Y         +G+  P+  NP             + G +     +DRE  S   + V A+D G P LS++  V + + D+ND+ P F  P   +    +I  +   G  + ++ A D D  LNG + + L
Sbjct:  362 ALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELM------DVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV--------ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN--NAAIRYAIIG---GNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVI--RAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEI-------TY---------SISERDDNFPLAVDPRTGWVQTI-------KPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEI-TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFE---DAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINP-------------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQA----SILEDALVGTSVIQVAASDPDVGLNGRIKYLL 1046          

HSP 3 Score: 144.05 bits (362), Expect = 4.845e-34
Identity = 175/754 (23.21%), Postives = 319/754 (42.31%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVI--ISGNVRLRN-----LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG---------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIG---HVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN--INSKLDFKIDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-----IGNI-YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE 2472
            FE  ++E   + S +I L+A      K A+  + I  ++    L       + +++  +G +   SS+DRE       +D  H+++ +           +    +   ++D ND  P F+++   + + ED   G   + +    A+D D        Y I         +    +  F   S+           + ++K +D E+   Y   + A D  +  +     +++N+ D NDN+P++    ++ +V E       I  ++A+D+D+  N  I   +  + D   L  + R          +       A + +A+   V P           ++ + I+++D NDN P  +     A + E++     +T +T  D D +    +     +T          R       +  RG++ I Q       S D ++   + + +   D G    T++   ++   D N+ +PIF  + Y   + E++   + +  VSA D D   NA+I YSL+E     +G+   FSIN   G I T    DRE  S Y  TV A D G PS S T  + + V D ND  P F+   Y+ +I+E   +  V  ++  + A+D D+  NG + Y        +++ D E    F +  T +G +     +DRE  +  ++  IA D G PPLS+++ V + L D+ND  P  TF S     +V  +S    G ++ ++ A D D  +N  V + ++G +
Sbjct:  469 FEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET------SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI---------IGGNTQSQFSIDSMSG--------DVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--------SSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNT----------RGRFAITSQNGRGLITIAQ-------SLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILE---DALVGTSVIQVAASDPDVGLNGRIKY-------LLSDRDIEDGS-FVIDPT-SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP--TFASDKITLYVPENS--PVGSVVGEIHAHDPDEGVNAVVHYSIIGGD 1156          

HSP 4 Score: 112.079 bits (279), Expect = 2.598e-24
Identity = 92/348 (26.44%), Postives = 151/348 (43.39%), Query Frame = 1
Query: 1534 NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-----------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPS---RSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK 2532
            + S DRE +D +   ++  D   P  + +    V VLD ND+SP F    +E  I E +   S + ++ A D+D  +NA+I+Y ++ + +           I+   +  GVI T+   DRE    Y+  V A+D        R++TAS+ VKVLD ND  P F  + Y   + E        N +  I A D D   N  + Y I                +F +  + +G +SL   +D E   +  + + A+D G P  SN+  + V + D ND+ P F           N+      GY + ++ A D D   N  + + +   +   P+ +  D R    ++IK
Sbjct:  419 SASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG---------GNTQSQFSID-SMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP----VGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAV--DPRTGWVQTIK 750          

HSP 5 Score: 110.538 bits (275), Expect = 6.745e-24
Identity = 136/606 (22.44%), Postives = 245/606 (40.43%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNL-IQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGV----IFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVH---NNLGLIEANDEDLDE 2079
            +S F+  + EN P+   +I ++A       E  +  +  S + R  N  + ++  TG +  I  +DREE  +      +    +   S    +   + D+ND  P F  +  E ++ ED P G  +    A+D D           E+     +I T      F  +S     +      + + + +D +  +++  T+ A D+ G+     + +NI D N+ +P +   PY  +V ++      +  + A D+D    +N+++ + ++   +                 I+    L        ++ +   DGG   L +TTD+ I + D NDNAP        A I E+      +  +   D D+ +N      L+D      +++   S       P  G +         NK  DRE V  + +  I +DKGSP L+S+ +  + + D ND+ P F        + ENS   S +G + A D D   NA + YS+   +  N +  +   G     + T  + D E  +   F ++      P R+  A I + V D ND  P+ R   +F ++  + N   H     +G I A D D+ +
Sbjct:  691 TSQFQESVLENVPVGYNIIRVQAY---DSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD-----------EDSRLHYEITTGNTRGRFAITSQNGRGL------ITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD--VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSD------RDIEDGSFVID---PTSGTI-------RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYE-STRKRFELVVRAASPPLRND-AHIEILVTDVNDNAPVLR---DFQVI--FNNFRDHFPSGEIGRIPAFDADVSD 1251          

HSP 6 Score: 90.1225 bits (222), Expect = 1.115e-17
Identity = 84/324 (25.93%), Postives = 152/324 (46.91%), Query Frame = 1
Query: 1654 DNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS----LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPP---LSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGY---LLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + SP F +++Y   ++E     + + +V A D    E++ + YS    LD      F ++   GV+ T    DRE   ++ F V+A+D+  P RS T ++ V VLD ND  P F  +Q+E +I E      V + +  + A D+D+ +N  + Y I A +        ++   F++  +++G +S    +DRE   + ++ V A D         + + +V V + D ND+ P F    S     V +  +   G     +A + A D D   N ++ + ++G  + S  +I+   G V L   +K   +   +S R+++RA D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIRE---GATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRID-SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSL---VKPLDYESVRSYRLVIRAQD 663          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 223.402 bits (568), Expect = 4.343e-59
Identity = 198/706 (28.05%), Postives = 333/706 (47.17%), Query Frame = 1
Query:  556 GSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            G  + E    I+D ND  P F+   + LSI E+  +G +  +PVA+D DS   GIA Y +    ++T++        F     +D + K+  PQL V+  +DRE R+ Y   +  +D  +  ++    + + I D NDN P++    Y+  + E       +  +KA D+D     N ++ + +      +S  +  +    +  +I ++G++  + ++ +K  V  K  D G    ++   +TI++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+        T N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ ++YE E  E +    ++  V A D DS  NA++ YS+    +    F IN   G +    + DREQ   Y F V A+D G PS   TA+++VKVLD+ND  P F    Y F++ E   NM   + +G++  ND D  EN  V   +         PD  K   F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T P+++S  F++  +  ET   +  ++AED D  LN  + F +VG        I  +G + L +    +   +    R++V+  D+     Q+
Sbjct:  139 GPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL--------FSLQVAQDSDEKL--PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQP---SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAK--DNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASE----TGNDRKRK-----YFLQTT--TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE---NMPPLSPVGMVTVNDHDEGENARVQLSV--------EPDNGK---FMIQ---NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGL---HRLVVKVKDKGTPPRQT 794          

HSP 2 Score: 139.428 bits (350), Expect = 8.669e-33
Identity = 161/603 (26.70%), Postives = 255/603 (42.29%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKI-KENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I D ND VP F +   E  + E+ P+GH +    A+D D    G  +Y +     S+ +M        +  SI D    II     V   +DRE      F + A D   + K     + + +KD NDN+P    + IGL  ++  V   +    + +  A     D D+  N      +   + F++ +A + GN RK    L  ++          + + E +  + +  VD G   L +T  L + + D NDNAP+ S T    +  +EN+   ++L ++   D D   N E        TY      +   L   N  P  G V +           DRE++D Y  L+   DKG P L  +    V VLD NDN P F  + Y F + EN    S +G V+  D D  ENA+++ S++     +   N    I +   FDRE++S Y+F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +     V +    +EA D D+  N  + + I   +P+           F+  I+  G+++L      +      + V  +D G PP   +  V + +N+
Sbjct:  257 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ--PSSPVM--------RLLSI-DRNTGII----FVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLD------YERIKEYR--IEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVAT-DADSGTNAEL-------TYSITGGSVPEGLFEIN--PNTGEVRVM-------SQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVES----VEAEDIDIGLNSELDFNIVGGNPH---------GLFR--ISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNE 804          

HSP 3 Score: 98.9821 bits (245), Expect = 2.470e-20
Identity = 136/585 (23.25%), Postives = 242/585 (41.37%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII----YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E EL EN P+   ++ +KA         +  + +   +  +  L+ ++  TG + +  SVDREE+       Q KDN        +       +T  + D ND  P+   + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      +  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD  +  N++L + I    +                +    G ++ M+++        + +V     D G   L+ T  + + + D NDN P   +   S  ++EN   L  + ++TV D D   N      +                      P  G  +I    Y I +    SFDREK   YS  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + + SV A D D   N+++ +++   GN +  F I+  G I   ++F  +   L+   V   D G P R +TA + + V
Sbjct:  274 SHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKAL------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVV-----AGDV---PFQLRSASETGNDRKRKYF---LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGSVPEG----------LFEINPNTGEVRVMSQLDREQLDHYQFLV--AAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSV---------------------EPDNGKFMIQNGTYTILS--TISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 802          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 222.631 bits (566), Expect = 5.249e-59
Identity = 198/706 (28.05%), Postives = 333/706 (47.17%), Query Frame = 1
Query:  556 GSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            G  + E    I+D ND  P F+   + LSI E+  +G +  +PVA+D DS   GIA Y +    ++T++        F     +D + K+  PQL V+  +DRE R+ Y   +  +D  +  ++    + + I D NDN P++    Y+  + E       +  +KA D+D     N ++ + +      +S  +  +    +  +I ++G++  + ++ +K  V  K  D G    ++   +TI++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+        T N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ ++YE E  E +    ++  V A D DS  NA++ YS+    +    F IN   G +    + DREQ   Y F V A+D G PS   TA+++VKVLD+ND  P F    Y F++ E   NM   + +G++  ND D  EN  V   +         PD  K   F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T P+++S  F++  +  ET   +  ++AED D  LN  + F +VG        I  +G + L +    +   +    R++V+  D+     Q+
Sbjct:  121 GPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL--------FSLQVAQDSDEKL--PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQP---SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAK--DNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASE----TGNDRKRK-----YFLQTT--TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE---NMPPLSPVGMVTVNDHDEGENARVQLSV--------EPDNGK---FMIQ---NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGL---HRLVVKVKDKGTPPRQT 776          

HSP 2 Score: 138.658 bits (348), Expect = 1.361e-32
Identity = 161/603 (26.70%), Postives = 255/603 (42.29%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKI-KENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I D ND VP F +   E  + E+ P+GH +    A+D D    G  +Y +     S+ +M        +  SI D    II     V   +DRE      F + A D   + K     + + +KD NDN+P    + IGL  ++  V   +    + +  A     D D+  N      +   + F++ +A + GN RK    L  ++          + + E +  + +  VD G   L +T  L + + D NDNAP+ S T    +  +EN+   ++L ++   D D   N E        TY      +   L   N  P  G V +           DRE++D Y  L+   DKG P L  +    V VLD NDN P F  + Y F + EN    S +G V+  D D  ENA+++ S++     +   N    I +   FDRE++S Y+F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +     V +    +EA D D+  N  + + I   +P+           F+  I+  G+++L      +      + V  +D G PP   +  V + +N+
Sbjct:  239 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ--PSSPVM--------RLLSI-DRNTGII----FVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLD------YERIKEYR--IEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVAT-DADSGTNAEL-------TYSITGGSVPEGLFEIN--PNTGEVRVM-------SQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVES----VEAEDIDIGLNSELDFNIVGGNPH---------GLFR--ISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNE 786          

HSP 3 Score: 97.4413 bits (241), Expect = 6.462e-20
Identity = 136/585 (23.25%), Postives = 242/585 (41.37%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII----YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E EL EN P+   ++ +KA         +  + +   +  +  L+ ++  TG + +  SVDREE+       Q KDN        +       +T  + D ND  P+   + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      +  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD  +  N++L + I    +                +    G ++ M+++        + +V     D G   L+ T  + + + D NDN P   +   S  ++EN   L  + ++TV D D   N      +                      P  G  +I    Y I +    SFDREK   YS  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + + SV A D D   N+++ +++   GN +  F I+  G I   ++F  +   L+   V   D G P R +TA + + V
Sbjct:  256 SHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKAL------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVV-----AGDV---PFQLRSASETGNDRKRKYF---LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGSVPEG----------LFEINPNTGEVRVMSQLDREQLDHYQFLV--AAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSV---------------------EPDNGKFMIQNGTYTILS--TISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 784          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 222.631 bits (566), Expect = 5.564e-59
Identity = 198/706 (28.05%), Postives = 334/706 (47.31%), Query Frame = 1
Query:  556 GSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            G  + E    I+D ND  P F+   + LSI E+  +G +  +PVA+D DS   GIA Y +    ++T++        F     +D + K+  PQL V+  +DRE R+ Y   +  +D  +  ++    + + I D NDN P++    Y+  + E       +  +KA D+D     N ++ + +      +S  +  +    +  +I ++G++  + ++ +K  V  K  D G    ++   +TI++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+     +  T N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ ++YE E  E +    ++  V A D DS  NA++ YS+    +    F IN   G +    + DREQ   Y F V A+D G PS   TA+++VKVLD+ND  P F    Y F++ E   NM   + +G++  ND D  EN  V   +         PD  K   F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T P+++S  F++  +  ET   +  ++AED D  LN  + F +VG        I  +G + L +    +   +    R++V+  D+     Q+
Sbjct:  140 GPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL--------FSLQVAQDSDEKL--PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQP---SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAK--DNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRS----ASETGNDRKRK-----YFLQTT--TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE---NMPPLSPVGMVTVNDHDEGENARVQLSV--------EPDNGK---FMIQ---NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGL---HRLVVKVKDKGTPPRQT 795          

HSP 2 Score: 138.658 bits (348), Expect = 1.215e-32
Identity = 161/603 (26.70%), Postives = 255/603 (42.29%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKI-KENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I D ND VP F +   E  + E+ P+GH +    A+D D    G  +Y +     S+ +M        +  SI D    II     V   +DRE      F + A D   + K     + + +KD NDN+P    + IGL  ++  V   +    + +  A     D D+  N      +   + F++ +A + GN RK    L  ++          + + E +  + +  VD G   L +T  L + + D NDNAP+ S T    +  +EN+   ++L ++   D D   N E        TY      +   L   N  P  G V +           DRE++D Y  L+   DKG P L  +    V VLD NDN P F  + Y F + EN    S +G V+  D D  ENA+++ S++     +   N    I +   FDRE++S Y+F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +     V +    +EA D D+  N  + + I   +P+           F+  I+  G+++L      +      + V  +D G PP   +  V + +N+
Sbjct:  258 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ--PSSPVM--------RLLSI-DRNTGII----FVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLD------YERIKEYR--IEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVAT-DADSGTNAEL-------TYSITGGSVPEGLFEIN--PNTGEVRVM-------SQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVES----VEAEDIDIGLNSELDFNIVGGNPH---------GLFR--ISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNE 805          

HSP 3 Score: 97.0561 bits (240), Expect = 8.361e-20
Identity = 136/585 (23.25%), Postives = 242/585 (41.37%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII----YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E EL EN P+   ++ +KA         +  + +   +  +  L+ ++  TG + +  SVDREE+       Q KDN        +       +T  + D ND  P+   + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      +  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD  +  N++L + I    +                +    G ++ M+++        + +V     D G   L+ T  + + + D NDN P   +   S  ++EN   L  + ++TV D D   N      +                      P  G  +I    Y I +    SFDREK   YS  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + + SV A D D   N+++ +++   GN +  F I+  G I   ++F  +   L+   V   D G P R +TA + + V
Sbjct:  275 SHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKAL------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVV-----AGDV---PFQLRSASETGNDRKRKYF---LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGSVPEG----------LFEINPNTGEVRVMSQLDREQLDHYQFLV--AAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSV---------------------EPDNGKFMIQNGTYTILS--TISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 803          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 222.631 bits (566), Expect = 6.010e-59
Identity = 198/706 (28.05%), Postives = 334/706 (47.31%), Query Frame = 1
Query:  556 GSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            G  + E    I+D ND  P F+   + LSI E+  +G +  +PVA+D DS   GIA Y +    ++T++        F     +D + K+  PQL V+  +DRE R+ Y   +  +D  +  ++    + + I D NDN P++    Y+  + E       +  +KA D+D     N ++ + +      +S  +  +    +  +I ++G++  + ++ +K  V  K  D G    ++   +TI++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+     +  T N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ ++YE E  E +    ++  V A D DS  NA++ YS+    +    F IN   G +    + DREQ   Y F V A+D G PS   TA+++VKVLD+ND  P F    Y F++ E   NM   + +G++  ND D  EN  V   +         PD  K   F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T P+++S  F++  +  ET   +  ++AED D  LN  + F +VG        I  +G + L +    +   +    R++V+  D+     Q+
Sbjct:  134 GPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL--------FSLQVAQDSDEKL--PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQP---SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAK--DNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRS----ASETGNDRKRK-----YFLQTT--TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE---NMPPLSPVGMVTVNDHDEGENARVQLSV--------EPDNGK---FMIQ---NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETH--VESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGL---HRLVVKVKDKGTPPRQT 789          

HSP 2 Score: 138.658 bits (348), Expect = 1.261e-32
Identity = 159/602 (26.41%), Postives = 251/602 (41.69%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I D ND VP F +   E  + E+ P+GH +    A+D D    G  +Y +     S+ +M        +  SI D    II     V   +DRE      F + A D   + K     + + +KD NDN+P    + IGL  ++  V   +    + +  A     D D+  N      +   + F++ +A + GN RK    L  ++          + + E +  + +  VD G   L +T  L + + D NDNAP+ S T    +  E  +  + +  +   D D   N E        TY      +   L   N  P  G V +           DRE++D Y  L+   DKG P L  +    V VLD NDN P F  + Y F + EN    S +G V+  D D  ENA+++ S++     +   N    I +   FDRE++S Y+F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +     V +    +EA D D+  N  + + I   +P+           F+  I+  G+++L      +      + V  +D G PP   +  V + +N+
Sbjct:  252 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ--PSSPVM--------RLLSI-DRNTGII----FVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLD------YERIKEYR--IEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAEL-------TYSITGGSVPEGLFEIN--PNTGEVRVM-------SQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVES----VEAEDIDIGLNSELDFNIVGGNPH---------GLFR--ISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNE 799          

HSP 3 Score: 97.4413 bits (241), Expect = 7.620e-20
Identity = 136/585 (23.25%), Postives = 242/585 (41.37%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII----YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E EL EN P+   ++ +KA         +  + +   +  +  L+ ++  TG + +  SVDREE+       Q KDN        +       +T  + D ND  P+   + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      +  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD  +  N++L + I    +                +    G ++ M+++        + +V     D G   L+ T  + + + D NDN P   +   S  ++EN   L  + ++TV D D   N      +                      P  G  +I    Y I +    SFDREK   YS  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + + SV A D D   N+++ +++   GN +  F I+  G I   ++F  +   L+   V   D G P R +TA + + V
Sbjct:  269 SHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKAL------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVV-----AGDV---PFQLRSASETGNDRKRKYF---LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGSVPEG----------LFEINPNTGEVRVMSQLDREQLDHYQFLV--AAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSV---------------------EPDNGKFMIQNGTYTILS--TISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 797          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 223.016 bits (567), Expect = 6.022e-59
Identity = 198/706 (28.05%), Postives = 333/706 (47.17%), Query Frame = 1
Query:  556 GSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            G  + E    I+D ND  P F+   + LSI E+  +G +  +PVA+D DS   GIA Y +    ++T++        F     +D + K+  PQL V+  +DRE R+ Y   +  +D  +  ++    + + I D NDN P++    Y+  + E       +  +KA D+D     N ++ + +      +S  +  +    +  +I ++G++  + ++ +K  V  K  D G    ++   +TI++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+        T N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ ++YE E  E +    ++  V A D DS  NA++ YS+    +    F IN   G +    + DREQ   Y F V A+D G PS   TA+++VKVLD+ND  P F    Y F++ E   NM   + +G++  ND D  EN  V   +         PD  K   F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T P+++S  F++  +  ET   +  ++AED D  LN  + F +VG        I  +G + L +    +   +    R++V+  D+     Q+
Sbjct:  144 GPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL--------FSLQVAQDSDEKL--PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSD--MGPNGEVTYSLHQP---SSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAK--DNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASE----TGNDRKRK-----YFLQTT--TLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQE---NMPPLSPVGMVTVNDHDEGENARVQLSV--------EPDNGK---FMIQ---NGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGL---HRLVVKVKDKGTPPRQT 799          

HSP 2 Score: 139.428 bits (350), Expect = 8.872e-33
Identity = 158/602 (26.25%), Postives = 250/602 (41.53%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I D ND VP F +   E  + E+ P+GH +    A+D D    G  +Y +     S+ +M        +  SI D    II     V   +DRE      F + A D   + K     + + +KD NDN+P    + IGL  ++  V   +    + +  A     D D+  N      +   + F++ +A + GN RK    L  ++          + + E +  + +  VD G   L +T  L + + D NDNAP+ S T    +  E  +  + +  +   D D   N E        TY      +   L   N  P  G V +           DRE++D Y  L+   DKG P L  +    V VLD NDN P F  + Y F + EN    S +G V+  D D  ENA+++ S++     +   N    I +   FDRE++S Y+F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +     V +    +EA D D+  N  + + I   +P+              +I+  G+++L      +      + V  +D G PP   +  V + +N+
Sbjct:  262 LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQ--PSSPVM--------RLLSI-DRNTGII----FVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLD------YERIKEYR--IEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAEL-------TYSITGGSVPEGLFEIN--PNTGEVRVM-------SQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPETHVES----VEAEDIDIGLNSELDFNIVGGNPH-----------GLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYVNE 809          

HSP 3 Score: 98.5969 bits (244), Expect = 2.815e-20
Identity = 136/585 (23.25%), Postives = 242/585 (41.37%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII----YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E EL EN P+   ++ +KA         +  + +   +  +  L+ ++  TG + +  SVDREE+       Q KDN        +       +T  + D ND  P+   + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      +  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD  +  N++L + I    +                +    G ++ M+++        + +V     D G   L+ T  + + + D NDN P   +   S  ++EN   L  + ++TV D D   N      +                      P  G  +I    Y I +    SFDREK   YS  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + + SV A D D   N+++ +++   GN +  F I+  G I   ++F  +   L+   V   D G P R +TA + + V
Sbjct:  279 SHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKAL------VTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVV-----AGDV---PFQLRSASETGNDRKRKYF---LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDAD--SGTNAELTYSITGGSVPEG----------LFEINPNTGEVRVMSQLDREQLDHYQFLV--AAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSV---------------------EPDNGKFMIQNGTYTILS--TISFDREKESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVG-GNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 807          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 239.195 bits (609), Expect = 4.018e-64
Identity = 218/784 (27.81%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  382 AFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQ--QKDNDC------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
             + ++KH + +  G+  LR    ++  TG ++   +S+DRE L  CQ  +    C      S   ++S    + +    I+D+ND  P F    I LSI E+  IG +  +P A+D DS   G++SY++        I+    +D F     +D + K  QPQL V+  +DRE R+ Y  T+   D  T  +     + ++I D NDN+P++  + Y+  + E       +  +KA D+D    +N+++D+    A     R+L  +   +    +      + +  +K  V  K  D G    T  T +TI+I+D NDN P+I I            A I E+      + ++ V D D  +N   +C +       LK+V      +K +         Y ++T    + D E V  Y++ I+ +D G+P L+S+    V V D NDN+P+F++S+ E    EN+  +  +  VSA D DS  N+++ YS+  D      FSIN   G I      DREQ+  Y+F V+A D G PS   TAS+++ VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  +   +             ++  F +Q   NG  ++   I  DRE QST    + A D G PP S+ + VT+ + D ND+ PV   PS+ S  +  ++ +   G  +  + AED D  +N  + + +          I   +G V L+++I  + + +    R++V+ +D+ +    S  G+ ++ +Y
Sbjct:   91 GYPDSKHLYKLELGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--------IVGPEAQDLFGLQVAEDQDEK--QPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKK---------YFLQTT--TALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVME---NMPRLSPVGMVTVIDADKGENAHIHLSV-----------EPESGEFVIQ---NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY--LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGL---HRLVVKVTDKGK---PSRHGTALVHFY 819          

HSP 2 Score: 145.206 bits (365), Expect = 1.693e-34
Identity = 152/600 (25.33%), Postives = 248/600 (41.33%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGL-PYKITV----KECTTSREIFSLKAFDADDQNN------INSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNN--LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I+D ND  P F K   E  + E+ P+GH +    A+D D    G+ + +I+  F        R     + + +           + V   IDRE      F++VA D     K     + + I+D NDN P    +  GL  ++  V    ++      +  ++  D D+  N      +   + F++   +  G+  K    L  ++        AL   +  +  + +  VD G   L +T  L + + D NDNAP+ S +       EN    +++  ++  D D   N +         Y  L +  +R + + N  P  G + +       N   DRE+ + Y   ++ +DKG P L  +    + VLD NDN P F  + Y F +MEN    S +G V+  D D  ENA I  S++     +   N  G I +   FDRE +S Y F + A D G+P RSS   + + VLD+ND  P+       NI   Y     H    +  + A D D   N  + Y I + +P+         + F++    NG+++L   I R+      + V   D GKP    +  V   +N+
Sbjct:  274 LRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNA-EIDYSFHQASDTVRRLLHLDRSTGL-----------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTT--------ALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLH-------YSILPDPSARGIFSIN--PDSGQIRV-------NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVI--VVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF---------ELFQIS-HNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINE 822          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 240.35 bits (612), Expect = 4.214e-64
Identity = 215/782 (27.49%), Postives = 366/782 (46.80%), Query Frame = 1
Query:  382 AFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQ--QKDNDC------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
             + ++KH + +  G+  LR    ++  TG ++   +S+DRE L  CQ  +    C      S   ++S    + +    I+D+ND  P F    I LSI E+  IG +  +P A+D DS   G++SY++        I+    +D F     +D + K  QPQL V+  +DRE R+ Y  T+   D  T  +     + ++I D NDN+P++  + Y+  + E       +  +KA D+D    +N+++D+    A     R+L  +   +    +      + +  +K  V  K          T +TI+I+D NDN P+I I            A I E+      + ++ V D D  +N   +C +       LK+V      +K +         Y ++T    + D E V  Y++ I+ +D G+P L+S+    V V D NDN+P+F++S+ E    EN+  +  +  VSA D DS  N+++ YS+  D      FSIN   G I      DREQ+  Y+F V+A D G PS   TAS+++ VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  +   +             ++  F +Q   NG  ++   I  DRE QST    + A D G PP S+ + VT+ + D ND+ PV   PS+ S  +  ++ +   G  +  + AED D  +N  + + +          I   +G V L+++I  + + +    R++V+ +D+ +    S  G+ ++ +Y
Sbjct:   83 GYPDSKHLYKLELGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--------IVGPEAQDLFGLQVAEDQDEK--QPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKK---------YFLQTT--TALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVME---NMPRLSPVGMVTVIDADKGENAHIHLSV-----------EPESGEFVIQ---NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY--LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGL---HRLVVKVTDKGK---PSRHGTALVHFY 811          

HSP 2 Score: 146.362 bits (368), Expect = 1.093e-34
Identity = 152/600 (25.33%), Postives = 248/600 (41.33%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGL-PYKITV----KECTTSREIFSLKAFDADDQNN------INSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNN--LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I+D ND  P F K   E  + E+ P+GH +    A+D D    G+ + +I+  F        R     + + +           + V   IDRE      F++VA D     K     + + I+D NDN P    +  GL  ++  V    ++      +  ++  D D+  N      +   + F++   +  G+  K    L  ++        AL   +  +  + +  VD G   L +T  L + + D NDNAP+ S +       EN    +++  ++  D D   N +         Y  L +  +R + + N  P  G + +       N   DRE+ + Y   ++ +DKG P L  +    + VLD NDN P F  + Y F +MEN    S +G V+  D D  ENA I  S++     +   N  G I +   FDRE +S Y F + A D G+P RSS   + + VLD+ND  P+       NI   Y     H    +  + A D D   N  + Y I + +P+         + F++    NG+++L   I R+      + V   D GKP    +  V   +N+
Sbjct:  266 LRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNA-EIDYSFHQASDTVRRLLHLDRSTGL-----------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTT--------ALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLH-------YSILPDPSARGIFSIN--PDSGQIRV-------NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVI--VVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF---------ELFQIS-HNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINE 814          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 239.965 bits (611), Expect = 6.062e-64
Identity = 215/782 (27.49%), Postives = 366/782 (46.80%), Query Frame = 1
Query:  382 AFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQ--QKDNDC------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
             + ++KH + +  G+  LR    ++  TG ++   +S+DRE L  CQ  +    C      S   ++S    + +    I+D+ND  P F    I LSI E+  IG +  +P A+D DS   G++SY++        I+    +D F     +D + K  QPQL V+  +DRE R+ Y  T+   D  T  +     + ++I D NDN+P++  + Y+  + E       +  +KA D+D    +N+++D+    A     R+L  +   +    +      + +  +K  V  K          T +TI+I+D NDN P+I I            A I E+      + ++ V D D  +N   +C +       LK+V      +K +         Y ++T    + D E V  Y++ I+ +D G+P L+S+    V V D NDN+P+F++S+ E    EN+  +  +  VSA D DS  N+++ YS+  D      FSIN   G I      DREQ+  Y+F V+A D G PS   TAS+++ VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  +   +             ++  F +Q   NG  ++   I  DRE QST    + A D G PP S+ + VT+ + D ND+ PV   PS+ S  +  ++ +   G  +  + AED D  +N  + + +          I   +G V L+++I  + + +    R++V+ +D+ +    S  G+ ++ +Y
Sbjct:   91 GYPDSKHLYKLELGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--------IVGPEAQDLFGLQVAEDQDEK--QPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKK---------YFLQTT--TALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVME---NMPRLSPVGMVTVIDADKGENAHIHLSV-----------EPESGEFVIQ---NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY--LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGL---HRLVVKVTDKGK---PSRHGTALVHFY 819          

HSP 2 Score: 145.976 bits (367), Expect = 1.496e-34
Identity = 152/600 (25.33%), Postives = 248/600 (41.33%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGL-PYKITV----KECTTSREIFSLKAFDADDQNN------INSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNN--LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I+D ND  P F K   E  + E+ P+GH +    A+D D    G+ + +I+  F        R     + + +           + V   IDRE      F++VA D     K     + + I+D NDN P    +  GL  ++  V    ++      +  ++  D D+  N      +   + F++   +  G+  K    L  ++        AL   +  +  + +  VD G   L +T  L + + D NDNAP+ S +       EN    +++  ++  D D   N +         Y  L +  +R + + N  P  G + +       N   DRE+ + Y   ++ +DKG P L  +    + VLD NDN P F  + Y F +MEN    S +G V+  D D  ENA I  S++     +   N  G I +   FDRE +S Y F + A D G+P RSS   + + VLD+ND  P+       NI   Y     H    +  + A D D   N  + Y I + +P+         + F++    NG+++L   I R+      + V   D GKP    +  V   +N+
Sbjct:  274 LRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNA-EIDYSFHQASDTVRRLLHLDRSTGL-----------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTT--------ALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLH-------YSILPDPSARGIFSIN--PDSGQIRV-------NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVI--VVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF---------ELFQIS-HNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINE 822          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 239.195 bits (609), Expect = 6.525e-64
Identity = 218/784 (27.81%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  382 AFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQ--QKDNDC------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
             + ++KH + +  G+  LR    ++  TG ++   +S+DRE L  CQ  +    C      S   ++S    + +    I+D+ND  P F    I LSI E+  IG +  +P A+D DS   G++SY++        I+    +D F     +D + K  QPQL V+  +DRE R+ Y  T+   D  T  +     + ++I D NDN+P++  + Y+  + E       +  +KA D+D    +N+++D+    A     R+L  +   +    +      + +  +K  V  K  D G    T  T +TI+I+D NDN P+I I            A I E+      + ++ V D D  +N   +C +       LK+V      +K +         Y ++T    + D E V  Y++ I+ +D G+P L+S+    V V D NDN+P+F++S+ E    EN+  +  +  VSA D DS  N+++ YS+  D      FSIN   G I      DREQ+  Y+F V+A D G PS   TAS+++ VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  +   +             ++  F +Q   NG  ++   I  DRE QST    + A D G PP S+ + VT+ + D ND+ PV   PS+ S  +  ++ +   G  +  + AED D  +N  + + +          I   +G V L+++I  + + +    R++V+ +D+ +    S  G+ ++ +Y
Sbjct:   91 GYPDSKHLYKLELGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--------IVGPEAQDLFGLQVAEDQDEK--QPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKK---------YFLQTT--TALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVME---NMPRLSPVGMVTVIDADKGENAHIHLSV-----------EPESGEFVIQ---NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY--LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGL---HRLVVKVTDKGK---PSRHGTALVHFY 819          

HSP 2 Score: 145.591 bits (366), Expect = 1.606e-34
Identity = 152/600 (25.33%), Postives = 248/600 (41.33%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGL-PYKITV----KECTTSREIFSLKAFDADDQNN------INSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNN--LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I+D ND  P F K   E  + E+ P+GH +    A+D D    G+ + +I+  F        R     + + +           + V   IDRE      F++VA D     K     + + I+D NDN P    +  GL  ++  V    ++      +  ++  D D+  N      +   + F++   +  G+  K    L  ++        AL   +  +  + +  VD G   L +T  L + + D NDNAP+ S +       EN    +++  ++  D D   N +         Y  L +  +R + + N  P  G + +       N   DRE+ + Y   ++ +DKG P L  +    + VLD NDN P F  + Y F +MEN    S +G V+  D D  ENA I  S++     +   N  G I +   FDRE +S Y F + A D G+P RSS   + + VLD+ND  P+       NI   Y     H    +  + A D D   N  + Y I + +P+         + F++    NG+++L   I R+      + V   D GKP    +  V   +N+
Sbjct:  274 LRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNA-EIDYSFHQASDTVRRLLHLDRSTGL-----------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTT--------ALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLH-------YSILPDPSARGIFSIN--PDSGQIRV-------NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVI--VVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF---------ELFQIS-HNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINE 822          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 238.039 bits (606), Expect = 9.757e-64
Identity = 218/784 (27.81%), Postives = 369/784 (47.07%), Query Frame = 1
Query:  382 AFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQ--QKDNDC------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
             + ++KH + +  G+  LR    ++  TG ++   +S+DRE L  CQ  +    C      S   ++S    + +    I+D+ND  P F    I LSI E+  IG +  +P A+D DS   G++SY++        I+    +D F     +D + K  QPQL V+  +DRE R+ Y  T+   D  T  +     + ++I D NDN+P++  + Y+  + E       +  +KA D+D    +N+++D+    A     R+L  +   +    +      + +  +K  V  K  D G    T  T +TI+I+D NDN P+I I            A I E+      + ++ V D D  +N   +C +       LK+V      +K +         Y ++T    + D E V  Y++ I+ +D G+P L+S+    V V D NDN+P+F++S+ E    EN+  +  +  VSA D DS  N+++ YS+  D      FSIN   G I      DREQ+  Y+F V+A D G PS   TAS+++ VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  +   +             ++  F +Q   NG  ++   I  DRE QST    + A D G PP S+ + VT+ + D ND+ PV   PS+ S  +  ++ +   G  +  + AED D  +N  + + +          I   +G V L+++I  + + +    R++V+ +D+ +    S  G+ ++ +Y
Sbjct:   91 GYPDSKHLYKLELGHPYLR----VDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYEL--------IVGPEAQDLFGLQVAEDQDEK--QPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSD--QGVNAEIDYSFHQAS-DTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK--DKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKK---------YFLQTT--TALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVME---NMPRLSPVGMVTVIDADKGENAHIHLSV-----------EPESGEFVIQ---NGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY--LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAIIRKHYGL---HRLVVKVTDKGK---PSRHGTALVHFY 819          

HSP 2 Score: 144.821 bits (364), Expect = 2.323e-34
Identity = 152/600 (25.33%), Postives = 248/600 (41.33%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGL-PYKITV----KECTTSREIFSLKAFDADDQNN------INSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNN--LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   I+D ND  P F K   E  + E+ P+GH +    A+D D    G+ + +I+  F        R     + + +           + V   IDRE      F++VA D     K     + + I+D NDN P    +  GL  ++  V    ++      +  ++  D D+  N      +   + F++   +  G+  K    L  ++        AL   +  +  + +  VD G   L +T  L + + D NDNAP+ S +       EN    +++  ++  D D   N +         Y  L +  +R + + N  P  G + +       N   DRE+ + Y   ++ +DKG P L  +    + VLD NDN P F  + Y F +MEN    S +G V+  D D  ENA I  S++     +   N  G I +   FDRE +S Y F + A D G+P RSS   + + VLD+ND  P+       NI   Y     H    +  + A D D   N  + Y I + +P+         + F++    NG+++L   I R+      + V   D GKP    +  V   +N+
Sbjct:  274 LRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNA-EIDYSFHQASDTVRRLLHLDRSTGL-----------ITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTT--------ALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLH-------YSILPDPSARGIFSIN--PDSGQIRV-------NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVI--VVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPF---------ELFQIS-HNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINE 822          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 233.417 bits (594), Expect = 2.261e-62
Identity = 205/731 (28.04%), Postives = 337/731 (46.10%), Query Frame = 1
Query:  484 SSVDREEL--CQQK--DNDC------SHIVIISFGS-FIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            +S+DRE L  CQ +   N C      S   ++  GS  + E    + D+ND  P FA   I L+I E+  IG +  +P+A+D D+   G+ASY+++   ++        ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E       +  +KA D+D     N+++D+    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+SI E    EN+     +  V+A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  + + + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:   91 TSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEA--------QELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENARVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 775          

HSP 2 Score: 159.073 bits (401), Expect = 7.156e-39
Identity = 156/602 (25.91%), Postives = 253/602 (42.03%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG--LIEANDEDLDE--NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +I+  F     +  R     + + +           + V   +DRE      F+++A D     K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G + +         S DRE+ D Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG  + +   ED+D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  244 LRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQG----ANAEIDYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLE-------PEPAAQGLFTIS--PENGEIRV-------KTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSN----TSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 792          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 233.417 bits (594), Expect = 2.261e-62
Identity = 205/731 (28.04%), Postives = 337/731 (46.10%), Query Frame = 1
Query:  484 SSVDREEL--CQQK--DNDC------SHIVIISFGS-FIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            +S+DRE L  CQ +   N C      S   ++  GS  + E    + D+ND  P FA   I L+I E+  IG +  +P+A+D D+   G+ASY+++   ++        ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E       +  +KA D+D     N+++D+    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+SI E    EN+     +  V+A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  + + + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:   91 TSIDREGLRECQNQIPGNPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEA--------QELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENARVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 775          

HSP 2 Score: 159.073 bits (401), Expect = 7.156e-39
Identity = 156/602 (25.91%), Postives = 253/602 (42.03%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG--LIEANDEDLDE--NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +I+  F     +  R     + + +           + V   +DRE      F+++A D     K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G + +         S DRE+ D Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG  + +   ED+D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  244 LRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQG----ANAEIDYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLE-------PEPAAQGLFTIS--PENGEIRV-------KTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSN----TSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 792          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 226.868 bits (577), Expect = 3.768e-60
Identity = 191/682 (28.01%), Postives = 314/682 (46.04%), Query Frame = 1
Query:  598 NDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ND  P FA   I L+I E+  IG +  +P+A+D D+   G+ASY+++             ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E +     +  +KA D+D     N+++D+    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+SI E    EN+     +  V+A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  + + + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQ--------AGPEAQELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSD--QGANAEIDYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENARVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL--LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 636          

HSP 2 Score: 159.458 bits (402), Expect = 5.136e-39
Identity = 156/602 (25.91%), Postives = 253/602 (42.03%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG--KRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG--LIEANDEDLDE--NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +I+  F     +  R     + + +           + V   +DRE      F+++A D     K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G + +         S DRE+ D Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG  + +   ED+D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  105 LRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQG----ANAEIDYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLE-------PEPAAQGLFTIS--PENGEIRV-------KTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSN----TSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 653          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 219.935 bits (559), Expect = 1.095e-57
Identity = 212/749 (28.30%), Postives = 341/749 (45.53%), Query Frame = 1
Query:  397 KHRFVIISGNVRLRNLIQLNFVTGSLHLISS-VDREELCQQ--KDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + + V  +G+V L   I++   TG +    + +DRE+LC     D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +I    ++++ E       +  L A DAD   N  +++ F         +++L  +   +    +      +     KL+V     DGG       + +++ D NDN P I I      T+ +  + EN      + ++TV D+D E N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     + EN+   +++  +SA D DS +NA+I Y L       F+++   G++   +K DRE++  Y FTV+A DNG P   S A++ V VLDQND  PIF   +Y F + ES   +  H  +GLI   D D  EN  V   I            +   +F +   ++G +      DRE Q +    V A D G+   S++  VT+ + D+ND+KP+F  P S + SF  +      G ++ K+ A D D  +N  V++ +VG  +     IE+  G + LKE        +    R++V+A+D
Sbjct:   62 QFKLVYKTGDVPL---IRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGEN--ARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLV--LATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQ---------------FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES---LPKHGTVGLITVTDPDYGENSAVTLSI-----------LDVNDQFTID-PQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGL---HRVIVKAND 755          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 218.009 bits (554), Expect = 1.516e-57
Identity = 212/749 (28.30%), Postives = 341/749 (45.53%), Query Frame = 1
Query:  397 KHRFVIISGNVRLRNLIQLNFVTGSLHLISS-VDREELCQQ--KDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASD 2586
            + + V  +G+V L   I++   TG +    + +DRE+LC     D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +I    ++++ E       +  L A DAD   N  +++ F         +++L  +   +    +      +     KL+V     DGG       + +++ D NDN P I I      T+ +  + EN      + ++TV D+D E N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     + EN+   +++  +SA D DS +NA+I Y L       F+++   G++   +K DRE++  Y FTV+A DNG P   S A++ V VLDQND  PIF   +Y F + ES   +  H  +GLI   D D  EN  V   I            +   +F +   ++G +      DRE Q +    V A D G+   S++  VT+ + D+ND+KP+F  P S + SF  +      G ++ K+ A D D  +N  V++ +VG  +     IE+  G + LKE        +    R++V+A+D
Sbjct:   62 QFKLVYKTGDVPL---IRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGEN--ARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLV--LATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQ---------------FLLETA--AFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPES---LPKHGTVGLITVTDPDYGENSAVTLSI-----------LDVNDQFTID-PQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPS-NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGL---HRVIVKAND 755          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 231.876 bits (590), Expect = 5.936e-61
Identity = 213/787 (27.06%), Postives = 360/787 (45.74%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLI-SSVDREEL--CQQK--------DNDCSHIVIISFGS-FIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ++ E +P ++ + +L A     F +  H + +  G   LR    ++  TG +    +S+DRE L  CQ +        + + S   ++  GS  + E    + D+ND  P FA   I L+I E+  IG +  +P+ASD D+   G+ASY+++             ++ F     +D E K  QPQL V+  +DRE  + Y  T+   D        + +L +   D NDN+P++    Y+  + E       +  +KA D+D     N+++++    A     R+L R+   +    +      + ++ ++  V  K            + +++KD NDNAP I I            A I E+      + ++ V D D   N   +C +       L++       +K +         Y ++T      D EKV  Y++ I+ +D G+P L+S+    V V+D NDN+P+FT+S+ E    EN+     I  ++A D DS  NA++ YSL  +      F+I+   G I  K   DREQ+  Y   V+A+D G PS   TA++LV VLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +            +    F +Q   NG  ++   +  DRE+QST    + A D G PP S  + VT+ + D ND+ P  T PS+ S     ++ +   G  ++++ AED D  +N  +++ + G        I    G + L++ I+ R H +    R++V+ SD+
Sbjct:   63 KVPEEQPPNTLIGSLAADY--GFPDVGHLYKLEVGAPYLR----VDGKTGDIFTTETSIDREGLRECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQ--------AGPEAQELFGLQVAEDQEEK--QPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSD--QGANAEIEYTFHQAPE-VVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKK---------YFLQTT--TPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVME---NMPALSPVGMVTVIDGDKGENAQVQLSV-----------EQDNGDFVIQ---NGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKL--LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGLFQIGSHSGAITLEKEIERRHHGL---HRLVVKVSDR 797          

HSP 2 Score: 162.54 bits (410), Expect = 4.601e-39
Identity = 159/602 (26.41%), Postives = 255/602 (42.36%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPYK----ITVKECTTSREIFSL-KAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG----LIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L   ++D ND  P F +   E  + E+ PIGH +    A+D D      A+ +IE  F     +  R     + + +           + V   +DRE      F+++A D  T  K     +V+ +KD+NDN+P    + IGL         + E        +L +  D D+  N      +   + F++  A + G+  K    L  ++         L         + +  VD G   L +T  L + + D NDNAP+ + +       EN +  E++  +T  D D   N E    L         E  ++ L T +  P+ G +   Q++T    S DRE+ + Y + ++  D+GSP L  +    V VLD NDN P F  S Y F +MEN    S +G V+  D D  ENA+++ S+++    +   N  G I +   FDREQ+S Y F + A D G P RS+   + + VLD+ND  P            S+  +     LG     + A D D   N  + Y I   +PY           F++  + +G ++L   I+R       + V   D GKPP   +  V + +N+
Sbjct:  266 LRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQG----ANAEIEYTFHQAPEVVRRLLRLDRNTGL-----------ITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT--------PLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLE-------PEPAAKGLFTIS--PETGEI---QVKT----SLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSN----TSHKLLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY---------GLFQIG-SHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYVNE 814          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.507e-54
Identity = 222/799 (27.78%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
             C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NAKI Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   15 ACVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.971e-54
Identity = 221/799 (27.66%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
             C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NA+I Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   15 ACVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.076e-54
Identity = 221/799 (27.66%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
             C+ FH      +K+ ++ E E+ EN  I   L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S                 + +ET      D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NA+I Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P S + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   15 ACVVFHSGAQ--EKNYTIRE-EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ---------------FLLETA--AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPS-NYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 755          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.514e-54
Identity = 220/799 (27.53%), Postives = 360/799 (45.06%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKL-PTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISS-VDREELCQ--QKDNDCSHIVIIS-FGSFIFELT---FLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE-GKRGHVNIV-LNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASD 2586
            VC+ FH      +K+ ++ E E+ EN  I + L +L   L P        +F ++  +G+V L   I++   TG +    + +DRE+LC    +D  C + V ++     IF L    FLI D+ND  P F    I +SI E+  I     LP A D D    G+ +Y++    KS +I        F    I+  E   + PQL V K++DRE ++ Y   +   D    +R    I+ +++ D NDN P +     ++++ E       +  L A DAD   N  +K+ F         +R+L  +   +    I      +     KL+V     DGG +     + +++ D NDN P I I       + +  + EN      + ++TV D+D + N   +C  +      L+ V S     +N                     D E    Y++ ++  D G P L  S    + V DENDN+P+FT+S     I EN+    ++  VSA D DS  NA+I Y L       FS++   G++   +K DRE++  Y FT++A DNG P  +S  ++ V ++DQND  P+F   +Y+F + E   N+  H  +GLI   D D  +N  V   I            ++   F +  ++ G +      DRE+Q +    V A D G+   S+S  VT+ + D+ND+KPVF  P   + S+  +      G ++ ++ A D D  +N  V + +VG  +     I+++ G + L E        +    R+LV+A+D
Sbjct:   47 VCVVFHSGAQ--EKNYTIRE-EIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPL---IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYEL---IKSQNI--------FGLDVIETPEGDKM-PQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN--AKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLV--LASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENA-----------------AYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPE---NLPRHGTVGLITVTDPDYGDNSAVTLSI-----------LDENDDFTID-SQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP-PYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGL---HRVLVKAND 787          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4E0S0C6 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000360 PE=4 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 7.967e-104
Identity = 277/945 (29.31%), Postives = 437/945 (46.24%), Query Frame = 1
Query:  358 NLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQK---DNDCS-------HIVIISFGSF-----IFELTFLIIDMNDEVPTF----AKQEIELSIL---EDVPIGHVIDLPVASDLDSQKYGIASY---------KIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQ-----------PQLKVIKKIDRETR-EKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWI----------------GLP-------------YKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTA---KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI--TSRSAKIKENKRTLEILTILTVKDEDL--EMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER-----------------------PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIF------------TKSI---------YEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN----------------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSR-SSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWY-------EIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKP-PLSNSITVTVTLNDLNDHKPVFTFPSSASGSF-------------------------------VNISSEFETGYLLAKLDAEDKDYALNGSVVFELV------------GNESLSPVTIEKDGRVILKE----------SIKSRSHRITQSDRILVRASDQ 2589
            NL A LP   +            V    L+QL   TG++     +DRE LC      D  C+       H+  I+   F       +LT L++D+ND  P F    +     L+++   E+ PIG +I LP A+D D+Q++G+  Y         ++  +F   D++  R +   +   +  +++++IQ           P L+ I+++DRET  +++ F L+A DT GKRG + + L ++D+ND++P+W                   P             Y  +V ECTT  ++  L+A D DD      K+ F++      +L  + +    +      L   +  L+G+A+  L + +   DG G        + I+DCND+ P+I I  T      +E+     +++++TV+D DL    N +FSC LNDTTYL LKEV++    T ++R                        +RG   +Y++ +    SFDRE    Y+V+  CIDKGSP LT+S+  ++ + D NDN+P F            TK I         + F + E++     IGSV A D DS ENA+++Y+L  + N                  F++   G +    + DRE +S Y F V+A+D+G+  R SSTA++ + V D NDC P+FR  Y F +VESYG+  +H  LG + A D DL  NG V Y       E G +    +  D+       V+++ +G++++YGV+DRE+ + I +DVIA D+G P  +S   TVT+ + DLND+KP F  P   +G                                 +N+S +   G L+ K +A D DY  NG++ FEL+            GN SL   T+  DGR+IL            S +    R  + D +L+R SDQ
Sbjct:  106 NLMANLPPQRR------------VNFVQLVQLEPSTGAVRFTVPLDRERLCPDTIGTDQRCTISLLVAIHLTPINSSHFKPLTVYADLTVLVLDVNDNAPYFTSSNSADSAPLAVITVDEECPIGTMIQLPQATDPDTQEHGVQRYEFHPTSTAVRVREHF---DVVQFRHQPGLRCEDVTSVQLEMIQSVAPADPRPVVPCLRTIRRLDRETAGDQFHFNLIATDTNGKRGEIAVQLLVRDVNDHAPEWATKLELFDSSSRSHWISASPSDPAHGTESRQTHYTFSVPECTTQHKLIRLEAQDKDDPQQDGGKITFRLSEHSPDRLPTTLRRRLFVSNDHLYLT--DRGLRGLAQPNLTIVVVASDGAGRNTEAWFHLRIEDCNDHRPMILIQNTDYITIPEESAGQSHLVSLITVRDFDLVTSPNSQFSCFLNDTTYLELKEVVAGP--TADDRDLLHSHSHQGDEITSTGGKEDLSSRRGRWSVYRLGSRSEISFDRETSALYTVMFECIDKGSPSLTASRPITIHIEDINDNAPQFITRCAPLPLSQNTKDIKPNRPCTPQFVFTVSEDAERGILIGSVRAVDLDSGENARVEYTLLSLHNNSTVPDSNESEVFRPETLFTVTPMGELHLLGELDRESQSYYEFLVVATDHGKRQRLSSTATVQITVADVNDCAPVFRGDYVFEVVESYGSSTIHQVLGTLNATDADLGRNGSVHYRLAVHPRESGLSGLSKSMSDSAVPGAQLVKVSHDGQITVYGVVDREQITMIMVDVIAEDNGVPLHMSTMTTVTIHVLDLNDNKPRFVQPEFTAGRLPSSFSNQKPERFNTLGLPPSFEALSSDATYKLNLSLDTSIGTLITKFEAFDPDYGPNGTLTFELIYSGGTMQTRSDPGNSSLFTFTLHPDGRLILTNHLEFDTVYTGSTRLVPRRYRRPDHLLIRVSDQ 1031          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A504YTS1 (Putative cadherin OS=Fasciola gigantica OX=46835 GN=FGIG_04381 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.932e-69
Identity = 191/660 (28.94%), Postives = 313/660 (47.42%), Query Frame = 1
Query:  439 NLIQLNFVTGSLHLISSVDREELCQQK---DNDCS-------HIVIISFGSFI-----FELTFLIIDMNDEVPTF----AKQEIELSIL---EDVPIGHVIDLPVASDLDSQKYGIASY---------KIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQ-----------PQLKVIKKIDRET-REKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWI----------------GLP-------------YKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTA---KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI--TSRSAKIKENKRTLEILTILTVKDEDL--EMNCEFSCHLNDTTYLHLKEVMS-----------RSLSTKNE----------RPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIF------------TKSI---------YEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN----------------IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSR-SSTASILVKVLDQNDCKPIFRKQYEFNI 2004
             L+QL   TG++     +DRE LC      D  C+       H+  I+   F       +LT L++D+ND  P F    +     L+++   E+ PIG +I LP A D D+Q++G+  Y         ++  +F   DI+  R +   +   +  +++++IQ           P L+ I+++DRET  +++ F L+A DT GKRG + + L ++DIND++P+W                   P             Y  +V ECTT  ++  L+A D DD      K+ F++      +L  + +    +  +   L   +  L+G+A+  L + +   DG G        + I+DCND+ P+I I  T      +E+     +++++TV+D DL    N +FSC LNDTTYL LKEV++             L   +E            +RG   +Y++ +    SFDRE    Y+V+  CIDKGSP LT+S+  ++ + D NDN+P F            TK +         + F + E++     IGSV A D DS ENA+++Y+L  + N                  F++ + G +  + + DRE++S Y F V+A+D+G+  R SSTA++ + V D NDC P+F   Y F +
Sbjct:  115 QLVQLEPSTGAVRFTVPLDRERLCPDTIGTDQRCTISLLVAIHLTPINSSHFTPLTVYADLTVLVLDVNDNAPYFTSSNSADSAPLAVITVDEECPIGTMIQLPQAIDPDTQEHGVQRYEFHPTSTAVRVREHF---DIVQFRRQPGLRCEDVTSVQLEMIQSVASADTLPVVPCLRTIRRLDRETVGDQFHFNLIATDTNGKRGEIAVQLLVRDINDHAPEWATKLELFDSSSRSHWISASPSDPAHGTESRRTHYTFSVPECTTQHKLIRLEAQDKDDPQQDGGKVTFRLSEHSPDRLITTLRRRLFVSNNHLYLT--DRGLRGLAQPNLTIVVVASDGAGRNTEAWFHLRIEDCNDHRPMILIQNTDHITIPEESTGQSHLVSLITVRDFDLITSPNSQFSCFLNDTTYLELKEVVAGPKADDRDMLHSHLHQGDEITSAGDKEDLSSRRGRWSVYRLGSRSEISFDRETSALYTVMFECIDKGSPSLTASRPITIHIEDINDNAPQFITRCAPLPLSQNTKDLKPNRPCMPQFVFTVSEDAERGILIGSVRAVDLDSGENARVEYTLHSLHNNSTAPDSNESEVFRPETLFTVTLMGELHLRGELDRERQSYYEFLVMATDHGKRQRLSSTATVQITVADVNDCAPVFHGDYVFEV 769          

HSP 2 Score: 73.559 bits (179), Expect = 2.878e-9
Identity = 63/225 (28.00%), Postives = 101/225 (44.89%), Query Frame = 1
Query: 1738 SAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF----------------------RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQ----ITKNGKLSLYGVIDREEQSTIYIDVIARDHGK-PPLSNSITVTVTLNDLNDHKPVF 2331
            SA DK+   + + ++S+  +G+            ++  FDRE  +LY       D G PS +++  I + + D ND  P F                        Q+ F + E      +   +G + A D D  EN  V Y + +       PD+ +++ F+ +    +T  G+L L G +DRE QS     V+A DHGK   LS++ TV +T+ D+ND  PVF
Sbjct:  551 SAGDKEDLSSRRGRWSVYRLGS-----------RSEISFDRETSALYTVMFECIDKGSPSLTASRPITIHIEDINDNAPQFITRCAPLPLSQNTKDLKPNRPCMPQFVFTVSEDAERGIL---IGSVRAVDLDSGENARVEYTLHSLHNNSTAPDSNESEVFRPETLFTVTLMGELHLRGELDRERQSYYEFLVMATDHGKRQRLSSTATVQITVADVNDCAPVF 761          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A068WE58 (Protocadherin gamma B1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000834200 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.973e-69
Identity = 234/818 (28.61%), Postives = 363/818 (44.38%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFL-----------------IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQ-----PQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC---------------------------TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKEN------------------KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVI--IYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVI-VLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL----DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR------KQYEFNIVESYGNMAVHNN-LGLIEANDEDLDENGLVWYEIGAT-SPYVN-NPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGK--PPLSNSITVTVTLNDLNDHKPVFTFPSS------ASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSP 2484
            + +  +KEN P  + +  L         + +  F  ++G   L   I ++   GS+  I ++DRE +CQ  ++  S +V+  F S   E+ FL                 IIDMND  P F    + +S+ E  PIG +  LP A D D  K GI+SY +      +       + C  +++  D    +       PQL+ I  +D E  +   + L A D  G    + I + I+D+NDNSPQW+GLPY + ++EC                           T  R +  L A DAD +   N  + FK+   K   S   +    +   + + I G L      K  + ++  DGGGL N T++ ++++DCNDN P I++TS S   +EN                   R +++ TI TV D D   N   SC +     +         L T    P   + +  ++ +   +   FDRE      V I+C D+G PQ   ++Q   I V D NDN+P F K   +  + EN    +  G V A D D   NA +KYS+      +  + F+I+   G I T    DRE K++Y  TV A D G+P  SS+  + + VLD ND  P+F+       +  F I ES+    +    +G + A D D   NG + + I  T  P+ + NP A        +IT+ G+L + GV+DRE+Q    + V+  D G     L++ I VT+ L D ND+ PVFT P +      A  + +N + +      + ++ A+D D   NG + F L   + L P
Sbjct:   21 MHQFYIKENTPAGTLIGQL-------IVQHQKTFTSLAGQ-PLSEYILIHPTNGSMLAIQTIDREAICQNDESTNSSLVLHRFESPSCEVAFLVHITTNEESLLETVQLTIIDMNDNSPIFEPSSVTISVPESSPIGGLFYLPPAKDADLGKNGISSYHLSRIHSDSGP-----QACPSYTANDDGYFTLSMTDENTPQLRQISGLDYEKFQNLFYCLHAYDGGGLTSALLIAVEIQDVNDNSPQWVGLPYHVHLRECAQQSQQSLWKTSAELRSFLRLSGFAYDTPFRFLIQLAAIDADSKE--NGLIKFKVVQRK---SDIQASYKVVVHGDKVYIIGQLDYETTPKFSIAVEAKDGGGLTNVTNIDVTLEDCNDNTPKITVTSLSPLPRENLSDWSYYKLTDIWISEEDGREIKLATI-TVSDADTGENAAVSCDIEWNNLVCTNPFSLVPLKT----PAAAIRVPTVFMLLKRDGIKFDREATSRVQVTIVCADRGRPQANIARQMVDIGVWDINDNAPKF-KHRGDIGVQENEPDGTVAGYVHASDIDFGRNAALKYSIKNCKHNVSTLSFTIDERTGKISTLRSLDRENKAVYCVTVEAVDEGDPQLSSSVDVNITVLDVNDSPPVFQGNKNESGRIVFEIPESFDQERLMERFIGQVNATDADSGANGTLEFSIKQTPGPFWHSNPPA------YFRITRKGQLYVDGVLDREKQQEHEVTVVVSDTGAFHQRLTSEIGVTIRLQDQNDNSPVFTEPGALSKGPHAGPATLNTTHDVTVNSSILRICAKDNDLQENGKLNFTLRCAKYLRP 808          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A068YEU7 (Protocadherin gamma B1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000834200 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 6.478e-69
Identity = 232/816 (28.43%), Postives = 360/816 (44.12%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFL-----------------IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQ-----PQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC---------------------------TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKEN------------------KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVI-VLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL----DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR------KQYEFNIVESYGNMAVHNN-LGLIEANDEDLDENGLVWYEIGAT-SPYVN-NPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGK--PPLSNSITVTVTLNDLNDHKPVFTFPSS------ASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSP 2484
            + +  +KEN P  + +  L         + +  F  ++G   L   I ++   GS+  I ++DRE +CQ   +  S +V   F +   E+ FL                 IIDMND  P F    + +S+ E  PIG +  LP A D D  K GI+SY +      +       + C  +++  D    +       PQL+ I  +D E  +   + L A D  G    + + + I+D+NDNSPQW+GLPY + ++EC                           T  R +  L A DAD +   N  + FK+   K   S   +    +   + + I G L      K  + ++  DGGGL N T++ ++++DCNDN P I++TS S   +EN                   R +++ TI TV D D   N   SC +     +         L T     K  +  ++ +   +   FDRE      V I+C D+G PQ   ++Q   I V D NDN+P F K   +  + EN    +  G V A D D   N+ +KYS+      +  + F+I+   G I T    DRE K++Y  TV A+D G+P  SS+  + + VLD ND  P+F+       +  F I ES+    +    +G + A D D   NG + + I  T  P+ + NP A        QIT+ G+L + GV+DRE+Q      V+  D G     L++ I VT+ L D ND+ PVFT P +      A  + +N + +      + ++ A+D D   NG + F L   + L P
Sbjct:   21 MHQFYIKENTPAGTLIGQL-------IVQHQKTFTSLAGQ-PLSEYILIHPTNGSMLAIQTIDREAICQNDKSTNSSLVSHQFENPSCEVAFLVHITTNEESLLETVQLTIIDMNDNSPIFEPSSVTISVPESSPIGGLFYLPPAKDADLGKNGISSYHLSRIHSDSGP-----QACPSYTANDDSYFTLSMTDENTPQLRQISGLDYEKFQNLFYCLHAYDGGGLTSALLVAVEIQDVNDNSPQWVGLPYHVHLRECAQQPQQSLWKTSAELRSFLRLSGFAYDTPFRFLIQLAAIDADSKE--NGVIKFKVVQRK---SDIQASYKVVVHGDKVYIIGQLDYETTPKFSIAVEAKDGGGLTNVTNIDVTLEDCNDNTPKITVTSLSPLPRENLSDWSYYKLTDIWISEEDGREIKLATI-TVSDADTGENAAVSCDIEWNNLICTNPFSLVPLKTPAAAIK--VPTVFMLLKRDGIKFDREVTSRVQVTIVCADRGHPQANIARQMVDIGVWDINDNAPKF-KHRGDIGVQENEPDGTVAGYVHASDIDFGRNSALKYSIKNCKHNVSTLSFTIDERTGKILTLRSLDRENKAVYCVTVEAADEGDPQLSSSVDVNITVLDVNDSPPVFQGNKNESGRIVFEIPESFNQERLRERFIGQVNATDADSGANGTLEFSIKQTPGPFWHSNPPA------YFQITRKGQLYVDGVLDREKQQEHEFTVVVSDTGAFHQRLTSEIGVTIRLQDQNDNSPVFTEPGALSKGPHAGPATLNTTHDVTVNSSILRICAKDNDLEENGKLNFTLRCAKYLRP 808          
BLAST of Protocadherin-1 vs. TrEMBL
Match: W6USW6 (Protocadherin beta-11 OS=Echinococcus granulosus OX=6210 GN=EGR_01394 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 3.375e-68
Identity = 223/760 (29.34%), Postives = 340/760 (44.74%), Query Frame = 1
Query:  481 ISSVDREELCQQKDNDCSHIVIISFGSFIFELTFL-----------------IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQ-----PQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC---------------------------TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKEN------------------KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVI--IYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVI-VLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL----DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR------KQYEFNIVESYGNMAVHNN-LGLIEANDEDLDENGLVWYEIGAT-SPYVN-NPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGK--PPLSNSITVTVTLNDLNDHKPVFTFPSS------ASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSP 2484
            I ++DRE +CQ  ++  S +V+  F S   E+ FL                 IIDMND  P F    + +S+ E  PIG +  LP A D D  K GI+SY +      +       + C  +++  D    +       PQL+ I  +D E  +   + L A D  G    + I + I+D+NDNSPQW+GLPY + ++EC                           T  R +  L A DAD +   N  + FK+   K   S   +    +   + + I G L      K  + ++  DGGGL N T++ ++++DCNDN P I++TS S   +EN                   R +++ TI TV D D   N   SC +     +         L T    P   + +  ++ +   +   FDRE      V I+C D+G PQ   ++Q   I V D NDN+P F K   +  + EN    +  G V A D D   NA +KYS+      +  + F+I+   G I T    DRE K++Y  TV A D G+P  SS+  + + VLD ND  P+F+       +  F I ES+    +    +G + A D D   NG + + I  T  P+ + NP A        +IT+ G+L + GV+DRE+Q    + V+  D G     L++ I VT+ L D ND+ PVFT P +      A  + +N + +      + ++ A+D D   NG + F L   + L P
Sbjct:    4 IQTIDREAICQNDESTNSSLVLHRFESPSCEVAFLVHITTNEESLLETVQLTIIDMNDNSPIFEPSSVTISVPESSPIGGLFYLPPAKDADLGKNGISSYHLSRIHSDSGP-----QACPSYTANDDGYFTLSMTDENTPQLRQISGLDYEKFQNLFYCLHAYDGGGLTSALLIAVEIQDVNDNSPQWVGLPYHVHLRECAQQSQQSLWKTSAELRSFLRLSGFAYDTPFRFLIQLAAIDADSKE--NGLIKFKVVQRK---SDIQASYKVVVHGDKVYIIGQLDYETTPKFSIAVEAKDGGGLTNVTNIDVTLEDCNDNTPKITVTSLSPLPRENLSDWSYYKLTDIWISEEDGREIKLATI-TVSDADTGENAAVSCDIEWNNLVCTNPFSLVPLKT----PAAAIRVPTVFMLLKRDGIKFDREATSRVQVTIVCADRGRPQANIARQMVDIGVWDINDNAPKF-KHRGDIGVQENEPDGTVAGYVHASDIDFGRNAALKYSIKNCKHNVSTLSFTIDERTGKISTLRSLDRENKAVYCVTVEAVDEGDPQLSSSVDVNITVLDVNDSPPVFQGNKNESGRIVFEIPESFDQERLMERFIGQVNATDADSGANGTLEFSIKQTPGPFWHSNPPA------YFRITRKGQLYVDGVLDREKQQEHEVTVVVSDTGAFHQRLTSEIGVTIRLQDQNDNSPVFTEPGALSKGPHAGPATLNTTHDVTVNSSILRICAKDNDLQENGKLNFTLRCAKYLRP 741          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 217.624 bits (553), Expect = 1.808e-57
Identity = 223/814 (27.40%), Postives = 362/814 (44.47%), Query Frame = 1
Query:  298 SSSLFEI--ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLIS-SVDREELCQQKDNDCSHI----------------VIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECT-TSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLK----VVDGGGLQNTTD--LTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
             SSL  I  +L+E +P ++ + +L A       +  H + +  G   LR    ++  TG ++     +DRE L      DC ++                ++   G  + E    I D ND  P F    +EL+I E+  +G    +PVA D D+   GIA YK+ +    +D M     + F      + + K+  PQL V+  +DRE R+ Y  ++  +D  T  +     + + I D NDN P++    Y+  + E T   + +  +KA   DD    N ++ +          R L                 +KG  + + V  LK      D G    ++   +TI++KD NDNAP I I            A + E+      + ++ V D+D   N   +C +       L     RS S  +   KR     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P+F+ S+YE +  E +    ++  V A D DS  NA++ YS+  D      F IN   G +    + DRE K  Y F V A+D G PS   TA+++V+VLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +             +  +F +Q   NG  ++   I  DRE++ST    + A D G PP S+ + +T+ + D ND+ P  T PS++S  F+   +  +T   + K+DAED D  LN  +V+ + G        I   DG + L +   +R H      R++V+ SD+ +    +
Sbjct:   29 GSSLASITYQLREEQPPNTLVGSLAAD--QGLPDTGHLYKLEVGGPYLR----VDGKTGDIYTTDVPIDRETL-----KDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNS---GSDAM-----NLFSLQVADNTDEKV--PQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKA--NDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQ-------VKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQL-----RSASASDSTSKRK----YFLQTT--TPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLE---NMPPLSPVGMVTVIDADKGENAHVQLSV-----------EPENGKFVIQ---NGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDT--RVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEF-TRKHNGLH--RLVVKVSDKGKPSRHT 779          

HSP 2 Score: 131.724 bits (330), Expect = 1.500e-30
Identity = 160/644 (24.84%), Postives = 255/644 (39.60%), Query Frame = 1
Query:  472 LHLISSVDREELCQQKDNDCSHIVIISFG------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE---------CTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNS---RKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L ++ ++DRE    Q+D     I +I  G      S +  +T  I D ND VP F +   E  + E+ P+G  +    A+D D    G  +Y     F       +R           D    IIQ    V   +DRE      F++ A D   + K     + + +KD NDN+P      + +   E               +  ++  D D+  N      +   + F++ +A   +S   RK         +   + E  ++ +A          VD G   L +T  L + + D NDNAP+ S +       E  +  + +  +   D D   N E         Y  + +  ++ L   N  P  G V +           DRE  + Y   +   DKG P L  +    V VLD NDN P F  + Y F ++EN    S +G V+  D D  ENA ++ S++     +   N  G I +   FDRE++S Y F + A D G+P RSS   I + VLD+ND  P   K     Y+F    +  +  V      ++A D D   N  + Y I   +P+           F++  T +G+++L     R+      + V   D GKP    +  V + +N+
Sbjct:  207 LIVLGNLDRE----QRDTYDLSIKVIDGGTPPRYSSALLRIT--ITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYS----FHQPSPNVQRLLHI-------DHNTGIIQ----VKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVA----------VDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAEL-------LYSIITDSATKGLFDIN--PNTGEVRVMN-------QLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDTRVEK----VDAEDIDTGLNAELVYSITGGNPH---------GLFRISST-DGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFVNE 789          

HSP 3 Score: 100.523 bits (249), Expect = 5.796e-21
Identity = 135/582 (23.20%), Postives = 242/582 (41.58%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTF--------AKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM------KLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETN--ENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK---SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            S +E E+ EN P+   ++ +KA         +  +     +  ++ L+ ++  TG + +  SVDREE+       Q +DN           S    +T  + D ND  P+         A ++   ++ ED+P+G  + L   SD D  +  + +  +     + D+  +      + +S  D   K  +  L+    +D E  ++Y   +VA+D+         ++ + + D+NDN+P +    Y++   +E     ++  + A DAD   N         D+A  G              ++    G ++ M ++      +    ++  D G   L+ T  + + + D NDN P   +   S  + EN   L  + ++TV D D   N      +                      P+ G  +I         + SFDREK   Y+  +  +D G P  +S    ++ VLDENDN+P  TK   S Y+F +   +   + +  V A D D+  NA++ YS+   GN +  F I+   G I   ++F R+   L+   V  SD G+PSR +TA + + V
Sbjct:  258 SHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGP------QAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVV-----AGDVPFQ-----LRSASASDSTSK-RKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKG------------LFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSV---------------------EPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKF-LQPLTSPDTRVEKVDAEDIDTGLNAELVYSITG-GNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFV 787          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 216.853 bits (551), Expect = 2.493e-57
Identity = 216/797 (27.10%), Postives = 363/797 (45.55%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLIS-SVDREEL--CQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI--------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES-----LSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            ++E +P ++ + +L A       ++ H + +  G   LR    ++  TG +      +DRE L  C+ K   C     +S    I        E    + D+ND  P F    + LS+ E+  +G    +P A+D D+++ G+  Y +    +++ +        F      D   K+  PQL V+  +DRE ++ Y  T+ A+D  T  +     + + I D NDN+PQ+    Y+  V E       +  +KA D+D     N ++++ I  A   +      +    S  +I ++G L  + ++  K  V  +        +TT ++I + D NDNAP + I        +   A I E+      + ++ V D+D   N   +C +       L+     S+  K +         Y ++T      D E++  Y V I+ +D G+P L+S+    V V D NDNSPIF+  ++E E  E +    ++  V A D DS  NA++ YS+  D      F I+   G +  +   DRE K  Y F V A+D G PS   TA++++KVLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +    P V N        F VQ   NG  ++   I  DRE++S+    + A D G+PP S+ + VT+ + D ND+ PV T PS++  SF  +S       ++  ++AED DY  N  +V+ + G        +SP     DG + L + + +R H      R++V+ SD+ +    +
Sbjct:   29 VREEQPPNTLIGSLAAD--QGLPDSGHLYKLEVGAPYLR----VDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASAL--------FSLQMANDRGEKL--PQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD--LGPNGEIEYTIHQA---SDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKK---------YFLQTT--TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLE---NMPPLSPVGMVTVLDMDKGENAQVQLSV---EPDVGN--------FVVQ---NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS--SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISP----SDGEIKLTKEL-TRKHGGLH--RLVVKVSDRGKPSRHA 767          

HSP 2 Score: 132.109 bits (331), Expect = 1.097e-30
Identity = 145/582 (24.91%), Postives = 236/582 (40.55%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA---KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD-EIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP----YVNNPDAE------------KTKRFKVQITKNGKLSLYGV 2202
            L  +I D ND  P F K   E  + E+ P+G+ +    A+D D    G   Y I    +++D +             K L+++     + V   +DRE    + F ++A D     K     + + + D NDN+P    + IGL  +   V   +    + +  A     D D+  N      +   + F++  A    + N +K         +   + +  ++ +A          VD G   L +T  L + + D NDN+P+ S      +  E  +  E +  +   D D   N E         Y  + +  +R L   +  P  G       E       DRE  + Y   +   DKG P    +    + VLD NDN P F  S Y F ++EN    S +G V+  D D  ENA+++ S++ ++GN     N  G I +   FDRE++S Y F + A D GEP RSS   + + VLD+ND  P+  K    +        A  + + ++EA D D   N  + Y I   +P    Y++  D E               R  V+++  GK S + +
Sbjct:  229 LRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIH---QASDPVP------------KMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVA----------VDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAEL-------VYSIIADSSTRGLFEID--PSSG-------EVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ-NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAI 768          

HSP 3 Score: 92.4337 bits (228), Expect = 1.665e-18
Identity = 136/576 (23.61%), Postives = 237/576 (41.15%), Query Frame = 1
Query:  286 KLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETN--ENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK-SIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN----IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            + +KSS  +E E+ EN P+   ++ +KA         +  + I   +  +  ++Q+   TG + +   +DREE+   K +  +     S  S    ++  + D ND  P    + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      S  D + K     L+    +D E    Y   +VA+D+         ++ + + D NDNSP +    +++   +E     ++  + A DAD  +  N++L + I    + +S          S+  +     L    + +    +   D G    + T  + I + D NDN P   ++S S  + EN   L  + ++TV D D   N +    +                      P  G  ++         + SFDREK   Y+  +  +D G P  +S    ++ VLDENDN+P+ TK S   F  +   +   S +  V A D D   NA++ YS+   GN     Y S +   +  TKE   R+   L+   V  SD G+PSR + A + + V
Sbjct:  242 QFEKSS--YEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV-----AGDV---PFQLRPAGDSSVDNKKKYF---LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDAD--SGTNAELVYSI----IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSV---------------------EPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAG-GNPHELFYISPSDGEIKLTKE-LTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 218.009 bits (554), Expect = 3.135e-57
Identity = 216/797 (27.10%), Postives = 363/797 (45.55%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLIS-SVDREEL--CQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLN--IKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL--KGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISI--------TSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES-----LSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            ++E +P ++ + +L A       ++ H + +  G   LR    ++  TG +      +DRE L  C+ K   C     +S    I        E    + D+ND  P F    + LS+ E+  +G    +P A+D D+++ G+  Y +    +++ +        F      D   K+  PQL V+  +DRE ++ Y  T+ A+D      + + +L   I D NDN+PQ+    Y+  V E       +  +KA D+D     N ++++ I  A   +      +    S  +I ++G L  + ++  K  V  +        +TT ++I + D NDNAP + I        +   A I E+      + ++ V D+D   N   +C +       L+     S+  K +         Y ++T      D E++  Y V I+ +D G+P L+S+    V V D NDNSPIF+  ++E E  E +    ++  V A D DS  NA++ YS+  D      F I+   G +  +   DRE K  Y F V A+D G PS   TA++++KVLD+ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +    P V N        F VQ   NG  ++   I  DRE++S+    + A D G+PP S+ + VT+ + D ND+ PV T PS++  SF  +S       ++  ++AED DY  N  +V+ + G        +SP     DG + L + + +R H      R++V+ SD+ +    +
Sbjct:   65 VREEQPPNTLIGSLAAD--QGLPDSGHLYKLEVGAPYLR----VDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASAL--------FSLQMANDRGEKL--PQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSD--LGPNGEIEYTIHQA---SDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKK---------YFLQTT--TPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLE---NMPPLSPVGMVTVLDMDKGENAQVQLSV---EPDVGN--------FVVQ---NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNS--SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISP----SDGEIKLTKEL-TRKHGGLH--RLVVKVSDRGKPSRHA 803          

HSP 2 Score: 132.494 bits (332), Expect = 9.727e-31
Identity = 145/582 (24.91%), Postives = 235/582 (40.38%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGL-PYKITVKECTTSREIFSLKAF----DADDQNN------INSKLDFKIDTA---KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD-EIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP----YVNNPDAE------------KTKRFKVQITKNGKLSLYGV 2202
            L  +I D ND  P F K   E  + E+ P+G+ +    A+D D    G   Y I    +++D +             K L+++     + V   +DRE    + F ++A D     K     + + + D NDN+P    + IGL  +   V   +    + +  A     D D+  N      +   + F++  A    + N +K         +   + +            V +  VD G   L +T  L + + D NDN+P+ S      +  E  +  E +  +   D D   N E         Y  + +  +R L   +  P  G       E       DRE  + Y   +   DKG P    +    + VLD NDN P F  S Y F ++EN    S +G V+  D D  ENA+++ S++ ++GN +   N  G I +   FDRE++S Y F + A D GEP RSS   + + VLD+ND  P+  K    +        A  + + ++EA D D   N  + Y I   +P    Y++  D E               R  V+++  GK S + +
Sbjct:  265 LRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIH---QASDPVP------------KMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRD----------YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAEL-------VYSIIADSSTRGLFEID--PSSG-------EVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGN-FVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAI 804          

HSP 3 Score: 93.2041 bits (230), Expect = 1.228e-18
Identity = 136/576 (23.61%), Postives = 237/576 (41.15%), Query Frame = 1
Query:  286 KLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETN--ENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK-SIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN----IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            + +KSS  +E E+ EN P+   ++ +KA         +  + I   +  +  ++Q+   TG + +   +DREE+   K +  +     S  S    ++  + D ND  P    + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      S  D + K     L+    +D E    Y   +VA+D+         ++ + + D NDNSP +    +++   +E     ++  + A DAD  +  N++L + I    + +S          S+  +     L    + +    +   D G    + T  + I + D NDN P   ++S S  + EN   L  + ++TV D D   N +    +                      P  G  ++         + SFDREK   Y+  +  +D G P  +S    ++ VLDENDN+P+ TK S   F  +   +   S +  V A D D   NA++ YS+   GN     Y S +   +  TKE   R+   L+   V  SD G+PSR + A + + V
Sbjct:  278 QFEKSS--YEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVV-----AGDVP---FQLRPAGDSSVDNKKKYF---LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDAD--SGTNAELVYSI----IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSV---------------------EPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSI-AGGNPHELFYISPSDGEIKLTKE-LTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000003988.2 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:103037566])

HSP 1 Score: 207.608 bits (527), Expect = 1.567e-53
Identity = 187/684 (27.34%), Postives = 316/684 (46.20%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNI---------NSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLK-EVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI-GNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE---SLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            + D+ND  P F++      I ED+  G ++   +ASD DS   G  +Y +E             ED   ++ +    +  +     V + +D ET++ Y  T+ A+D  G+   V +  N+ D+NDN P +    Y  ++ E  T    I ++ A DADD  N          + +  F I TA +  +RKL      S  NL++       + +M L    +        +T  +++ + D ND  P+ + + + A I+EN     ++  +   D D   N      L  +  +    + +  S+    E                    DRE++  YS+ I+  DKG P L+S+   +++VLD NDN+P F+++IY+ EI EN++  +++  V A D D   N +I++S+    GN  F I+ + GVI   +  DRE ++ Y+  V A+D G   R   A++ + +LD NDC P+F    Y   + E+  ++    N+  +   D+D   NG + Y +        N DA         +T +G+L L   +DRE Q    + + A D G P LS S TV V ++D+ND  P+F    S+S    +I+ +  TG  +  ++A D D   NG + + L G +   S++P T +     I+  S+  R  R   + ++LV ASD
Sbjct: 1812 VSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLE-------------EDDGDYTFL----LNPVTGVFNVTQPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQLSYSIASGDPQAHFGITTAGVLQTRKLLDRETQSFYNLVVT------VNDMALPPATR------FTSTAQVSVILLDVNDCPPVFT-SQKMAYIQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGE-------------------LDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGNSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLP--KNILQVVGRDDDYGSNGQLSYSLSG-----GNEDA------AFSLTSSGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLF----SSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSGGDGQFSINPATGQ-----IITSSLLDRESR--GNYQLLVVASD 2422          

HSP 2 Score: 188.734 bits (478), Expect = 1.175e-47
Identity = 190/708 (26.84%), Postives = 313/708 (44.21%), Query Frame = 1
Query:  442 LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGI--ASYKI-----ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG---KRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISI-----TSRSAKIKENKRTLEILTILTVKDED-LEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSS-QQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI-YFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESL 2478
            L  +N  TG ++  S +DRE L     N    +V+ S  ++  E+  +++D+ND  P F    I +S  ED   G  + L  A+D D    G+   +Y+I     +  F+    +    E  F                L     +DRE    Y   L+ ++ +G   + G++ + + I+DINDN P +    Y+ +V E       +  + A D D+  N      ++    F+ID  K G                ++I+ AL    + +  + +  VD G   L   T+ TI + D NDN P++       TS+ A + EN +   ++ +LTV D D    N   S  +         EV +  +      P   ++ +  +        DRE++  Y++ +   D G P   SS     + V D ND+ PIF +++Y+ +I E+    S I  VSA D DS +NA ++YSL    ++ +F+I+   G++ +    DRE  S+    + A D G   + S   ++V + D ND  P F +  Y  ++VE   +    + L  + A D DL  NG V +   A +P      A   + F++  T  GKLS    +DRE+  +  + V A D G PPL +   V VTL D+ND++PVF +P      F NI      G  +  + A D D   NG+V + +   ++ 
Sbjct:   68 LFAINATTGVVYTSSVIDRESLASSVIN---VVVLSSQPTYPTEVRIVVLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFL--------------HLVTTGGLDRELAPFYQL-LIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDEGTPFQID-PKAGT---------------VVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPV------PNLSLIKVASV-------LDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVE---HSPAGSELLSLSATDTDLGANGTVRFTFDAETP------ATVQELFRLD-TITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVF-YPVQY---FANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTF 714          

HSP 3 Score: 176.022 bits (445), Expect = 9.233e-44
Identity = 181/748 (24.20%), Postives = 323/748 (43.18%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI--FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQ---LKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSP---QLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSI-NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESI 2529
            LKE +P  + +I+L A  P         F++   SG   +  L  +   TG +     +DRE        D   I   +        E+   + D+ND  P F    +++++ E+V  G  I    A+D D     + +Y I              +D F+           I P+   L   K++DRE R KYS  LV  D   +   + + + + D+ND++P++    Y   + E      I +     +D  + +N ++ + ++             L      +  +   L    +   ++ ++ VDGGG  ++  +  ++ D NDN P  + +  S  I E+      +  +   D D   N +                +S S+++ + +   G+     ++T   K  DRE   FY++++   D   P   + TS+ Q SVI+LD ND  P+FT     + I EN+   + + +V A D DS  N+ ++YSL     + FSI N+ G +    + DRE+ + Y+ T++A+D G+P  SST  + + VLD ND  P F +  Y+  I E   N     ++  + A+D D   NG + + I A +    N D      F++  +  G +S+  ++DRE +++  + V A D G  P  +  TV + L D+ND  PVF           N++   +    + ++   D DY  NG + + L G    +  ++   G++ L  ++
Sbjct: 1619 LKEGQPPGTNVISLDASSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFRIMQLTATDADEGPNALVTYTI----------ISGADDSFR-----------IDPESGDLIATKRLDRERRSKYSL-LVRADDGQQSSDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVA-AILASDSDSGVNGEITYSLE-----EDDGDYTFLLNPVTGVFNVTQPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQ----------------LSYSIASGDPQAHFGITTAGVLQT--RKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVFTSQKMAY-IQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEE---NTLSGTDVLQVFASDADEGTNGQIRFSIAAGN---GNSD------FRID-SVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKN---ILQVVGRDDDYGSNGQLSYSLSGGNEDAAFSLTSSGQLKLIRTL 2303          

HSP 4 Score: 163.696 bits (413), Expect = 5.321e-40
Identity = 192/727 (26.41%), Postives = 309/727 (42.50%), Query Frame = 1
Query:  463 TGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFE----LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK---RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK-DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATS-PYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK---SRSHRITQSDR--ILVRASDQ 2589
            +G L LI ++DRE     +D     I  I  GS        +  L+ D+ND VP F+      SI ED P G  + L  ASD D  + G+ +Y +            +F       SI     +II   L     +DRE+R  Y   +VA D            + + + DINDN P++   PY   +   T     +F++   D D  +N  S+L + +      + R   +         I     L G +E+   V  +V DGG    T   T++++     + P+I I  +S    EN+    I+T ++           +    N     H+ + +S  LS K                      D E ++ Y + I   D+  P  ++ ++  + VLD NDN+P+F K  +  EI+EN +    +  VSA D+DS  N ++ Y++ + GN    FSIN   G I T    DRE+ + Y+  V A+D G P +S+  S+++ VLD ND  P F K +   + E   N  V   +  +   DED   N +  Y I  TS P+  NP               G +++   ++RE+       V A D G    + S  VT+ + D+ND+ P F+ PS     ++      + G L+ K+ A D D   NG  +F  + ++S +       G + +K+ ++   S  H     +R   +V ASD+
Sbjct: 2294 SGQLKLIRTLDRE----TQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSG-------GDGQF-------SINPATGQIITSSL-----LDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSN--SQLHYSL------SGRNSEKFKIDPVRGAITASEKLTGSSEVTFTV--RVKDGGSNPKTDSTTVTVRFVTGGDFPIIKIKDKSFTYPENQAINTIVTKVSGTSTRAGPLSYYIASGNLDNAFHVDQ-LSGELSLK-------------------APLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILEN-LSPQRVLVVSALDQDSGPNGQLDYTIID-GNKENSFSINRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIFSATVPE---NAPVGYTVTRVTTTDEDTGANAVSRYTISDTSLPFSINP-------------STGDITISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPS----YYLEYPELTDVGSLVTKVSATDLDEGFNGK-IFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDR 2941          

HSP 5 Score: 163.31 bits (412), Expect = 6.359e-40
Identity = 170/615 (27.64%), Postives = 267/615 (43.41%), Query Frame = 1
Query:  838 LKVIKKIDRE-TREKYSFTLVALDTEGKRGHVN---IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLD--FKID--------TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLT--ISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIG-NIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRS---STASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFET--GYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ++   ++DRE   + Y   + A++TE  + H     + + ++DINDN P +      +TV+E       I  L A DAD+  N      I S  D  F+ID        T +L   R+                         K  + ++  DG   Q ++D+T  I++ D ND+ P  S +  S  I E+     I+  +   D D  +N E  +S   +D  Y  L              P  G+        N  +  D E   +Y + +  +D G     SS +    VLD NDN P F  S+Y   I E+    S I +V+A D D   NA++ YS+       +F I   GV+ T++  DRE +S YN  V  +D   P  +   STA + V +LD NDC P+F  Q    I E   N AV   +  ++A D D   N  V Y +G +             +F +    +G + L G +DREE +   + ++A D G+PPLS+++ VT+ + D+ND+ P F      S +  +I  E  T  G  + ++ A D D   NG + F +      S   I+    VI    +  R  R + S  ++V+A+D+
Sbjct: 1671 IQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRS------------------------KYSLLVRADDG---QQSSDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLEEDDGDYTFLLN------------PVTGVF-------NVTQPLDYETQQYYILTVRAVDGGG--QASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQLSYSIASGDPQAHFGITTAGVLQTRKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVFTSQKMAYIQE---NTAVDTVVFTVQATDADSGPNSYVEYSLGGS----------YGVKFSID-NIDGSVRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSF------SQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGNSDFRIDSVTGVISVAKLLDRETRASYS--LVVQAADR 2215          

HSP 6 Score: 149.058 bits (375), Expect = 1.470e-35
Identity = 173/672 (25.74%), Postives = 291/672 (43.30%), Query Frame = 1
Query:  547 ISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMN--CEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY---SLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESI 2529
            +S  SF   L   + D+ND  P F +   ++ I EDVP G  I    A+D DS +     Y + +             +   + +I +    +    L     +DRET       + A D   + K  +  +++NI D+ND  P +    Y ++ V+      E+ SL A D D     N  + F  D       ++L R+  I+       E   + M    L V  +  D G   L +   + +++KD NDN P+       A IKEN+     +T ++  D DL  N    ++    DT   H+     +  +         +V++           DRE+   Y + +   D G  +  +    ++ V+D  DN PIFT+  Y F + EN   ++ IG++SA   D   N  I Y   S D+ G   F++N   G I      DRE+++ Y   V+A   G+ +  +  +I VK  D ND  P F    E   V +  N    +++   +A D+D   NG++ Y +        NP       F +   K+G ++L G ++    S+  ++V+A D G P  ++++ +TV++ D+ND+ PVF      S   V + SE        K++A DKD  LNG +V+++ G  +     I  DG++ +K  +
Sbjct:  434 VSRSSFA-SLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVS------------GNSLGWFAISENSGLVTSAAL-----LDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVEHSPAGSELLSLSATDTD--LGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYV--RATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFKFHINSNTGKITT---------LVLL-----------DREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVD--LNTNITYLIASGDQRG--LFAVNSATGHITATSLIDREEQAFYQLKVVAR-GGDVTGEALVNITVK--DLNDNAPHFLHSEEH--VSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQ------QNPKG----LFHIH-EKHGLITLTGPLEV-TTSSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVF---DQLSYEVVILESEPVNSRFF-KVEATDKDSGLNGEIVYDITGGNTNDIFGIFPDGQLYIKADL 1038          

HSP 7 Score: 149.058 bits (375), Expect = 1.832e-35
Identity = 187/741 (25.24%), Postives = 309/741 (41.70%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE----LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH----VNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMA----EMKLVVPLKV--VDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKS--FDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLA-KLDAEDKDYALNGSVVFEL 2460
            +++++++ E+ P  S +  + A    + + A  R+ ++SGN      I  N  +G +   + +DRE     +      D      IS+   I  +T    D+ND+VPTF +    +S++E  P G  +    A+D D    G   +  +    +T       ++ F+  +I          +L    ++DRE    Y   + A D      H    VN+ L  KDINDN P +  + Y   +KE       + ++ A D D   N              G  R           ++    G +  +     E K    L+V   DGG L++ T   +TI++ D  DN P+ +    S  + EN     ++  ++    DL  N  +     D                     +RG+  +     +   +   DRE+  FY + ++   +G   +T     ++ V D NDN+P F  S      +EN      I    A D+D   N  I YSL +     F I+  +G+I      +    S Y   V+ASD G P R+ST  + V V D ND  P+F +  YE  I+ES     V++    +EA D+D   NG + Y+I  T    N+            I  +G+L +   +DRE Q    + ++ARD    PLS S+ VT+ L+D+ND++P+F    +++        E   G L+A ++ AEDKD+  N  V +  
Sbjct:  459 AVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISEN--SGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNIT----DVNDQVPTFTQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPAT------VQELFRLDTITG--------KLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTL--KDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRN--------------GTVRYTITAGDTFKFHINSNTGKITTLVLLDREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVDLNTNITYLIASGD---------------------QRGLFAVNSATGHITATSLIDREEQAFYQLKVVA--RGG-DVTGEALVNITVKDLNDNAPHFLHSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEVTTSS-YQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILES---EPVNSRFFKVEATDKDSGLNGEIVYDI--TGGNTND---------IFGIFPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLF----NSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSF 1120          

HSP 8 Score: 144.436 bits (363), Expect = 3.758e-34
Identity = 184/644 (28.57%), Postives = 273/644 (42.39%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSIT---VTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            LT  + D+ND  P F +   E+ ILE  P+        A+D DS   G   Y         DI      D F               QL +   +DRE +++Y+  LVA D   E     VN+ + + D+NDN P +    Y     E      + + + F  D     NS++ +  +T +  N    +    +SS   +  E  ++          +   D G    L++   + + I+D NDNAP  +     A I E+   +  L  ++  D D   N +   H+++       E    S+ + +     G V +           D E    YS+ II  D GS  L+SS   SV VLDENDNSP F+KS    +I+EN      + S++A D DS  NA I YS+    N   FSI+   G IF   K D E +SLY   + A DNG P RSS+  +++ V D ND  P+F     F  +    N+ +  ++  I A+D D D NG + Y I   +P  N+        F +    +G +   G IDRE  +   + V A D   P          +TV + D NDH P F      S + +   +    G +L  + A D D   NG V +ELV  +S
Sbjct:  962 LTVSVYDVNDNAPVFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVY---------DITGGNTNDIFGI---------FPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFETPQ-PNFELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEG-----NEETQFSIDSSS-----GQVTLV-------GKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYSIMANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPE--NLPLSTSIMTITAHDTDADINGELEYSIVQQTPRGNH--------FSIDPI-SGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFI-----SQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYELVKGDS 1553          

HSP 9 Score: 140.969 bits (354), Expect = 4.714e-33
Identity = 190/768 (24.74%), Postives = 306/768 (39.84%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGN-VRLRNLIQLNFVTGSLHLISSVDREE----LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII---YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESY--GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREE------QSTIYIDVIARDHGKP-PLSNSITVTVTLNDLNDHKPVFT---FPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GNESLSPVTIEKDGRVIL 2517
            + S + + L E+ P  SEL++L A           RF   +     ++ L +L+ +TG L   + +DRE+    L   +  D     + S    I ++   + D+ND  P F   +   +I E+ P G  +    ASD D  + G   Y I               D FKF       +     ++  +  +DRE +  Y   + A D    R H + ++ I   D  DN P +    Y   + E      +    +    D   +N+ + + I +   G+ R L  +   + +         +  A  +L V   V  GG +     + I++KD NDNAP    +       EN  T   +      D+D   N    +S   N     H+ E             K G++ +    ++ T+            Y V ++  D+G PQ TS+   +V V D NDN+P+F +  YE  I+E+   +S    V A DKDS  N +I Y +   GN    F I   G ++ K   DRE +  YN  ++A D      S++ ++ + + D ND +P+F    Y F  +E    G++        + A D+D   N  V Y      P            F++     G+LS    +DRE        +     VI+ D G P PL +   V V + D+ND+ P FT   + +S S S  N++        L ++ A D D   NG V + +  GNE          G+V L
Sbjct:  562 TQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHS----IAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITA------------GDTFKF------HINSNTGKITTLVLLDREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVD---LNTNITYLIAS---GDQRGLFAVNSATGHITATSLIDREEQAFYQLKV---VARGGDVTGEALVNITVKDLNDNAPHFLHSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHE-------------KHGLITLTGPLEVTTSS-----------YQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVYDITG-GNTNDIFGIFPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARR----VFAEDKDFGPNSEVRYSFETPQP-----------NFELNAI-TGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQ-------LLRVSASDVDENKNGQVRYHISEGNEETQFSIDSSSGQVTL 1250          

HSP 10 Score: 139.043 bits (349), Expect = 1.793e-32
Identity = 165/586 (28.16%), Postives = 266/586 (45.39%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK---RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTS-REIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLE--ILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSR-SSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTV 2295
            +++ +++D+ND  P F  Q++   I E+  +  V+    A+D DS       Y +   +              KFS      +  I   ++++ ++DRE    YS T+VA D +G+      +++ + + D+NDN+P +    Y I ++E T S  ++  + A DAD+    N ++ F I  A  GNS      +    +   L++   +  A   LVV  +  D G        T++I   D ND AP+  ++  + +++EN   L   IL ++  +D+D   N +                +S SLS  NE     +    Q++    ++ DRE  D YS++I  ID GSP L+ S    V+V D ND  P+F+ S +   I E++   S++  V+A D D  +N  I YSL   G+  FSIN   G I T    DRE +  Y   V+ASD G+P+  SS+A + V V D ND  P F    Y  +I  S    A  + +  +   DED   N  + Y +        N +  K    +  IT + KL+          S +   V  +D G  P ++S TVTV
Sbjct: 2017 QVSVILLDVNDCPPVFTSQKMAY-IQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYG------------VKFS------IDNIDGSVRLVGELDREEMANYSLTIVATD-KGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEENTLSGTDVLQVFASDADE--GTNGQIRFSI-AAGNGNSDFRIDSVTGVISVAKLLDRETR--ASYSLVV--QAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKNILQVVG-RDDDYGSNGQ----------------LSYSLSGGNEDAAFSLTSSGQLKLI--RTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSG-GDGQFSINPATGQIITSSLLDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPAS---TAPGSLVFAVTVTDEDSGSNSQLHYSLSG-----RNSEKFKIDPVRGAITASEKLT--------GSSEVTFTVRVKDGGSNPKTDSTTVTV 2539          

HSP 11 Score: 134.806 bits (338), Expect = 3.428e-31
Identity = 120/439 (27.33%), Postives = 195/439 (44.42%), Query Frame = 1
Query: 1255 TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTK-NERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYG----NMAVHNNLGLIEANDEDLDE-NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSL---YGVIDREEQSTIYIDVIARDHGKPPLSNSI-TVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSR 2538
            T++ I + D NDN+P+   TS     KE+  +   + + T  D D+  N      ++ TTY  ++    R         P      ++ + T      DRE   FY +LI   DKG P+     Q +V + D NDN P F    Y+  + E++   S +  ++A D+D   N+ I+Y LDE     F I+   G +  KE  D E K  Y+ T+ A DNG PS S      +K+LD ND  P+ + +Y F     +     N  +   + L+  +D D    NG +   I             +   F+V  +    LSL     V+DRE  S+  + V   D+G+P   +S  ++ + +ND+NDH P+F      +   V+IS +   G  +  + A D D   N ++ + LV   SL    I ++  ++   ++  R
Sbjct:  107 TEVRIVVLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSN-----GVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFLHLVTTG---GLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDE--GTPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRY-FPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILG---------GNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIF----QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAALLDR 521          

HSP 12 Score: 122.865 bits (307), Expect = 1.458e-27
Identity = 158/613 (25.77%), Postives = 268/613 (43.72%), Query Frame = 1
Query:  856 IDRETREKYSFTLVALDTEGK-RGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL-----KGMAEMKLV----VPLKVVDGGGLQ--NTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPI-----FTKSIYEFEIMENSVGSSEIGSVSAPDKDSQE-NAKIKYSL---DEIGNIYFSINMYGV-----IFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDR-------ILVRASD 2586
            IDRE+       +V L ++      V IV  + DINDNSP +      ++ KE  T+ R++    A DAD  +N      ++I     GN ++  R+    + +    EGA       G  + +L     + ++V D G  +      + ++I+D NDN P   +      + E+      +  +T  D+D   N +    L++ T   +              PK G V+I        ++ D E    YS+ I  +D G P L+   + ++ +LD NDN P+     F  +     + EN+   + +  ++  D DS   N  I  S+   +E G  +F ++   V     I      DRE+ S YN TV  SDNG P SRSS AS+++ V D ND  PIF++  Y+ +I E   ++   + +  + A D D  +N  + Y + +               F +    +G ++   ++DRE  S + +++ A+D G  P  +   + V + D+ND  P FT     S   V++      G  L  L A D D   NG+V F     ++ +P T+++  R+   ++I  +    T+ DR       + VRA+D
Sbjct:   84 IDRESLASSVINVVVLSSQPTYPTEVRIV--VLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRI---VQGNEQRKFRLDITVNPSG---EGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDEGTPFQID-------------PKAGTVVI-------KEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQG--HFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISE---DVPKGSYIKGVSATDGDSGQNANLRYSLVS---------GNSLGWFAIS-ENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFT----QSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTF---DAETPATVQELFRL---DTITGKLSTTTELDREDMGSYLLYVRATD 643          

HSP 13 Score: 119.398 bits (298), Expect = 1.631e-26
Identity = 152/597 (25.46%), Postives = 250/597 (41.88%), Query Frame = 1
Query:  835 QLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYN--------FTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEAND-EDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDA--EDKDYALNGSVVFEL-VGNESLSPVTIEKDGRVILKESI---KSRSH--RITQSD 2562
            +L +   +D E  EKY   + A D        +  I + + D+NDN+P +   P+   + E  + + +  + A D D  +  N +LD+ I     GN      I   +           +  A+  L V  K  D G  Q +T +++ I   D NDNAP  S    SA + EN      +T +T  DED   N      ++DT+       +  S++     P  G + I       ++  +RE  D Y   +   D G    T S   ++ V D NDN+P F+K  Y  E  E +   S +  VSA D D   N KI Y +      +   +  G IF K++   +  + +N        F V ASD G     S  +++V ++D ND  P F     F  V    ++ V  NL  + A+D +D   N  + Y I              + +F++   + G +++   +  +      +++ A+D G P LS+  T+ + + + N H P F    S S     +S     G  +  L A  +DKD  +NG + + +  GN+    V  EK G + L + +   K + H  RI+ +D
Sbjct: 2603 ELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILENLSPQRVLVVSALDQD--SGPNGQLDYTIID---GNKENSFSINRATGEIRTTRPLDREKTAQYSLKV--KATDRGAPQKSTAVSVVINVLDVNDNAPRFSKI-FSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTISDTS-------LPFSIN-----PSTGDITI-------SRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKIFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTFESSSYFTPVTK--SVKVGTNLIKVTAHDKKDFGVNSEIEYVISG---------GNSSSKFRLD-KQTGWVTVASSLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEF----SQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATD 3153          

HSP 14 Score: 113.235 bits (282), Expect = 1.207e-24
Identity = 135/565 (23.89%), Postives = 237/565 (41.95%), Query Frame = 1
Query:  439 NLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISF--GSFIFELTFLII-----DMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKK---IDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT----TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQI-ETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQEN-AKIKYSLDEIGN--IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDL 2073
             L  +N  TG L L   +D E+  +QK     H + IS   G +I + +++ +     D+ND  P F   E    + E+VP G ++    A+D DS    + +Y I++                      D ++ II P   VI     +D E ++ Y  T+ A +   E +    N+ + +K  N+  P+++   Y   V E      +   + F +D     +  + + I     G SR+    +   +  + +  G L    E K+ + +   + G ++        + I+I D ND  P+ +      ++ E      ++T ++ +D D                  +      + S   +R K    I  Q  + +     DRE    Y++ ++ ID GSP  T +    V + D NDN P    +    E+MEN    + + ++++ D D   N     YSL   G+   YF++   G + T  + DREQ S +  +V+  D+G P  SST ++ VK+ DQND  P   +  E   V  +GNM    +LG+++  D D+
Sbjct: 3120 GLFVVNEKTGVLSLAKPLDYEK--KQK-----HELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQS---------------------SDSDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTMVG-EVFASDRDLGDDGVVYYLI----FGRSRRKGFGINKKTGQIYVT-GPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSEGLSPGGLVTFVSAEDSD-----------------SVPSWSRFTYSVTTDREKNAFTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLVTTT--GEVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQND-NPSQPRSVEI-FVHYFGNMFPGGSLGIVKPQDPDI 3628          

HSP 15 Score: 110.923 bits (276), Expect = 6.310e-24
Identity = 174/722 (24.10%), Postives = 300/722 (41.55%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETR--EKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESY--GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHG--KPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            S +F   + EN P+   +  +          A  R+ I   ++       +N  TG + +   ++RE+         +H    S  +   ++T  + D+ND  P F+K    L   E   +G ++    A+DLD    G    KI  + +S    +E F        I       ++ QL+             ++SF + A D   K       +++NI D NDN P +    Y   V K       +  + A D  D   +NS++++ I     GNS    R+   +    +    +L        ++ +   D G   L +   L I++ + N + P  S +   A + E+      +  L+ +D+D +        +N     ++       L   NE  K G++ +        K  D EK   + + I   D G    TS    ++ V D NDN P+F    Y   + EN    + +  ++A DKDS  N+ + Y +    +  F I+   GVI T+   D E K +Y+ TV A +  +  R S A++ +++   N+  P F  KQY F + E+   G M     +G + A+D DL ++G+V+Y I   S         + K F +   K G++ + G +DRE++  I + V+A++ G  +    + + V +T+ D ND  PVFT         V +S     G L+  + AED D
Sbjct: 2757 SKIFSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTISDTSLPF----SINPSTGDITISRPLNREDTDHYIAKVSAHD---SGWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNG----KIFYFIRS---QSENFRINSSTGEI------FVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTFESSSYFTPVTKSVKVGTNLIKVTAHDKKD-FGVNSEIEYVISG---GNSSSKFRLDKQTGWVTVAS--SLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDK------QMNGLITYNISSGNDDGLFVVNE--KTGVLSLA-------KPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTM-----VGEVFASDRDLGDDGVVYYLIFGRS---------RRKGFGIN-KKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFT----QELYDVQVSEGLSPGGLVTFVSAEDSD 3417          

HSP 16 Score: 97.0561 bits (240), Expect = 1.167e-19
Identity = 167/742 (22.51%), Postives = 295/742 (39.76%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE------LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLP------VASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDAD-DQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER-----PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNG 2442
            S ++++IE++EN    ++++ + A         + RF I +GN    +  +++ VTG + +   +DRE       + Q  D   S  V  +       +  +++D+ND  P F      + + E+     + DLP      V  D D    G  SY +    +         +  F  +S           QLK+I+ +DRET+++YS  + A+D+      G   +++ + D+ND  P +    +  ++ E   T  ++  + A D D  QN +   + + +     G+ +              L++   +G  ++ +V      DGG    L ++  +++ + D NDN P          I  +     ++  +TV DED   N +          LH       SLS +N       P RG +      T   K     +V F    +   D GS   T S   +V  +   D  PI       F   EN   ++ +  VS     S     + Y +    + N +    + G +  K   D E    Y   + A D   P  S+   I + VLD ND  P+F K+ +   I+E   N++    L ++ A D+D   NG + Y I          D  K   F +     G++     +DRE+ +   + V A D G P  S +++V + + D+ND+ P F+   SA+     +      GY + ++   D+D   N 
Sbjct: 2136 SQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNG--NSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRA------TVNIVLLDVNDCAPVFELSPYTVRVQEN-----LADLPKNILQVVGRDDDYGSNGQLSYSLSGGNE---------DAAFSLTS---------SGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGV---ITYSLSG---GDGQFSINPATGQIITSSLLDRESRGNYQLLVVAS----DGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSNSQ----------LHY------SLSGRNSEKFKIDPVRGAI------TASEKLTGSSEVTF---TVRVKDGGSNPKTDSTTVTVRFVTGGD-FPIIKIKDKSFTYPENQAINTIVTKVSG---TSTRAGPLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILE---NLSPQRVL-VVSALDQDSGPNGQLDYTI---------IDGNKENSFSIN-RATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIFSAT-----VPENAPVGYTVTRVTTTDEDTGANA 2788          

HSP 17 Score: 93.9745 bits (232), Expect = 1.071e-18
Identity = 162/747 (21.69%), Postives = 311/747 (41.63%), Query Frame = 1
Query:  328 ENKPIHSELI-NLKAK---LPTAFKE-----AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQ---LKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFS-LKAFDADDQNNINSKL---------DFKID--TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDE-DLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER--PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSA--PDKDSQENAKIKYSLDEIGN--IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP--YVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVG 2466
            E +P H+E++ NL  +   + +A  +      +  + II GN    N   +N  TG +     +DRE+  Q      +        S    +   ++D+ND  P F+K     ++ E+ P+G+ +     +D D+    ++ Y I              +    FS         I P    + + + ++RE  + Y   + A D+ G     ++ + + DINDN+P++    Y +   E T    + + + A D D+    N K+         +F+I+  T ++   ++L        NN  +   +    A  + + PL         + T + ++I D NDN P    +S    + ++ +    L  +T  D+ D  +N E            ++ V+S   S+   R   + G V +    T+     D  KV  Y + I   DKG+P L+      + V +EN ++P F++S     + E+    + I ++SA   DKD Q N  I Y++   GN    F +N   GV+   +  D E+K  +   + A+D G  +++S  ++ ++V D ND  P+F     F +V+   N+     +  + A D+D   N ++ Y I ++    ++ +P+              G ++  G +D E +   ++ V A +       +   V + L   N++ P F     +   +  +S     G ++ ++ A D+D   +G V + + G
Sbjct: 2653 EKEPFHAEILENLSPQRVLVVSALDQDSGPNGQLDYTIIDGN--KENSFSINRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKI-FSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTIS-------------DTSLPFS---------INPSTGDITISRPLNREDTDHYIAKVSAHDS-GWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDE--GFNGKIFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPL--------MSETTVIVNIVDSNDNPPTFESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSE------------IEYVISGGNSSSKFRLDKQTGWVTVASSLTS-----DINKV--YLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISS-GNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQE--NVPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDLFIIDPNT-------------GVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFV----SKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFG 3324          

HSP 18 Score: 90.8929 bits (224), Expect = 7.696e-18
Identity = 80/270 (29.63%), Postives = 134/270 (49.63%), Query Frame = 1
Query: 1543 FDREKVDFYSVLIICIDKGSPQLTSSQQF--SVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQEN-AKIKYSL--DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGL----IEANDEDLDEN-GLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDH 2319
             DREK +  S+ ++  + GS +     +   ++ +LD ND  P+FT+ +Y+ ++ E       +  VSA D DS  + ++  YS+  D   N  F+IN   G +    + DRE   +YN T++A D+G P+ + TA+++V + D ND  P         +V + G +  +   G     + + D DL  N G   Y + +T   V              +T +G+LS    IDRE+ S  Y+ V+ +D G P +S++ TV V +ND ND+
Sbjct: 3346 LDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSEGLSPGGLVTFVSAEDSDSVPSWSRFTYSVTTDREKNA-FTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGP--------TLVTTTGEVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVT----------YFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQNDN 3595          

HSP 19 Score: 82.8037 bits (203), Expect = 2.389e-15
Identity = 167/759 (22.00%), Postives = 313/759 (41.24%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWI-GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG----GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTL-EILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-------DEIGNIYFSINMYGVIFTKEKFDREQKS---LYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG------LIEANDEDLDENGLVWYEI--GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES-----LSPVT 2490
            +++  + E+ P  ++L+ + A      K  + R+ I  GN   +    ++  +G + L+  +D E          +        S    L+  ++D ND  P+F+K  + + ILE++ IG ++    A+D DS      +Y          IM       F  S             + +++K+D ET+  Y   + A D     +   + +V++++D NDN P +  G  +K   +    S  I ++ A D D   +IN +L++ I       +      +     +   I+     + E+ +    + V        L+N   +T+ + D ND+ P  +  S++A + E    +  ILT +   D D   N E    L          V   S +   +R    + +  Q+  ++           YS+ +   D G+ + TS  + ++I+  +  + P+F++  Y   + E     + + S+ A         K++Y +         +G ++      GVI T  + DRE  +   L +   I ++  +P  +  A + + + D ND  PIF      +I++    + V  N+G       + A D D   N LV Y I  GA   +  +P++             G L     +DRE +S   + V A D  +   S+ +TV +T++D+NDH P F   S +  SF +I  +   G ++A + A D D  +NG + + L  ++      L+PVT
Sbjct: 1195 IYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEGNEETQ--FSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYS---------IMANNNHGTFSISPSTG--------SIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTITAHDTD--ADINGELEYSIVQQTPRGNHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKN---ITVWVTDQNDHVP--NFISQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYEL----------VKGDSDTFIMDRYSGDIRVASQLVPSKL---------IYSLTVSATDHGTDRKTSRTELTIIL--QGTDGPVFSQPKYITILKEGQPPGTNVISLDA-SSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQP-HTQRAEVEITLQDINDNPPIFPT----DILD----VTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPES-------------GDLIATKRLDRERRSKYSLLVRADDGQQ---SSDMTVNITVSDVNDHTPKF---SRSVYSF-DIPEDMAPGSIVAAILASDSDSGVNGEITYSLEEDDGDYTFLLNPVT 1876          

HSP 20 Score: 73.1738 bits (178), Expect = 1.916e-12
Identity = 162/732 (22.13%), Postives = 287/732 (39.21%), Query Frame = 1
Query:  448 QLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSP---QLTSSQQFSVIVLDENDNSPIFTKS---IYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY-IDVIA-RDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            +LN +TG L     +DRE L +Q+        +IS    +        ++   I D+ND  P F K   + SI E  P    +    ASD+D  K G   Y I    + T          F   S           Q+ ++ K+D E    YS  ++A D+          + +++ D NDNSP +      + + E     E + S+ A D+D  +  N+ + + I      N+     I   + +  ++ +   +  +  KL +  K        ++  L I ++D NDN P+ +       I EN      +  +T  D D ++N E    +   T            S     P  G++         N   DRE  + + + +   D+  P   +  + +  +V V D+ND+ P F      + E  I+  S+    + +V A D D   N +++Y L +  +  F ++ Y G I    +     K +Y+ TV A+D+G   R ++ + L  +L   D  P+F +     I++         N+  ++A+        + ++ +   S        +   R        G +     +DRE  + +Y +DV A       P +    V +TL D+ND+ P+  FP+      V +      G+ + +L A D D   N  V + ++     S     + G +I  + +  R  R   S  +LVRA D
Sbjct: 1128 ELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEGNEETQ---------FSIDSSSG--------QVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGS--NADITYSI---MANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTITAHDTDADINGELEYSIVQQT------PRGNHFSID---PISGIIF-------SNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFISQNALVAEANIVIGSI----LTTVMAFDPDEGANGEVEYELVKGDSDTFIMDRYSGDIRVASQL-VPSKLIYSLTVSATDHGT-DRKTSRTELTIILQGTD-GPVFSQPKYITILKE--GQPPGTNVISLDASSPRGTGTKVEYFIVSVRS------GGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPI--FPTDILD--VTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLD-RERRSKYS--LLVRADD 1799          

HSP 21 Score: 71.633 bits (174), Expect = 6.388e-12
Identity = 111/516 (21.51%), Postives = 204/516 (39.53%), Query Frame = 1
Query: 1219 LKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER-----PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILV--KVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALN-GSVVFELVGNES-LSPVTIEKDG-----RVILKESIK----------SRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNG 2679
            +   DGG +  T+ +T++I+  D NDN P+         ++EN  +  I+  L   D+D   N                 VM+  + + +       P  G++             D E    Y + +   +    +  S    ++ +   N+  P F    Y FE+ E +   + +G V A D+D  ++  + Y +        F IN   G I+     DRE++   +  V+A + G    +    + V   +LD ND  P+F ++ Y+  + E    ++    +  + A D D   +   W        Y    D EK   F +   + G++S+   +DRE      + ++A D G P  + + T+ VTL D+ND+ P      + +G    +      G  +  L++ D D A N G   + L+   S ++  T+   G     R I +E I           S   +++ +  + V+ +DQ +N  Q     + + Y+       N +P G
Sbjct: 3149 ISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSN----------------SVMAYVIQSSDSDLFIIDPNTGVITTQGF-------LDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFGRSRRKGFGINKKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSE---GLSPGGLVTFVSAEDSDSVPS---WSRF----TYSVTTDREKNA-FTIN-PQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLV---TTTG---EVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQNDNPSQPRSVEIFVHYFG------NMFPGG 3616          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000031516.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:103037566])

HSP 1 Score: 207.608 bits (527), Expect = 1.605e-53
Identity = 187/684 (27.34%), Postives = 316/684 (46.20%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNI---------NSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLK-EVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI-GNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE---SLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            + D+ND  P F++      I ED+  G ++   +ASD DS   G  +Y +E             ED   ++ +    +  +     V + +D ET++ Y  T+ A+D  G+   V +  N+ D+NDN P +    Y  ++ E  T    I ++ A DADD  N          + +  F I TA +  +RKL      S  NL++       + +M L    +        +T  +++ + D ND  P+ + + + A I+EN     ++  +   D D   N      L  +  +    + +  S+    E                    DRE++  YS+ I+  DKG P L+S+   +++VLD NDN+P F+++IY+ EI EN++  +++  V A D D   N +I++S+    GN  F I+ + GVI   +  DRE ++ Y+  V A+D G   R   A++ + +LD NDC P+F    Y   + E+  ++    N+  +   D+D   NG + Y +        N DA         +T +G+L L   +DRE Q    + + A D G P LS S TV V ++D+ND  P+F    S+S    +I+ +  TG  +  ++A D D   NG + + L G +   S++P T +     I+  S+  R  R   + ++LV ASD
Sbjct: 1812 VSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLE-------------EDDGDYTFL----LNPVTGVFNVTQPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQLSYSIASGDPQAHFGITTAGVLQTRKLLDRETQSFYNLVVT------VNDMALPPATR------FTSTAQVSVILLDVNDCPPVFT-SQKMAYIQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGE-------------------LDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGNSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLP--KNILQVVGRDDDYGSNGQLSYSLSG-----GNEDA------AFSLTSSGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLF----SSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSGGDGQFSINPATGQ-----IITSSLLDRESR--GNYQLLVVASD 2422          

HSP 2 Score: 188.734 bits (478), Expect = 1.224e-47
Identity = 192/707 (27.16%), Postives = 311/707 (43.99%), Query Frame = 1
Query:  442 LIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGI--ASYKI-----ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-TEGKR-GHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISI-----TSRSAKIKENKRTLEILTILTVKDED-LEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSS-QQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI-YFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESL 2478
            L  +N  TG ++  S +DRE L     N    +V+ S  ++  E+  +++D+ND  P F    I +S  ED   G  + L  A+D D    G+   +Y+I     +  F+    +    E  F                L     +DRE    Y   +   D  E KR G++ + + I+DINDN P +    Y+ +V E       +  + A D D+  N      ++    F+ID  K G                ++I+ AL    + +  + +  VD G   L   T+ TI + D NDN P++       TS+ A + EN +   ++ +LTV D D    N   S  +         EV +  +      P   ++ +  +        DRE++  Y++ +   D G P   SS     + V D ND+ PIF +++Y+ +I E+    S I  VSA D DS +NA ++YSL    ++ +F+I+   G++ +    DRE  S+    + A D G   + S   ++V + D ND  P F +  Y  ++VE   +    + L  + A D DL  NG V +   A +P      A   + F++  T  GKLS    +DRE+  +  + V A D G PPL +   V VTL D+ND++PVF +P      F NI      G  +  + A D D   NG+V + +   ++ 
Sbjct:   68 LFAINATTGVVYTSSVIDRESLASSVIN---VVVLSSQPTYPTEVRIVVLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFL--------------HLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDEGTPFQID-PKAGT---------------VVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQGHFEVHTSPV------PNLSLIKVASV-------LDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVE---HSPAGSELLSLSATDTDLGANGTVRFTFDAETP------ATVQELFRLD-TITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTLKDINDNRPVF-YPVQY---FANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTF 714          

HSP 3 Score: 176.022 bits (445), Expect = 8.615e-44
Identity = 181/748 (24.20%), Postives = 323/748 (43.18%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVII--SGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI--FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQ---LKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSP---QLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSI-NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESI 2529
            LKE +P  + +I+L A  P         F++   SG   +  L  +   TG +     +DRE        D   I   +        E+   + D+ND  P F    +++++ E+V  G  I    A+D D     + +Y I              +D F+           I P+   L   K++DRE R KYS  LV  D   +   + + + + D+ND++P++    Y   + E      I +     +D  + +N ++ + ++             L      +  +   L    +   ++ ++ VDGGG  ++  +  ++ D NDN P  + +  S  I E+      +  +   D D   N +                +S S+++ + +   G+     ++T   K  DRE   FY++++   D   P   + TS+ Q SVI+LD ND  P+FT     + I EN+   + + +V A D DS  N+ ++YSL     + FSI N+ G +    + DRE+ + Y+ T++A+D G+P  SST  + + VLD ND  P F +  Y+  I E   N     ++  + A+D D   NG + + I A +    N D      F++  +  G +S+  ++DRE +++  + V A D G  P  +  TV + L D+ND  PVF           N++   +    + ++   D DY  NG + + L G    +  ++   G++ L  ++
Sbjct: 1619 LKEGQPPGTNVISLDASSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFRIMQLTATDADEGPNALVTYTI----------ISGADDSFR-----------IDPESGDLIATKRLDRERRSKYSL-LVRADDGQQSSDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVA-AILASDSDSGVNGEITYSLE-----EDDGDYTFLLNPVTGVFNVTQPLDYETQQYYILTVRAVDGGGQASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQ----------------LSYSIASGDPQAHFGITTAGVLQT--RKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVFTSQKMAY-IQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYGVKFSIDNIDGSVRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEE---NTLSGTDVLQVFASDADEGTNGQIRFSIAAGN---GNSD------FRID-SVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKN---ILQVVGRDDDYGSNGQLSYSLSGGNEDAAFSLTSSGQLKLIRTL 2303          

HSP 4 Score: 163.696 bits (413), Expect = 5.688e-40
Identity = 192/727 (26.41%), Postives = 309/727 (42.50%), Query Frame = 1
Query:  463 TGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFE----LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK---RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK-DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATS-PYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIK---SRSHRITQSDR--ILVRASDQ 2589
            +G L LI ++DRE     +D     I  I  GS        +  L+ D+ND VP F+      SI ED P G  + L  ASD D  + G+ +Y +            +F       SI     +II   L     +DRE+R  Y   +VA D            + + + DINDN P++   PY   +   T     +F++   D D  +N  S+L + +      + R   +         I     L G +E+   V  +V DGG    T   T++++     + P+I I  +S    EN+    I+T ++           +    N     H+ + +S  LS K                      D E ++ Y + I   D+  P  ++ ++  + VLD NDN+P+F K  +  EI+EN +    +  VSA D+DS  N ++ Y++ + GN    FSIN   G I T    DRE+ + Y+  V A+D G P +S+  S+++ VLD ND  P F K +   + E   N  V   +  +   DED   N +  Y I  TS P+  NP               G +++   ++RE+       V A D G    + S  VT+ + D+ND+ P F+ PS     ++      + G L+ K+ A D D   NG  +F  + ++S +       G + +K+ ++   S  H     +R   +V ASD+
Sbjct: 2294 SGQLKLIRTLDRE----TQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSG-------GDGQF-------SINPATGQIITSSL-----LDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSN--SQLHYSL------SGRNSEKFKIDPVRGAITASEKLTGSSEVTFTV--RVKDGGSNPKTDSTTVTVRFVTGGDFPIIKIKDKSFTYPENQAINTIVTKVSGTSTRAGPLSYYIASGNLDNAFHVDQ-LSGELSLK-------------------APLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILEN-LSPQRVLVVSALDQDSGPNGQLDYTIID-GNKENSFSINRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIFSATVPE---NAPVGYTVTRVTTTDEDTGANAVSRYTISDTSLPFSINP-------------STGDITISRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPS----YYLEYPELTDVGSLVTKVSATDLDEGFNGK-IFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDR 2941          

HSP 5 Score: 163.31 bits (412), Expect = 6.626e-40
Identity = 170/615 (27.64%), Postives = 267/615 (43.41%), Query Frame = 1
Query:  838 LKVIKKIDRE-TREKYSFTLVALDTEGKRGHVN---IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLD--FKID--------TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLT--ISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIG-NIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRS---STASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFET--GYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            ++   ++DRE   + Y   + A++TE  + H     + + ++DINDN P +      +TV+E       I  L A DAD+  N      I S  D  F+ID        T +L   R+                         K  + ++  DG   Q ++D+T  I++ D ND+ P  S +  S  I E+     I+  +   D D  +N E  +S   +D  Y  L              P  G+        N  +  D E   +Y + +  +D G     SS +    VLD NDN P F  S+Y   I E+    S I +V+A D D   NA++ YS+       +F I   GV+ T++  DRE +S YN  V  +D   P  +   STA + V +LD NDC P+F  Q    I E   N AV   +  ++A D D   N  V Y +G +             +F +    +G + L G +DREE +   + ++A D G+PPLS+++ VT+ + D+ND+ P F      S +  +I  E  T  G  + ++ A D D   NG + F +      S   I+    VI    +  R  R + S  ++V+A+D+
Sbjct: 1671 IQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPIFPTDILDVTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLDRERRS------------------------KYSLLVRADDG---QQSSDMTVNITVSDVNDHTPKFSRSVYSFDIPEDMAPGSIVAAILASDSDSGVNGEITYSLEEDDGDYTFLLN------------PVTGVF-------NVTQPLDYETQQYYILTVRAVDGGG--QASSVRVYFNVLDVNDNRPAFNTSVYSTSISESLTPGSSILTVAASDADDGPNAQLSYSIASGDPQAHFGITTAGVLQTRKLLDRETQSFYNLVVTVNDMALPPATRFTSTAQVSVILLDVNDCPPVFTSQKMAYIQE---NTAVDTVVFTVQATDADSGPNSYVEYSLGGS----------YGVKFSID-NIDGSVRLVGELDREEMANYSLTIVATDKGQPPLSSTMDVTMMVLDVNDNTPSF------SQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNGNSDFRIDSVTGVISVAKLLDRETRASYS--LVVQAADR 2215          

HSP 6 Score: 149.058 bits (375), Expect = 1.493e-35
Identity = 173/672 (25.74%), Postives = 291/672 (43.30%), Query Frame = 1
Query:  547 ISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMN--CEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY---SLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESI 2529
            +S  SF   L   + D+ND  P F +   ++ I EDVP G  I    A+D DS +     Y + +             +   + +I +    +    L     +DRET       + A D   + K  +  +++NI D+ND  P +    Y ++ V+      E+ SL A D D     N  + F  D       ++L R+  I+       E   + M    L V  +  D G   L +   + +++KD NDN P+       A IKEN+     +T ++  D DL  N    ++    DT   H+     +  +         +V++           DRE+   Y + +   D G  +  +    ++ V+D  DN PIFT+  Y F + EN   ++ IG++SA   D   N  I Y   S D+ G   F++N   G I      DRE+++ Y   V+A   G+ +  +  +I VK  D ND  P F    E   V +  N    +++   +A D+D   NG++ Y +        NP       F +   K+G ++L G ++    S+  ++V+A D G P  ++++ +TV++ D+ND+ PVF      S   V + SE        K++A DKD  LNG +V+++ G  +     I  DG++ +K  +
Sbjct:  434 VSRSSFA-SLVIFVNDINDHPPIFQEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVS------------GNSLGWFAISENSGLVTSAAL-----LDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQSSYHVSLVEHSPAGSELLSLSATDTD--LGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYV--RATDAGAPPLHSIAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITAGDTFKFHINSNTGKITT---------LVLL-----------DREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVD--LNTNITYLIASGDQRG--LFAVNSATGHITATSLIDREEQAFYQLKVVAR-GGDVTGEALVNITVK--DLNDNAPHFLHSEEH--VSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQ------QNPKG----LFHIH-EKHGLITLTGPLEV-TTSSYQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVF---DQLSYEVVILESEPVNSRFF-KVEATDKDSGLNGEIVYDITGGNTNDIFGIFPDGQLYIKADL 1038          

HSP 7 Score: 149.058 bits (375), Expect = 1.799e-35
Identity = 187/741 (25.24%), Postives = 309/741 (41.70%), Query Frame = 1
Query:  304 SLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE----LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH----VNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMA----EMKLVVPLKV--VDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKS--FDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLA-KLDAEDKDYALNGSVVFEL 2460
            +++++++ E+ P  S +  + A    + + A  R+ ++SGN      I  N  +G +   + +DRE     +      D      IS+   I  +T    D+ND+VPTF +    +S++E  P G  +    A+D D    G   +  +    +T       ++ F+  +I          +L    ++DRE    Y   + A D      H    VN+ L  KDINDN P +  + Y   +KE       + ++ A D D   N              G  R           ++    G +  +     E K    L+V   DGG L++ T   +TI++ D  DN P+ +    S  + EN     ++  ++    DL  N  +     D                     +RG+  +     +   +   DRE+  FY + ++   +G   +T     ++ V D NDN+P F  S      +EN      I    A D+D   N  I YSL +     F I+  +G+I      +    S Y   V+ASD G P R+ST  + V V D ND  P+F +  YE  I+ES     V++    +EA D+D   NG + Y+I  T    N+            I  +G+L +   +DRE Q    + ++ARD    PLS S+ VT+ L+D+ND++P+F    +++        E   G L+A ++ AEDKD+  N  V +  
Sbjct:  459 AVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISEN--SGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNIT----DVNDQVPTFTQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPAT------VQELFRLDTITG--------KLSTTTELDREDMGSYLLYVRATDAGAPPLHSIAKVNVTL--KDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRN--------------GTVRYTITAGDTFKFHINSNTGKITTLVLLDREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVDLNTNITYLIASGD---------------------QRGLFAVNSATGHITATSLIDREEQAFYQLKVVA--RGG-DVTGEALVNITVKDLNDNAPHFLHSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHEKHGLITLTGPLEVTTSS-YQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILES---EPVNSRFFKVEATDKDSGLNGEIVYDI--TGGNTND---------IFGIFPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLF----NSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSF 1120          

HSP 8 Score: 144.436 bits (363), Expect = 4.262e-34
Identity = 184/644 (28.57%), Postives = 273/644 (42.39%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN-IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSIT---VTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            LT  + D+ND  P F +   E+ ILE  P+        A+D DS   G   Y         DI      D F               QL +   +DRE +++Y+  LVA D   E     VN+ + + D+NDN P +    Y     E      + + + F  D     NS++ +  +T +  N    +    +SS   +  E  ++          +   D G    L++   + + I+D NDNAP  +     A I E+   +  L  ++  D D   N +   H+++       E    S+ + +     G V +           D E    YS+ II  D GS  L+SS   SV VLDENDNSP F+KS    +I+EN      + S++A D DS  NA I YS+    N   FSI+   G IF   K D E +SLY   + A DNG P RSS+  +++ V D ND  P+F     F  +    N+ +  ++  I A+D D D NG + Y I   +P  N+        F +    +G +   G IDRE  +   + V A D   P          +TV + D NDH P F      S + +   +    G +L  + A D D   NG V +ELV  +S
Sbjct:  962 LTVSVYDVNDNAPVFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVY---------DITGGNTNDIFGI---------FPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARRVFAEDKDFGPNSEVRYSFETPQ-PNFELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEG-----NEETQFSIDSSS-----GQVTLV-------GKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYSIMANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPE--NLPLSTSIMTITAHDTDADINGELEYSIVQQTPRGNH--------FSIDPI-SGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFI-----SQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYELVKGDS 1553          

HSP 9 Score: 140.969 bits (354), Expect = 4.669e-33
Identity = 187/753 (24.83%), Postives = 302/753 (40.11%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGN-VRLRNLIQLNFVTGSLHLISSVDREE----LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIK--DINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVII---YQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESY--GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREE------QSTIYIDVIARDHGKP-PLSNSITVTVTLNDLNDHKPVFT---FPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GNE 2472
            + S + + L E+ P  SEL++L A           RF   +     ++ L +L+ +TG L   + +DRE+    L   +  D     + S    I ++   + D+ND  P F   +   +I E+ P G  +    ASD D  + G   Y I               D FKF       +     ++  +  +DRE +  Y   + A D    R H + ++ I   D  DN P +    Y   + E      +    +    D   +N+ + + I +   G+ R L  +   + +         +  A  +L V   V  GG +     + I++KD NDNAP    +       EN  T   +      D+D   N    +S   N     H+ E             K G++ +    ++ T+            Y V ++  D+G PQ TS+   +V V D NDN+P+F +  YE  I+E+   +S    V A DKDS  N +I Y +   GN    F I   G ++ K   DRE +  YN  ++A D      S++ ++ + + D ND +P+F    Y F  +E    G++        + A D+D   N  V Y      P            F++     G+LS    +DRE        +     VI+ D G P PL +   V V + D+ND+ P FT   + +S S S  N++        L ++ A D D   NG V + +  GNE
Sbjct:  562 TQSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTFDAETPATVQELFRLDTITGKLSTTTELDREDMGSYLLYVRATDAGAPPLHS----IAKVNVTLKDINDNRPVFYPVQYFANIKENEPPGSYVTTVSASDPDLGRNGTVRYTITA------------GDTFKF------HINSNTGKITTLVLLDREEKTAYQLQVSATDGGELRSHTHAIVTITVVDTQDNPPIFTQKEYSFVMFENVAPNTVIGTISASTVD---LNTNITYLIAS---GDQRGLFAVNSATGHITATSLIDREEQAFYQLKV---VARGGDVTGEALVNITVKDLNDNAPHFLHSEEHVSAVENWNTGHHIFQAKAFDQDEGTNGMIVYSLQQNPKGLFHIHE-------------KHGLITLTGPLEVTTSS-----------YQVEVVASDRGVPQRTSTLILTVSVYDVNDNAPVFDQLSYEVVILESEPVNSRFFKVEATDKDSGLNGEIVYDITG-GNTNDIFGIFPDGQLYIKADLDREVQDRYNLLLVARDRAVEPLSASVNVTIILDDVNDNRPLFNSTNYVFRFMEEQPRGSLVARR----VFAEDKDFGPNSEVRYSFETPQP-----------NFELNAI-TGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQ-------LLRVSASDVDENKNGQVRYHISEGNE 1235          

HSP 10 Score: 139.043 bits (349), Expect = 1.917e-32
Identity = 164/585 (28.03%), Postives = 263/585 (44.96%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK---RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLE--ILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSR-SSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTV 2295
            +++ +++D+ND  P F  Q++   I E+  +  V+    A+D DS       Y +   +              KFS      +  I   ++++ ++DRE    YS T+VA D +G+      +++ + + D+NDN+P +    Y I ++E T S     L+ F +D     N ++ F I  A  GNS      +    +   L++   +  A   LVV  +  D G        T++I   D ND AP+  ++  + +++EN   L   IL ++  +D+D   N +                +S SLS  NE     +    Q++    ++ DRE  D YS++I  ID GSP L+ S    V+V D ND  P+F+ S +   I E++   S++  V+A D D  +N  I YSL   G+  FSIN   G I T    DRE +  Y   V+ASD G+P+  SS+A + V V D ND  P F    Y  +I  S    A  + +  +   DED   N  + Y +        N +  K    +  IT + KL+          S +   V  +D G  P ++S TVTV
Sbjct: 2017 QVSVILLDVNDCPPVFTSQKMAY-IQENTAVDTVVFTVQATDADSGPNSYVEYSLGGSYG------------VKFS------IDNIDGSVRLVGELDREEMANYSLTIVATD-KGQPPLSSTMDVTMMVLDVNDNTPSFSQNIYDIEIEENTLSGTDV-LQVFASDADEGTNGQIRFSI-AAGNGNSDFRIDSVTGVISVAKLLDRETR--ASYSLVV--QAADRGSSPRVDRATVNIVLLDVNDCAPVFELSPYTVRVQENLADLPKNILQVVG-RDDDYGSNGQ----------------LSYSLSGGNEDAAFSLTSSGQLKLI--RTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGVITYSLSG-GDGQFSINPATGQIITSSLLDRESRGNYQLLVVASDGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPAS---TAPGSLVFAVTVTDEDSGSNSQLHYSLSG-----RNSEKFKIDPVRGAITASEKLT--------GSSEVTFTVRVKDGGSNPKTDSTTVTV 2539          

HSP 11 Score: 134.806 bits (338), Expect = 3.603e-31
Identity = 120/439 (27.33%), Postives = 195/439 (44.42%), Query Frame = 1
Query: 1255 TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTK-NERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYG----NMAVHNNLGLIEANDEDLDE-NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSL---YGVIDREEQSTIYIDVIARDHGKPPLSNSI-TVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSR 2538
            T++ I + D NDN+P+   TS     KE+  +   + + T  D D+  N      ++ TTY  ++    R         P      ++ + T      DRE   FY +LI   DKG P+     Q +V + D NDN P F    Y+  + E++   S +  ++A D+D   N+ I+Y LDE     F I+   G +  KE  D E K  Y+ T+ A DNG PS S      +K+LD ND  P+ + +Y F     +     N  +   + L+  +D D    NG +   I             +   F+V  +    LSL     V+DRE  S+  + V   D+G+P   +S  ++ + +ND+NDH P+F      +   V+IS +   G  +  + A D D   N ++ + LV   SL    I ++  ++   ++  R
Sbjct:  107 TEVRIVVLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSN-----GVDHTTYRIVQGNEQRKFRLDITVNPSGEGAFLHLVTTG---GLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDE--GTPFQIDPKAGTVVIKEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRY-FPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILG---------GNEQGHFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIF----QEAVYKVDISEDVPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLVTSAALLDR 521          

HSP 12 Score: 122.865 bits (307), Expect = 1.408e-27
Identity = 158/613 (25.77%), Postives = 268/613 (43.72%), Query Frame = 1
Query:  856 IDRETREKYSFTLVALDTEGK-RGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGAL-----KGMAEMKLV----VPLKVVDGGGLQ--NTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPI-----FTKSIYEFEIMENSVGSSEIGSVSAPDKDSQE-NAKIKYSL---DEIGNIYFSINMYGV-----IFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDR-------ILVRASD 2586
            IDRE+       +V L ++      V IV  + DINDNSP +      ++ KE  T+ R++    A DAD  +N      ++I     GN ++  R+    + +    EGA       G  + +L     + ++V D G  +      + ++I+D NDN P   +      + E+      +  +T  D+D   N +    L++ T   +              PK G V+I        ++ D E    YS+ I  +D G P L+   + ++ +LD NDN P+     F  +     + EN+   + +  ++  D DS   N  I  S+   +E G  +F ++   V     I      DRE+ S YN TV  SDNG P SRSS AS+++ V D ND  PIF++  Y+ +I E   ++   + +  + A D D  +N  + Y + +               F +    +G ++   ++DRE  S + +++ A+D G  P  +   + V + D+ND  P FT     S   V++      G  L  L A D D   NG+V F     ++ +P T+++  R+   ++I  +    T+ DR       + VRA+D
Sbjct:   84 IDRESLASSVINVVVLSSQPTYPTEVRIV--VLDINDNSPVFPDTSIVVSFKEDATSGRQVILDTATDADIGSNGVDHTTYRI---VQGNEQRKFRLDITVNPSG---EGAFLHLVTTGGLDRELAPFYQLLIEVEDKGEPKRYGYLQVNVTIQDINDNPPAFDLDQYQTSVYEDAAIGSSVLQITATDQDEGANSDIRYFLDEGTPFQID-------------PKAGTVVI-------KEALDYEVKKEYSLTIHAVDNGVPSLSGRTEATIKLLDVNDNDPVVKFRYFPTTSKFASVDENAQIGTVVALLTVSDSDSSSANGNISVSILGGNEQG--HFEVHTSPVPNLSLIKVASVLDRERISSYNLTVSVSDNGRPVSRSSFASLVIFVNDINDHPPIFQEAVYKVDISE---DVPKGSYIKGVSATDGDSGQNANLRYSLVS---------GNSLGWFAIS-ENSGLVTSAALLDRETASVVVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFT----QSSYHVSLVEHSPAGSELLSLSATDTDLGANGTVRFTF---DAETPATVQELFRL---DTITGKLSTTTELDREDMGSYLLYVRATD 643          

HSP 13 Score: 119.398 bits (298), Expect = 1.671e-26
Identity = 152/597 (25.46%), Postives = 250/597 (41.88%), Query Frame = 1
Query:  835 QLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYN--------FTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEAND-EDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDA--EDKDYALNGSVVFEL-VGNESLSPVTIEKDGRVILKESI---KSRSH--RITQSD 2562
            +L +   +D E  EKY   + A D        +  I + + D+NDN+P +   P+   + E  + + +  + A D D  +  N +LD+ I     GN      I   +           +  A+  L V  K  D G  Q +T +++ I   D NDNAP  S    SA + EN      +T +T  DED   N      ++DT+       +  S++     P  G + I       ++  +RE  D Y   +   D G    T S   ++ V D NDN+P F+K  Y  E  E +   S +  VSA D D   N KI Y +      +   +  G IF K++   +  + +N        F V ASD G     S  +++V ++D ND  P F     F  V    ++ V  NL  + A+D +D   N  + Y I              + +F++   + G +++   +  +      +++ A+D G P LS+  T+ + + + N H P F    S S     +S     G  +  L A  +DKD  +NG + + +  GN+    V  EK G + L + +   K + H  RI+ +D
Sbjct: 2603 ELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILENLSPQRVLVVSALDQD--SGPNGQLDYTIID---GNKENSFSINRATGEIRTTRPLDREKTAQYSLKV--KATDRGAPQKSTAVSVVINVLDVNDNAPRFSKI-FSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTISDTS-------LPFSIN-----PSTGDITI-------SRPLNREDTDHYIAKVSAHDSG---WTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNGKIFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTFESSSYFTPVTK--SVKVGTNLIKVTAHDKKDFGVNSEIEYVISG---------GNSSSKFRLD-KQTGWVTVASSLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEF----SQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATD 3153          

HSP 14 Score: 113.235 bits (282), Expect = 1.369e-24
Identity = 135/565 (23.89%), Postives = 237/565 (41.95%), Query Frame = 1
Query:  439 NLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISF--GSFIFELTFLII-----DMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKK---IDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT----TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQI-ETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQEN-AKIKYSLDEIGN--IYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDL 2073
             L  +N  TG L L   +D E+  +QK     H + IS   G +I + +++ +     D+ND  P F   E    + E+VP G ++    A+D DS    + +Y I++                      D ++ II P   VI     +D E ++ Y  T+ A +   E +    N+ + +K  N+  P+++   Y   V E      +   + F +D     +  + + I     G SR+    +   +  + +  G L    E K+ + +   + G ++        + I+I D ND  P+ +      ++ E      ++T ++ +D D                  +      + S   +R K    I  Q  + +     DRE    Y++ ++ ID GSP  T +    V + D NDN P    +    E+MEN    + + ++++ D D   N     YSL   G+   YF++   G + T  + DREQ S +  +V+  D+G P  SST ++ VK+ DQND  P   +  E   V  +GNM    +LG+++  D D+
Sbjct: 3120 GLFVVNEKTGVLSLAKPLDYEK--KQK-----HELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQS---------------------SDSDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTMVG-EVFASDRDLGDDGVVYYLI----FGRSRRKGFGINKKTGQIYVT-GPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSEGLSPGGLVTFVSAEDSD-----------------SVPSWSRFTYSVTTDREKNAFTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLVTTT--GEVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQND-NPSQPRSVEI-FVHYFGNMFPGGSLGIVKPQDPDI 3628          

HSP 15 Score: 110.923 bits (276), Expect = 6.745e-24
Identity = 174/722 (24.10%), Postives = 300/722 (41.55%), Query Frame = 1
Query:  301 SSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETR--EKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITV-KECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESY--GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHG--KPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            S +F   + EN P+   +  +          A  R+ I   ++       +N  TG + +   ++RE+         +H    S  +   ++T  + D+ND  P F+K    L   E   +G ++    A+DLD    G    KI  + +S    +E F        I       ++ QL+             ++SF + A D   K       +++NI D NDN P +    Y   V K       +  + A D  D   +NS++++ I     GNS    R+   +    +    +L        ++ +   D G   L +   L I++ + N + P  S +   A + E+      +  L+ +D+D +        +N     ++       L   NE  K G++ +        K  D EK   + + I   D G    TS    ++ V D NDN P+F    Y   + EN    + +  ++A DKDS  N+ + Y +    +  F I+   GVI T+   D E K +Y+ TV A +  +  R S A++ +++   N+  P F  KQY F + E+   G M     +G + A+D DL ++G+V+Y I   S         + K F +   K G++ + G +DRE++  I + V+A++ G  +    + + V +T+ D ND  PVFT         V +S     G L+  + AED D
Sbjct: 2757 SKIFSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTISDTSLPF----SINPSTGDITISRPLNREDTDHYIAKVSAHD---SGWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDEGFNG----KIFYFIRS---QSENFRINSSTGEI------FVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPLMSETTVIVNIVDSNDNPPTFESSSYFTPVTKSVKVGTNLIKVTAHDKKD-FGVNSEIEYVISG---GNSSSKFRLDKQTGWVTVAS--SLTSDINKVYLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDK------QMNGLITYNISSGNDDGLFVVNE--KTGVLSLA-------KPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDLFIIDPNTGVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTM-----VGEVFASDRDLGDDGVVYYLIFGRS---------RRKGFGIN-KKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFT----QELYDVQVSEGLSPGGLVTFVSAEDSD 3417          

HSP 16 Score: 97.0561 bits (240), Expect = 1.099e-19
Identity = 167/742 (22.51%), Postives = 295/742 (39.76%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE------LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLP------VASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDAD-DQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER-----PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNG 2442
            S ++++IE++EN    ++++ + A         + RF I +GN    +  +++ VTG + +   +DRE       + Q  D   S  V  +       +  +++D+ND  P F      + + E+     + DLP      V  D D    G  SY +    +         +  F  +S           QLK+I+ +DRET+++YS  + A+D+      G   +++ + D+ND  P +    +  ++ E   T  ++  + A D D  QN +   + + +     G+ +              L++   +G  ++ +V      DGG    L ++  +++ + D NDN P          I  +     ++  +TV DED   N +          LH       SLS +N       P RG +      T   K     +V F    +   D GS   T S   +V  +   D  PI       F   EN   ++ +  VS     S     + Y +    + N +    + G +  K   D E    Y   + A D   P  S+   I + VLD ND  P+F K+ +   I+E   N++    L ++ A D+D   NG + Y I          D  K   F +     G++     +DRE+ +   + V A D G P  S +++V + + D+ND+ P F+   SA+     +      GY + ++   D+D   N 
Sbjct: 2136 SQNIYDIEIEENTLSGTDVLQVFASDADEGTNGQIRFSIAAGNG--NSDFRIDSVTGVISVAKLLDRETRASYSLVVQAADRGSSPRVDRA------TVNIVLLDVNDCAPVFELSPYTVRVQEN-----LADLPKNILQVVGRDDDYGSNGQLSYSLSGGNE---------DAAFSLTS---------SGQLKLIRTLDRETQDRYSLIITAIDSGSPSLSGSATVLVLVDDVNDMVPLFSSSSFHTSITEDAPTGSDVLLVNASDGDVGQNGV---ITYSLSG---GDGQFSINPATGQIITSSLLDRESRGNYQLLVVAS----DGGQPTPLSSSAMVSVVVTDINDNPPRFHHHPYVTHIPASTAPGSLVFAVTVTDEDSGSNSQ----------LHY------SLSGRNSEKFKIDPVRGAI------TASEKLTGSSEVTF---TVRVKDGGSNPKTDSTTVTVRFVTGGD-FPIIKIKDKSFTYPENQAINTIVTKVSG---TSTRAGPLSYYIASGNLDNAFHVDQLSGELSLKAPLDYENIEKYVLWIEARDQSFPPYSAYEKIEITVLDVNDNNPVFEKEPFHAEILE---NLSPQRVL-VVSALDQDSGPNGQLDYTI---------IDGNKENSFSIN-RATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKIFSAT-----VPENAPVGYTVTRVTTTDEDTGANA 2788          

HSP 17 Score: 93.5893 bits (231), Expect = 1.174e-18
Identity = 162/747 (21.69%), Postives = 311/747 (41.63%), Query Frame = 1
Query:  328 ENKPIHSELI-NLKAK---LPTAFKE-----AKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQ---LKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFS-LKAFDADDQNNINSKL---------DFKID--TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDE-DLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER--PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSA--PDKDSQENAKIKYSLDEIGN--IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP--YVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVG 2466
            E +P H+E++ NL  +   + +A  +      +  + II GN    N   +N  TG +     +DRE+  Q      +        S    +   ++D+ND  P F+K     ++ E+ P+G+ +     +D D+    ++ Y I              +    FS         I P    + + + ++RE  + Y   + A D+ G     ++ + + DINDN+P++    Y +   E T    + + + A D D+    N K+         +F+I+  T ++   ++L        NN  +   +    A  + + PL         + T + ++I D NDN P    +S    + ++ +    L  +T  D+ D  +N E            ++ V+S   S+   R   + G V +    T+     D  KV  Y + I   DKG+P L+      + V +EN ++P F++S     + E+    + I ++SA   DKD Q N  I Y++   GN    F +N   GV+   +  D E+K  +   + A+D G  +++S  ++ ++V D ND  P+F     F +V+   N+     +  + A D+D   N ++ Y I ++    ++ +P+              G ++  G +D E +   ++ V A +       +   V + L   N++ P F     +   +  +S     G ++ ++ A D+D   +G V + + G
Sbjct: 2653 EKEPFHAEILENLSPQRVLVVSALDQDSGPNGQLDYTIIDGN--KENSFSINRATGEIRTTRPLDREKTAQYSLKVKATDRGAPQKSTAVSVVINVLDVNDNAPRFSKI-FSATVPENAPVGYTVTRVTTTDEDTGANAVSRYTIS-------------DTSLPFS---------INPSTGDITISRPLNREDTDHYIAKVSAHDS-GWTVSTDVTIFVTDINDNAPRFSKPSYYLEYPELTDVGSLVTKVSATDLDE--GFNGKIFYFIRSQSENFRINSSTGEIFVKQQLRYQNSTGHNNANINRHSFIVTASDRGIKPL--------MSETTVIVNIVDSNDNPPTFESSSYFTPVTKSVKVGTNLIKVTAHDKKDFGVNSE------------IEYVISGGNSSSKFRLDKQTGWVTVASSLTS-----DINKV--YLLEITAKDKGNPVLSDKATLKIAVTEENHHTPEFSQSQVIAAVSESLTVGTAIRTLSARDKDKDKQMNGLITYNISS-GNDDGLFVVNEKTGVLSLAKPLDYEKKQKHELRISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQE--NVPSGTIVVKLNATDKDSSSNSVMAYVIQSSDSDLFIIDPNT-------------GVITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFV----SKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFG 3324          

HSP 18 Score: 90.8929 bits (224), Expect = 7.691e-18
Identity = 80/270 (29.63%), Postives = 134/270 (49.63%), Query Frame = 1
Query: 1543 FDREKVDFYSVLIICIDKGSPQLTSSQQF--SVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQEN-AKIKYSL--DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGL----IEANDEDLDEN-GLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDH 2319
             DREK +  S+ ++  + GS +     +   ++ +LD ND  P+FT+ +Y+ ++ E       +  VSA D DS  + ++  YS+  D   N  F+IN   G +    + DRE   +YN T++A D+G P+ + TA+++V + D ND  P         +V + G +  +   G     + + D DL  N G   Y + +T   V              +T +G+LS    IDRE+ S  Y+ V+ +D G P +S++ TV V +ND ND+
Sbjct: 3346 LDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSEGLSPGGLVTFVSAEDSDSVPSWSRFTYSVTTDREKNA-FTINPQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGP--------TLVTTTGEVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVT----------YFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQNDN 3595          

HSP 19 Score: 82.8037 bits (203), Expect = 2.388e-15
Identity = 167/759 (22.00%), Postives = 313/759 (41.24%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWI-GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG----GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTL-EILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-------DEIGNIYFSINMYGVIFTKEKFDREQKS---LYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG------LIEANDEDLDENGLVWYEI--GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES-----LSPVT 2490
            +++  + E+ P  ++L+ + A      K  + R+ I  GN   +    ++  +G + L+  +D E          +        S    L+  ++D ND  P+F+K  + + ILE++ IG ++    A+D DS      +Y          IM       F  S             + +++K+D ET+  Y   + A D     +   + +V++++D NDN P +  G  +K   +    S  I ++ A D D   +IN +L++ I       +      +     +   I+     + E+ +    + V        L+N   +T+ + D ND+ P  +  S++A + E    +  ILT +   D D   N E    L          V   S +   +R    + +  Q+  ++           YS+ +   D G+ + TS  + ++I+  +  + P+F++  Y   + E     + + S+ A         K++Y +         +G ++      GVI T  + DRE  +   L +   I ++  +P  +  A + + + D ND  PIF      +I++    + V  N+G       + A D D   N LV Y I  GA   +  +P++             G L     +DRE +S   + V A D  +   S+ +TV +T++D+NDH P F   S +  SF +I  +   G ++A + A D D  +NG + + L  ++      L+PVT
Sbjct: 1195 IYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEGNEETQ--FSIDSSSGQVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGSNADITYS---------IMANNNHGTFSISPSTG--------SIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTITAHDTD--ADINGELEYSIVQQTPRGNHFSIDPISGIIFSNGQIDREFSNLFELTVKATDQAVPAEFRKFALKN---ITVWVTDQNDHVP--NFISQNALVAEANIVIGSILTTVMAFDPDEGANGEVEYEL----------VKGDSDTFIMDRYSGDIRVASQLVPSKL---------IYSLTVSATDHGTDRKTSRTELTIIL--QGTDGPVFSQPKYITILKEGQPPGTNVISLDA-SSPRGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQP-HTQRAEVEITLQDINDNPPIFPT----DILD----VTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPES-------------GDLIATKRLDRERRSKYSLLVRADDGQQ---SSDMTVNITVSDVNDHTPKF---SRSVYSF-DIPEDMAPGSIVAAILASDSDSGVNGEITYSLEEDDGDYTFLLNPVT 1876          

HSP 20 Score: 73.1738 bits (178), Expect = 2.015e-12
Identity = 172/746 (23.06%), Postives = 291/746 (39.01%), Query Frame = 1
Query:  448 QLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFI-------FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSP---QLTSSQQFSVIVLDENDNSPIFTKS---IYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKL--SLY------GVI------DREEQSTIY-IDVIA-RDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            +LN +TG L     +DRE L +Q+        +IS    +        ++   I D+ND  P F K   + SI E  P    +    ASD+D  K G   Y I    + T          F   S           Q+ ++ K+D E    YS  ++A D+          + +++ D NDNSP +      + + E     E + S+ A D+D  +  N+ + + I      N+     I   + +  ++ +   +  +  KL +  K        ++  L I ++D NDN P+ +       I EN      +  +T  D D ++N E    +   T            S     P  G++         N   DRE  + + + +   D+  P   +  + +  +V V D+ND+ P F      + E  I+  S+    + +V A D D   N +++Y L +  +  F ++ Y G I    +     K +Y+ TV A+D+G   R ++ + L  +L   D  P+F +     I++  G     N + L                   A+SP        K + F V +   GK    L+      GVI      DRE  + +Y +DV A       P +    V +TL D+ND+ P+  FP+      V +      G+ + +L A D D   N  V + ++     S     + G +I  + +  R  R   S  +LVRA D
Sbjct: 1128 ELNAITGELSSTLQMDRESLMRQRGAAVFTFTVISSDQGLPKPLKDQAKVQVYIQDINDNAPKFTKDIYQASISESAPNMTQLLRVSASDVDENKNGQVRYHISEGNEETQ---------FSIDSSSG--------QVTLVGKLDYEATSSYSLKIIAEDSGSVPLSSSCLLSVSVLDENDNSPSFSKSSMSVDILENMRIGELVVSITATDSDSGS--NADITYSI---MANNNHGTFSISPSTGSIFLVRKLDYETQSLYKLNITAKDNGRPPRSSSIPLVIHVRDFNDNPPVFTPGDIFKSIPENLPLSTSIMTITAHDTDADINGELEYSIVQQT------PRGNHFSID---PISGIIF-------SNGQIDREFSNLFELTVKATDQAVPAEFRKFALKNITVWVTDQNDHVPNFISQNALVAEANIVIGSI----LTTVMAFDPDEGANGEVEYELVKGDSDTFIMDRYSGDIRVASQL-VPSKLIYSLTVSATDHGT-DRKTSRTELTIILQGTD-GPVFSQPKYITILKE-GQPPGTNVISL------------------DASSP---RGTGTKVEYFIVSVRSGGKAVGRLFTIGRHTGVIQTAMELDREHGADLYLLDVYAIETEASQPHTQRAEVEITLQDINDNPPI--FPTDILD--VTVQENVGDGFRIMQLTATDADEGPNALVTYTIISGADDSFRIDPESGDLIATKRLD-RERRSKYS--LLVRADD 1799          

HSP 21 Score: 71.2478 bits (173), Expect = 7.005e-12
Identity = 111/516 (21.51%), Postives = 204/516 (39.53%), Query Frame = 1
Query: 1219 LKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER-----PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILV--KVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALN-GSVVFELVGNES-LSPVTIEKDG-----RVILKESIK----------SRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNG 2679
            +   DGG +  T+ +T++I+  D NDN P+         ++EN  +  I+  L   D+D   N                 VM+  + + +       P  G++             D E    Y + +   +    +  S    ++ +   N+  P F    Y FE+ E +   + +G V A D+D  ++  + Y +        F IN   G I+     DRE++   +  V+A + G    +    + V   +LD ND  P+F ++ Y+  + E    ++    +  + A D D   +   W        Y    D EK   F +   + G++S+   +DRE      + ++A D G P  + + T+ VTL D+ND+ P      + +G    +      G  +  L++ D D A N G   + L+   S ++  T+   G     R I +E I           S   +++ +  + V+ +DQ +N  Q     + + Y+       N +P G
Sbjct: 3149 ISATDGGWIAKTSYVTVNIQVTDVNDNPPMFEPDEYFPVVQENVPSGTIVVKLNATDKDSSSN----------------SVMAYVIQSSDSDLFIIDPNTGVITTQGF-------LDYEAKQVYHLTVKAFNVPDEERCSFANVNIQLKGANEYVPRFVSKQYYFEVSEAAPKGTMVGEVFASDRDLGDDGVVYYLIFGRSRRKGFGINKKTGQIYVTGPLDREKEEKISLKVLAKNAGSIRGADIDEVFVNITILDAND-PPVFTQELYDVQVSE---GLSPGGLVTFVSAEDSDSVPS---WSRF----TYSVTTDREKNA-FTIN-PQTGQVSVAAELDRETTPVYNLTLLAIDSGSPAATGTATLIVTLEDINDNGPTLV---TTTG---EVMENQRAGTPVMTLNSVDPDLAPNQGPFSYSLLSTGSAVTYFTLTSSGELSTSREIDREQISDFYLSVVIKDSGVPQMSSTGTVHVKINDQNDNPSQPRSVEIFVHYFG------NMFPGG 3616          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 1.654e-45
Identity = 189/778 (24.29%), Postives = 327/778 (42.03%), Query Frame = 1
Query:  439 NLIQLNFVTGSLHLISSVDREELCQQKDNDCS-----HIVIISF-----GSF---IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIE---------NYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKR--GHVNIVLNIKDINDNSPQWI---GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGA-LKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITS--------RSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTK--------SIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI-----YFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-------QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLA-KLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASDQ 2589
            +L  +N ++G L +   +DRE LC ++ + C      H V ++      GS    + ++  L+ D+ND  P F    + +SI E   +G  + LP A D D+    I  Y+I            F   +   +             +  + +   L++ +++DRE    Y   L   D    +  G V + + + D NDN+P ++     P +IT +       +  L+A D D   N      F      L     L          +   E    + M   +LVV  +  DGG L  +  +T++++  D NDNAP+  + +           KI EN  +   + +++V D DL  +      L   T           L++ N+          Q      +  D E+   Y+V ++  D+G+P+L+      + V+D NDN+P+F          ++YE  + EN    + + ++ A D DS  N  I ++L E+         FS+NM  G +      DRE++  Y  +V A D G P R + A + V VLD+ND  P F          Y+F + E     +V   +G +  +D D  +N  V   +   +     PD           T  G +    V+DRE++    + V A D G+P LS S  V++T++D ND+ PV T P++ + ++ ++ +    G L+   + A D D   NG  ++E++G        +  D G + L  ++ S    +    R++VR  D+
Sbjct:   72 SLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRAL---LELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRIT-EHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVAR--DGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPT--------GAELASPNK---------VQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEE---ETSVGTYVGTVSTSDLDEGDNARVALNLVREA----GPDWIG----GAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNT-NDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGL---HRLVVRVRDR 811          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 1.733e-44
Identity = 183/729 (25.10%), Postives = 303/729 (41.56%), Query Frame = 1
Query:  505 LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD-TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE------CTTSREIFSLKAFDAD---------------DQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKG---SPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL----------DEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETG--YLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILV 2574
            L   +DN     +     SF  ++   + D+ND  P FA  E+EL + E+   G VI    A+D D  +  + +Y +              E  F   +   +        L+  +++DRE R  Y  T+ A D T      +++   ++D NDNSP++    Y   V E       TT   I ++ A DAD               D +  +        T  L  +R                   L   +    V+  +  DGGGL  T  L +++ D NDNAP +   S +A++ E+      L  ++  D+D  +N E                     S  +  P+    +    + +  ++ DRE+  FY++++   D+      +L+S+ + S+I+ D NDN+P FT         ++ VG+  + +V A D DS  N+ ++Y+L             G   F++N + G +    + DRE +  Y  TV+A D G P  +STA++ V V D ND  P F R++YE  I E   +      +  + A D D   NG + Y+I +  P         T  F++     G L++   +DRE  ++  + V ARD G P  S++ +V VTL+D+ND  P F         +   + E   G   L+ ++ A D D   +G V +   G       ++  DG V L  S+     R  Q   +L+
Sbjct: 1480 LSSLRDNGAGSFIRPPMSSF-NQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV----------LSGSEGAFVVDAASGV--------LRASRRLDREERASYLLTVRASDGTHATDARLSVA--VRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRP------------------LDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAEL------------------EFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAV-VATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAE---DEPPGTEVLRLSAWDPDEGANGELRYDIASGDP---------TGDFRLDPVL-GTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQL-----SPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLD----REAQPQHVLI 2128          

HSP 2 Score: 172.17 bits (435), Expect = 1.868e-43
Identity = 187/725 (25.79%), Postives = 318/725 (43.86%), Query Frame = 1
Query:  406 FVIISGNVRLRNLIQLNFVTGSLHLISSVDREELC--QQKDNDCSHIVIISFGSFIFE--LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNIN-------SKLDFKID--TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENK-----SFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEF-NIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY-IDVIARDHGKP------PLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            ++I+SG+   R    + +  G +   +++DREE    Q +       V+ + G    E  ++ L+ D+N+  P F +   E+SI ED P+        A+D DS K G   Y+I                  KF    D        QL V  ++DRETRE+YS T+ A+DT  E     V + + + D+NDN P +    Y     +E      + +++A DAD  +N          +++F++D  T ++ + R            +   E  ++          +   DGG    LQ+   + + ++D NDN P  + +   A + E+   L  L  +T  D D  +N      +N+                 NE  K      + ++ +  +     S DRE+   Y++++   D G+  L +S   +V VLDENDN P FT+S+   + +E++     + +++A D+D+  +  ++Y++   GN +  F+I+   G +F   + D E + LY   V A D G P RSS   ++V V D ND  P F     F +I+E   N+ +   +  + A D D D NG + Y I    P    P A     F +   ++G++     IDRE    ++ + V A D   P       L N   VTV + D ND+ P F  P++     +  ++    G ++  L A D D A N +V + + G ++
Sbjct:  693 YLIVSGD--QRGSFSIEWSGGRIFTANAIDREEQAFYQLR-------VVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGE-----------KFGIFPDG-------QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLR------------VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE----------------GNEGGK------FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI-VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIME---NIPIGTRVITVTARDPDADVNGELHYSIARQFP----PGAH----FTID-PESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKN---VTVLVTDENDNAPRFVTPTAILVDGLRAAA----GSVVGTLQASDPDEAENAAVRYAVTGGDA 1336          

HSP 3 Score: 157.147 bits (396), Expect = 8.736e-39
Identity = 185/728 (25.41%), Postives = 304/728 (41.76%), Query Frame = 1
Query:  436 RNLIQLNFVTGSLHLISSVDREEL------CQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVN------IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQ------KSLYNFTVIASDNGEPSR-SSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRI 2550
            R + +L+ +TG +  + S+DREEL       Q +D     +     GS   ++T ++ D+ND  P F   +   SILE+ P G  +    A+D D    G   Y++               D  +F      ++  +   +     +DRE R  Y   + ALD     GH+       + + + D  D  P +    Y   V E       + S+ A   D    +N+ + + I +   G+ R    I +             +  A  +L V   V + GG+     +++ + D N++AP+    S    I E++        +   D+D   N E    + +        +           P   + + Y++        DRE  + YS+ +  +D G   L+SS   +V VLD NDN P+F  S Y F   E     S +G+V A D D+  N  + YS  E   + F ++   G I +   FDRE        + ++F+V+A+D G P      A++ V V D ND  P F K  Y+ ++ ES  N+     L  + A+D D   NG + Y I          +  +  +F V  +  G+++L G +DREE ++  + V A D G  PL+ S TV V + D ND+ P FT     S   V+       G LL  L A D+D   +G V + +V   + +   I++  G V L   +   + R+
Sbjct:  494 REMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPL-----GS-TAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTA------------GDAARF------QVNAVTGAVSTRVSLDREERAVYQLQVTALDG----GHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD----LNANVTYLIVS---GDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRV---VANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF----------PDGQLYVRYEL--------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNL---TQLLRVTASDVDEGVNGALRYAIN---------EGNEGGKFTVDAS-TGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFT----ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRL 1147          

HSP 4 Score: 155.992 bits (393), Expect = 1.942e-38
Identity = 195/721 (27.05%), Postives = 297/721 (41.19%), Query Frame = 1
Query:  367 AKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTG--SLHLISSVDREELCQQK----DNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQ-----KYGIASYKIENYF---KSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKIT-VKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMN--CEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY---SLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFV-NISSEFETGYLLAKLDAEDKDYALNGSVVF 2454
            A  PTA  E      I+ GN R   ++    V G   L + S +DRE +         +D    V  S  +    L   + D+ND  P FA      ++ E  P G  +    A D DS      +Y I S     +F   +ST ++T                            K+DRE        + A D   + K  + ++ + + D+ND  P +    Y  T V+       + S+ A D+D   N   + +F  D       R++ R+  ++     L     + + E  LVV  +      L +T  +T+ + D NDN P+       A I EN+     +T +T  D D   N    +     D     +  V   ++ST+                    S DRE+   Y + +  +D G  +  S    ++ V D  D  P F +  Y F + EN    + +GSVSA   D   NA + Y   S D+ G+  FSI    G IFT    DRE+++ Y   V+A+  G    +  AS+ V V D N+  P+F R  YE +I E   +  V++    + A D+D  +NG V YEIG           E     K  I  +G+L +   +DRE +    + V A D G  PLS+S+TV VT+ D+ND+KP+F      S S+V +   E E G L+  + A D D   NG V +
Sbjct:  257 ADSPTANGELS--VSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATA---SLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTD-------------------------GKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPA--QYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTG-AVSTR-------------------VSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGS--FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAE---DEPVNSRFFSVRATDKDSGKNGEVKYEIG-----------EGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFN-----SSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTY 899          

HSP 5 Score: 152.91 bits (385), Expect = 1.753e-37
Identity = 155/580 (26.72%), Postives = 258/580 (44.48%), Query Frame = 1
Query:  838 LKVIKKIDRETREKYSFTLVALDTE---GKRGHVNIVLNIKDINDNSPQWI----------GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAK-LGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMS-RSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILK 2520
            LKV  ++DRE    Y+ T++A D      +    ++V+ + D+ND++P++           G P    VK+ T         A DAD  + +N+KL + I +   LG            S  L+  +G +       +V+ +   D G    T  T LT+++ D ND  PL + T   A   EN      +  ++  D DL  N     + +       +E+    SL+ K                   KS DRE+++ Y +++   D+GSP L S+ + +V+V D NDN P+F    Y   I+EN  G + + +V+A D D   N  ++Y L       F +N + G + T+   DRE++++Y   V A D G     S A + + V D  D  P F R  Y F + E   N+A    +G + A+  DL+ N  V Y I +          ++   F ++ +  G++     IDREEQ+   + V+A   G   ++   +V+V ++D+N+H PVF   S      V+I+ +         + A DKD   NG V +E+          I  DG++ ++
Sbjct:  292 LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVT---------AMDAD--SGLNAKLRYSIVSGNDLG------WFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGK---------------VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFE---NVAPGTLVGSVSASTLDLNAN--VTYLIVS---------GDQRGSFSIEWS-GGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYE----VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVR 817          

HSP 6 Score: 148.288 bits (373), Expect = 4.414e-36
Identity = 160/675 (23.70%), Postives = 266/675 (39.41%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE----LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDV-PIGH----VIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTA------KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMN--CEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY---SLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLG------LIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARD 2253
             E+E++EN      +  L A      + A   + ++SG+        ++  +G L     +DREE    L   + +D +H            L+  + D ND  P F++      + ED  P G     VI   +A D DS  +G  +Y +     S D  ++  +  F    +           L V + +DRE+R  Y     A D  G      + +N+ D NDN+P          V E       +  + A   DD   +N++L+F I +        +GN  +LS    +           ++ +++     P +      L +   +++ + D NDNAP  + + RSA   E+     ++  +   D D   N   E++   +               +      +  +V          +  DRE    Y++ ++ +DKG P LTS+   +V V D NDN+P F +  YE  I E+    +E+  +SA D D   N +++Y   S D  G+      + G +      DRE+ + Y   V A D G P+RS TAS+ V + D NDC P F+       +  Y   A  N  G       + A D+DL  +G V Y             A         ++ +G + L   +DRE Q    + + A D
Sbjct: 1521 MELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS---EGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDA-------RLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALA---PSED--SDWADGAFGLHPVTG--------ALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISA--TDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVR-VSDRARHPPAR------LSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLV----------RELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLD-PVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQ-------LSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAA-----------AGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 7 Score: 111.694 bits (278), Expect = 6.827e-25
Identity = 145/631 (22.98%), Postives = 263/631 (41.68%), Query Frame = 1
Query:  262 LNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKR-----GHVNIVLNIKDINDNSPQWIGLPYKITVKECTTS-REIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDL--EMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE--IGNIYFSINM-YGVIFTKEKFDRE-QKSLYNFTVIASDNGEP---SRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI 2103
            +N H  +   D++S  +E+ + E++P++S   +++A    + K  + ++ I  GN   +  I   F  G L++   +DRE   +      +    +   S    +   ++D+ND  P F          E+  +G ++    A+D D+   G  +Y     F+   +  E   +  + +S++  + + +         I +     +SF++VA  T+G R         + + ++D+NDN PQ+    Y+ +V E  ++  ++  + A D D+   +N  L + I+    G    +       +       G+L         + +   D G   L  +  + + + D NDN P  + +  S    E+ R  E+L  LT  DED     +  ++    +T   H    + RS          G V +        +  D E    Y + +   D G P  +S+    V V D NDN P F        IMEN    + + +V+A D D+  N ++ YS+        +F+I+   G I T  + DRE    L+  TV A+D   P    RS+  ++ V V D+ND  P F       +V+     A  + +G ++A+D D  EN  V Y +
Sbjct:  751 VNNHAPV--FDRAS--YEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI---FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS----FEKPQVNFELDSETGRIASLRVFDREAL---------IRQGGAASFSFSVVA--TDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDE--GVNGALRYAINEGNEGGKFTVDASTGQITLL-----GSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT---HATFAIDRST---------GSVFLA-------RRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAI-LVDGL-RAAAGSVVGTLQASDPDEAENAAVRYAV 1331          

HSP 8 Score: 95.9005 bits (237), Expect = 4.796e-20
Identity = 129/524 (24.62%), Postives = 212/524 (40.46%), Query Frame = 1
Query:  946 IKDINDNSPQWI--GLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDL--TISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPI-----FTKSIYEFEIMENSVGSSEIGSVSAPDKDSQ-ENAKIKYSL---DEIGNIYFSINMYGV-----IFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFE-TGYLLAKLDAEDKDYALNGSVVF 2454
            + D+NDN+P +   G+  ++  KE     R++    A D D   N  +   +KI +          R +   +   +   G L   A     + ++  DGG  +    L   ++++D NDN P     +  A + E+                          L D   LH      R        PK GMV   Q         D E    Y++ +   D G+P L+      + +LD NDN P         +     + E++   +    V+  D DS   N ++  S+   +E G  +F ++  GV     +    + DRE+  +YN T++ASDNG+P +RS+TAS++V V D ND  P F        +        +  +  + A D D   N  + Y I      V+  D      F V     G ++  G +DRE  S++ +++ A+D G  P +   ++TVTL D+ND  P+FT        +V  + E    G  +  + A D D   NG+V +
Sbjct:   13 VGDVNDNAPSFPEPGV-MEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAED--------------------SPVGAALRD--LLH----RGRGPLAVPFDPKTGMVSTRQ-------PLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERG--HFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSY--VKDVTAMDADSGLNAKLRYSI------VSGND---LGWFSVD-ESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFT-----QTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY 483          

HSP 9 Score: 94.7449 bits (234), Expect = 9.590e-20
Identity = 98/381 (25.72%), Postives = 165/381 (43.31%), Query Frame = 1
Query: 1495 RGMVIIYQIETNENKSFDREK----VDFYSVLIICIDKGS-----PQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYG--NMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCEN 2598
            RG  +I  ++     SFD       + F S+L    D G+     P ++S  Q  + V D NDN P+F     E E+ EN+     I ++SA D D  +NA + YS+       F ++   GV+    + DRE+++ Y  TV ASD    + ++ A + V V D ND  P F R  Y F++ E            +G + A D D    G V Y   A +P  ++  A+    F +     G L++   +DRE ++   +   A D G   L+ +  + V + D ND+ P     S A+     +  +   G  L ++ A D D  +N  + F +   +      +  DG++ +  ++            ++VR SD+  +
Sbjct: 1449 RGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTY---ALAPSEDSDWADGA--FGLHPV-TGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAA----EVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYN---LVVRVSDRARH 1811          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.162 bits (422), Expect = 8.295e-42
Identity = 163/640 (25.47%), Postives = 284/640 (44.38%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI---ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD---TEGKRGHVNIVLNIKDINDNSPQWIGLPY-KITVKECTTSREIFSLKAFDADDQNNINSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATS-PYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVF 2454
            +T L+ D ND +P F   E+  ++ ED PIG  + L  A+D D+    I SY++   + +F                 S+     +II         +DRE RE Y   + ALD   T G      +V+ + D+ND++P+++  PY             +F++ A DAD     N  L F +  +A  G S    R +  ++        AL+G  +  L + ++V DGG    +  T +T+  +D  +  P  +   RS   +E++     +T++  +          S HL   +  +L +V +         P+ G V ++       ++ D E    Y +++   D G P  ++  +  V VLD NDN+P F+ S +  ++ EN+     I  ++A DKDS  N ++ YS+    IGN++      G I +    DRE  + Y  TV A+D G P++  T  +L+ V D+ND  P F + +  ++ E   + AV   +  +   D D   N  + + +   S P+  +P               G++++   ++RE++S   + V A D   P  + S  VT+ ++D+ND+ P F      +  ++      E   L+A++ A D D   NG V F
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHF-----------------SVNPSTGQII-----TTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDAD--AGPNGDLRFSLSGSASAGFSVDPRRGVIHAAR-------ALQGPRD-DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSS--RRAGPVSYHL--ASGGNLGDVFAVD-------PQSGEVSVH-------RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP-PRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRE---DAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHP-------------STGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF 576          

HSP 2 Score: 124.79 bits (312), Expect = 7.996e-29
Identity = 150/655 (22.90%), Postives = 265/655 (40.46%), Query Frame = 1
Query:  559 SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH--VNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN-------INSKLDFKI--DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMA-EMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            S   +L   ++D+ND  P F+       + E+ P   ++ L  A D DS   G   Y I         +     + F+ +            +++ +  +DRE    Y  T+ A D      H  V +++++ D NDNSP++  + +   V+E       +  +   DAD+  N       ++  L F I   T ++  SR+L+R                 G A +++   P   V       +TD+TI + D NDNAP    T+   +  E      ++  ++  D D   N +    +   T      V   S    + RP R     Y+         +  K   YS ++  +D+G P L+S    ++ ++  N N+P F +  Y   +       + I  +SA D D   N +I YS+   GN    F ++  G +  +     +  S+++ TV A D G P  SS A+ ++ V ++N   P F     E ++ E   N    ++L  + A D D   NG + Y I +          + +  F +    +G + L G +D E +    + V A D G    +    V++++ D+ND+ P+     +AS  +  I     +G  +  +DA D D   N   ++ L   E+
Sbjct:  317 SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSI---------IDGNIGNVFRVNPNSG--------EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDR-------------SGYAVKVRASDPAWTV-------STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENF--RVGRDSGEIHSVRPLR-----YRDPAGGGSGANLNK---YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG-GNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIAS---------GDGSGLFDIS-RASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML----NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA 904          

HSP 3 Score: 111.309 bits (277), Expect = 9.119e-25
Identity = 171/782 (21.87%), Postives = 307/782 (39.26%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQ-----------QKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPV--ASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQP---QLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFS-LKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI-GNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVR 2577
            SSS F  ++ EN P  + ++ L A    +    +  + II GN+   N+ ++N  +G +  +S++DRE +                  C+  V+IS           + D ND  P F  Q     + ED  +G     PV   S LD+ +   A+           I     +    FS         I P   ++ V ++++RE R  Y+  + A D        ++ + + D+NDN+P++    Y I   E +    + + + A DADD  N       +  T      R    I  +         G   G    K    +  +D G   L +   +TI+I   N NAP       S  +    R    +  ++  D D ++N + +             V+  + S + +    G + +         S   +    +SV +   D+G P L+S     + V +EN  +P F     E  + EN    S +  V+A D D+  N  I YS+    G+  F I+   G +    + D E + LYN +V A+D G  +++  + + + V D ND  P+      + ++    N      + +++A D D   N +  Y +          D  +   F V   K G L+  G +D E + T  + V A ++      ++  V V +  +N++ P F        +FV +S     G  +  + A D+D  ++G+V + L G       ++ E  G +I+   +  R    + + R++ +
Sbjct:  337 SSSRFWAKVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIG--NVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLIS-----------VTDENDNSPRF-TQIFSAHVREDAAVG----FPVLRVSTLDADEGPNAA-----------ITFSLLDPSLPFS---------IHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTV-STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIA-----------YSVVGGNASRRFDVDAGGFLHL-------RASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPE--NAPSGTTVLVMDAVDADSPSNAVTMYSL----------DDGEADLF-VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFV---QREYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLD-REREASATLRVIAK 1042          

HSP 4 Score: 100.523 bits (249), Expect = 1.905e-21
Identity = 101/409 (24.69%), Postives = 167/409 (40.83%), Query Frame = 1
Query: 1243 LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKG-SPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV 2463
            L  T  +T+ ++D NDN P        A + E+      + ++   D D  +N   S  L      H            +  P  G +I          S DRE  + Y + +  +D G +P L+SS    V V D ND++P F  + Y      ++   + + +V+A D D+  N  +++SL    +  FS++   GVI         +  L   TV  SD G P RS+  ++ V+  D  +          F+  E   +      + ++ A        G V Y + +     N  D      F V   ++G++S++  +D E Q    + V ARD G PP S  + + V + D+ND+ P F+     S  F     E      +  L A DKD  +NG V + ++
Sbjct:    6 LTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDG-HF-----------SVNPSTGQIIT-------TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFRE---DQPPGTTITVVAARSSR--RAGPVSYHLASGG---NLGDV-----FAVD-PQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS-----SSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSII 375          

HSP 5 Score: 97.8265 bits (242), Expect = 1.103e-20
Identity = 148/609 (24.30%), Postives = 248/609 (40.72%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERF---EDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH------VNIVLNIKDINDNSPQWI----GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHG--KPPLSNSITVTVTLNDLNDHKPVFT 2334
            ++T ++ D+ND  P F +    +   E      ++    ASD D    G    ++  + +S    TE F    D  +  S++ L  +                  KYSF + A+D    RG         + +NI   N N+P+++      P   TV+  T    I  + A D D   ++N ++ + +     GN+ +      + +   + +  +L G A     V ++  D G   L +     IS+ + N  AP  +       + EN      L  +T  D D  +N    +S    D + L     +SR+          G V++           D E    Y++ +   D G    T     S+ V D NDN P+   S Y   I EN+   + +  + A D DS  NA   YSLD+     F +N   GV+ T+   D E K  Y  TV A +  +    STA + V++   N+  P F +++Y F + ES     V   +G + A D D   +G V+Y +   S         ++K F V     G++ +   +DRE +++  + VIA++ G  +    + + V V + D ND  PVF+
Sbjct:  524 DVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANG----QVFFFMRS---QTENFRVGRDSGEIHSVRPLRYR------DPAGGGSGANLNKYSFVVTAMD----RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGT---RILDMSAVDPD--RDVNGQIAYSV---VGGNASR---RFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLF---DISRA---------SGDVLLV-------GELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSES---APVGAPVGSVFATDRDAGIDGTVFYMLFGES---------RSKGFSVN-EHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFS 1071          

HSP 6 Score: 97.4413 bits (241), Expect = 1.800e-20
Identity = 87/295 (29.49%), Postives = 137/295 (46.44%), Query Frame = 1
Query: 1543 FDREKVDFYSVLIICIDKGSPQLTSSQQF--SVIVLDENDNSPIFTKSIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDEN-GLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNI---SSEFETGYL 2397
             DRE+    ++ +I  + GS +     +   +V + D ND  P+F+ ++Y   + E  SVG+  +G VSA D DS    +    L + GN    FSIN + G+I      DRE   LYN TV+A D GEP  + T  ++V + D ND  P                M V N    +EA D DL  N G   +++  + P           R    ++ +G L     IDRE++   ++ V   D G PPL++++T+ +++ D ND+      PS A    V++    S F  G++
Sbjct: 1027 LDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLN----LEAGDPDLPPNKGPYTFQLLGSDP---------AWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFI 1300          

HSP 7 Score: 85.1149 bits (209), Expect = 9.139e-17
Identity = 77/258 (29.84%), Postives = 114/258 (44.19%), Query Frame = 1
Query: 1594 KGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGE-PSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI--GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASG 2355
             G P+LT +   +V+V DENDN P F  +     + E++   S++  V+A D D+  NA I Y L   G+ +FS+N   G I T    DRE +  Y   V A D G  P  SS+A+++V V D ND  P F          S  +      +  + A D D   NG + + +   A++ +  +P     +R  +   +    +L G  D      + + V   D G PP S   TVTV   D  +      FP  A G
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPS--SAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDP-----RRGVIHAAR----ALQGPRD-----DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE------FPRFAPG 235          

HSP 8 Score: 82.0333 bits (201), Expect = 8.619e-16
Identity = 126/567 (22.22%), Postives = 227/567 (40.04%), Query Frame = 1
Query:  922 GHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDR----ILVRASD 2586
            G   + + ++D NDN P++     +  V E      ++  + A DAD    +N+ + +++     G+         I +   +  EG          V+ +  +DGG   GL ++  L +++ D ND+ P        A    +      +  +T +D D   N +    L+ +         S   S     P+RG++       +  ++    + D  ++ +   D G+P  ++    +V   D  +  P F      F   E+    + I  V+A  + S+    + Y L   GN+   F+++   G +      D E +  Y   V A D+G P  S+   + V VLD ND  P F     +  V           + ++ A D+D   NG V Y I          D      F+V    +G++     +DRE  ++  + V A D G P    ++ V +++ D ND+ P FT   SA     ++  +   G+ + ++   D D   N ++ F L+ + SL P +I    G + +       S R+ + DR    + VRASD
Sbjct:    8 GTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDAD--AGLNAIISYRLRGGD-GHFSVNPSTGQIITTASLDREG------RESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA--------SAGFSVD---PRRGVI-------HAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVP---ENTPPRTIVVLTAVDKDSGINGQVDYSI---------IDGNIGNVFRVN-PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSA-----HVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-DPSL-PFSIHPSTGEITV-------SRRLNREDRSGYAVKVRASD 516          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 1.095e-41
Identity = 163/640 (25.47%), Postives = 284/640 (44.38%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI---ENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD---TEGKRGHVNIVLNIKDINDNSPQWIGLPY-KITVKECTTSREIFSLKAFDADDQNNINSKLDFKI-DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATS-PYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVF 2454
            +T L+ D ND +P F   E+  ++ ED PIG  + L  A+D D+    I SY++   + +F                 S+     +II         +DRE RE Y   + ALD   T G      +V+ + D+ND++P+++  PY             +F++ A DAD     N  L F +  +A  G S    R +  ++        AL+G  +  L + ++V DGG    +  T +T+  +D  +  P  +   RS   +E++     +T++  +          S HL   +  +L +V +         P+ G V ++       ++ D E    Y +++   D G P  ++  +  V VLD NDN+P F+ S +  ++ EN+     I  ++A DKDS  N ++ YS+    IGN++      G I +    DRE  + Y  TV A+D G P++  T  +L+ V D+ND  P F + +  ++ E   + AV   +  +   D D   N  + + +   S P+  +P               G++++   ++RE++S   + V A D   P  + S  VT+ ++D+ND+ P F      +  ++      E   L+A++ A D D   NG V F
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHF-----------------SVNPSTGQII-----TTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDAD--AGPNGDLRFSLSGSASAGFSVDPRRGVIHAAR-------ALQGPRD-DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSS--RRAGPVSYHL--ASGGNLGDVFAVD-------PQSGEVSVH-------RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP-PRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVRE---DAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHP-------------STGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFF 576          

HSP 2 Score: 124.405 bits (311), Expect = 1.073e-28
Identity = 150/655 (22.90%), Postives = 265/655 (40.46%), Query Frame = 1
Query:  559 SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH--VNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN-------INSKLDFKI--DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMA-EMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            S   +L   ++D+ND  P F+       + E+ P   ++ L  A D DS   G   Y I         +     + F+ +            +++ +  +DRE    Y  T+ A D      H  V +++++ D NDNSP++  + +   V+E       +  +   DAD+  N       ++  L F I   T ++  SR+L+R                 G A +++   P   V       +TD+TI + D NDNAP    T+   +  E      ++  ++  D D   N +    +   T      V   S    + RP R     Y+         +  K   YS ++  +D+G P L+S    ++ ++  N N+P F +  Y   +       + I  +SA D D   N +I YS+   GN    F ++  G +  +     +  S+++ TV A D G P  SS A+ ++ V ++N   P F     E ++ E   N    ++L  + A D D   NG + Y I +          + +  F +    +G + L G +D E +    + V A D G    +    V++++ D+ND+ P+     +AS  +  I     +G  +  +DA D D   N   ++ L   E+
Sbjct:  317 SAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSI---------IDGNIGNVFRVNPNSG--------EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDR-------------SGYAVKVRASDPAWTV-------STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENF--RVGRDSGEIHSVRPLR-----YRDPAGGGSGANLNK---YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVG-GNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPE---NHPAGSSLARVTATDTDAGVNGAIVYSIAS---------GDGSGLFDIS-RASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML----NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA 904          

HSP 3 Score: 110.923 bits (276), Expect = 1.366e-24
Identity = 171/782 (21.87%), Postives = 307/782 (39.26%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQ-----------QKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPV--ASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQP---QLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFS-LKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEI-GNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI-EKDGRVILKESIKSRSHRITQSDRILVR 2577
            SSS F  ++ EN P  + ++ L A    +    +  + II GN+   N+ ++N  +G +  +S++DRE +                  C+  V+IS           + D ND  P F  Q     + ED  +G     PV   S LD+ +   A+           I     +    FS         I P   ++ V ++++RE R  Y+  + A D        ++ + + D+NDN+P++    Y I   E +    + + + A DADD  N       +  T      R    I  +         G   G    K    +  +D G   L +   +TI+I   N NAP       S  +    R    +  ++  D D ++N + +             V+  + S + +    G + +         S   +    +SV +   D+G P L+S     + V +EN  +P F     E  + EN    S +  V+A D D+  N  I YS+    G+  F I+   G +    + D E + LYN +V A+D G  +++  + + + V D ND  P+      + ++    N      + +++A D D   N +  Y +          D  +   F V   K G L+  G +D E + T  + V A ++      ++  V V +  +N++ P F        +FV +S     G  +  + A D+D  ++G+V + L G       ++ E  G +I+   +  R    + + R++ +
Sbjct:  337 SSSRFWAKVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIG--NVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLIS-----------VTDENDNSPRF-TQIFSAHVREDAAVG----FPVLRVSTLDADEGPNAA-----------ITFSLLDPSLPFS---------IHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTV-STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIA-----------YSVVGGNASRRFDVDAGGFLHL-------RASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPE--NAPSGTTVLVMDAVDADSPSNAVTMYSL----------DDGEADLF-VLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFV---QREYNFV-VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLD-REREASATLRVIAK 1042          

HSP 4 Score: 100.523 bits (249), Expect = 2.070e-21
Identity = 101/409 (24.69%), Postives = 167/409 (40.83%), Query Frame = 1
Query: 1243 LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKG-SPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV 2463
            L  T  +T+ ++D NDN P        A + E+      + ++   D D  +N   S  L      H            +  P  G +I          S DRE  + Y + +  +D G +P L+SS    V V D ND++P F  + Y      ++   + + +V+A D D+  N  +++SL    +  FS++   GVI         +  L   TV  SD G P RS+  ++ V+  D  +          F+  E   +      + ++ A        G V Y + +     N  D      F V   ++G++S++  +D E Q    + V ARD G PP S  + + V + D+ND+ P F+     S  F     E      +  L A DKD  +NG V + ++
Sbjct:    6 LTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDG-HF-----------SVNPSTGQIIT-------TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFRE---DQPPGTTITVVAARSSR--RAGPVSYHLASGG---NLGDV-----FAVD-PQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS-----SSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSII 375          

HSP 5 Score: 97.4413 bits (241), Expect = 1.505e-20
Identity = 148/609 (24.30%), Postives = 248/609 (40.72%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERF---EDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH------VNIVLNIKDINDNSPQWI----GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHG--KPPLSNSITVTVTLNDLNDHKPVFT 2334
            ++T ++ D+ND  P F +    +   E      ++    ASD D    G    ++  + +S    TE F    D  +  S++ L  +                  KYSF + A+D    RG         + +NI   N N+P+++      P   TV+  T    I  + A D D   ++N ++ + +     GN+ +      + +   + +  +L G A     V ++  D G   L +     IS+ + N  AP  +       + EN      L  +T  D D  +N    +S    D + L     +SR+          G V++           D E    Y++ +   D G    T     S+ V D NDN P+   S Y   I EN+   + +  + A D DS  NA   YSLD+     F +N   GV+ T+   D E K  Y  TV A +  +    STA + V++   N+  P F +++Y F + ES     V   +G + A D D   +G V+Y +   S         ++K F V     G++ +   +DRE +++  + VIA++ G  +    + + V V + D ND  PVF+
Sbjct:  524 DVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANG----QVFFFMRS---QTENFRVGRDSGEIHSVRPLRYR------DPAGGGSGANLNKYSFVVTAMD----RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGT---RILDMSAVDPD--RDVNGQIAYSV---VGGNASR---RFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLF---DISRA---------SGDVLLV-------GELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSES---APVGAPVGSVFATDRDAGIDGTVFYMLFGES---------RSKGFSVN-EHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFS 1071          

HSP 6 Score: 97.0561 bits (240), Expect = 2.058e-20
Identity = 87/295 (29.49%), Postives = 137/295 (46.44%), Query Frame = 1
Query: 1543 FDREKVDFYSVLIICIDKGSPQLTSSQQF--SVIVLDENDNSPIFTKSIYEFEIMEN-SVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDEN-GLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNI---SSEFETGYL 2397
             DRE+    ++ +I  + GS +     +   +V + D ND  P+F+ ++Y   + E  SVG+  +G VSA D DS    +    L + GN    FSIN + G+I      DRE   LYN TV+A D GEP  + T  ++V + D ND  P                M V N    +EA D DL  N G   +++  + P           R    ++ +G L     IDRE++   ++ V   D G PPL++++T+ +++ D ND+      PS A    V++    S F  G++
Sbjct: 1027 LDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVG-VSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLN----LEAGDPDLPPNKGPYTFQLLGSDP---------AWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFI 1300          

HSP 7 Score: 85.1149 bits (209), Expect = 9.765e-17
Identity = 77/258 (29.84%), Postives = 114/258 (44.19%), Query Frame = 1
Query: 1594 KGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGE-PSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI--GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASG 2355
             G P+LT +   +V+V DENDN P F  +     + E++   S++  V+A D D+  NA I Y L   G+ +FS+N   G I T    DRE +  Y   V A D G  P  SS+A+++V V D ND  P F          S  +      +  + A D D   NG + + +   A++ +  +P     +R  +   +    +L G  D      + + V   D G PP S   TVTV   D  +      FP  A G
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPS--SAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDP-----RRGVIHAAR----ALQGPRD-----DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE------FPRFAPG 235          

HSP 8 Score: 81.6481 bits (200), Expect = 1.072e-15
Identity = 126/567 (22.22%), Postives = 227/567 (40.04%), Query Frame = 1
Query:  922 GHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG---GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDR----ILVRASD 2586
            G   + + ++D NDN P++     +  V E      ++  + A DAD    +N+ + +++     G+         I +   +  EG          V+ +  +DGG   GL ++  L +++ D ND+ P        A    +      +  +T +D D   N +    L+ +         S   S     P+RG++       +  ++    + D  ++ +   D G+P  ++    +V   D  +  P F      F   E+    + I  V+A  + S+    + Y L   GN+   F+++   G +      D E +  Y   V A D+G P  S+   + V VLD ND  P F     +  V           + ++ A D+D   NG V Y I          D      F+V    +G++     +DRE  ++  + V A D G P    ++ V +++ D ND+ P FT   SA     ++  +   G+ + ++   D D   N ++ F L+ + SL P +I    G + +       S R+ + DR    + VRASD
Sbjct:    8 GTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDAD--AGLNAIISYRLRGGD-GHFSVNPSTGQIITTASLDREG------RESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA--------SAGFSVD---PRRGVI-------HAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAA--RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVP---ENTPPRTIVVLTAVDKDSGINGQVDYSI---------IDGNIGNVFRVN-PNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSA-----HVREDAAVGFPVLRVSTLDADEGPNAAITFSLL-DPSL-PFSIHPSTGEITV-------SRRLNREDRSGYAVKVRASD 516          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 161.384 bits (407), Expect = 1.153e-40
Identity = 167/673 (24.81%), Postives = 289/673 (42.94%), Query Frame = 1
Query:  439 NLIQLNFVTGSLHLISSVDREELCQQKDNDCSHI-VIISFGSFIFELTFL---IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNN------INSKLD------FKID--TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKL----VVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISI----TSR--SAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIG----NIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGL------IEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY-IDVIARDHGKPPLSNSITVTVTLNDLND 2316
            +L+ +    G++     +DRE+ C Q  +      V+ +    +F+L      ++D+ND  P FA+ E+ + I E V +G  + L  A DLD     + +Y ++   +    +  R  D  K++            +L V  ++DRE   +Y+  L A D     + G   + + + D NDNSP +      +TV+E  T    + +L A D D+  N       +S +D      F++D  T KL                      +LKG  + +L     + ++  D G   +     + + ++D NDNAP I +     SR  +  + E       + ++TV D D   N   +CHL    +  L              P R   ++       N S DRE++  Y +++   D G+P   +++QF+V +LDENDN P F +S YE  ++EN+   + + +V+A D D++ N  I Y++   E+     + Y SIN   G I+     D E  +   F V A D+G P   + A++ V+++D+ND  P+       N     G + +  + GL      + A D D + NG + Y I       N  +  +  R   ++  N       V D    +T + + V+ RD G P LS +  + + +    D
Sbjct:   73 SLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRAR-TDGAKYA------------ELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKL----------------------SLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLL-------------PYRDDYVVVT-----NSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRN---GTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQG----NERNLFRINRLGGEVFTNAA----SVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGD 681          

HSP 2 Score: 127.872 bits (320), Expect = 3.576e-30
Identity = 141/550 (25.64%), Postives = 232/550 (42.18%), Query Frame = 1
Query:  928 VNIVLNIKDINDNSPQWIGLPYKITVKECTT---------SREI----FSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSP------IFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYG---VIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI------GAT-SPYVN-NPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGS-FVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GNE 2472
            V+  + + DIND++P +      + + E            +R++     +L+A+  D+       L  + D AK                  ++++  L    E +  + L   DGG      TT + I++ D NDN+P+ + TS +  ++E+     +L  L   D D   N E     +      ++ +           PK G + +           D E    Y + I   D G   + +  +  V V D NDN+P      I         + E +   S +G V+  D DS EN  +   L   G+ +F +  Y    V+ T    DREQ + Y   + ASD G P R +     V++LD+ND +P F R  YE +++E   N +    +  + A D D + NG++ Y +      GA+ S YV+ NP              +G +     +D E  +++   V ARD G PPL  + TV+V + D ND+ PV T P   +G+  V +  +   GYL+  + A D D   NG + + +V GNE
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAE---------------LVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLD-------PKTGKLSL-------KGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR--GHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLE---NNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINP-------------SSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNE 622          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 177.178 bits (448), Expect = 9.811e-45
Identity = 190/714 (26.61%), Postives = 310/714 (43.42%), Query Frame = 1
Query:  577 TFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH---VNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN--IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF--------TFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESL-----SPVT-----IEKDGRVILKESIKSRSHRI-TQSDRILVRASDQCENCHQSEVGSLILR 2634
            T  ++D+ND  P F       S+ E++PIG  +    A+D D  +    +Y++               D  KF      E+      +   + +DRE +  YS  + A+D  GK        I L I D+NDNSPQ+    Y +TV E T +     L+   +D     N ++ + I +   GN+ ++       +   ++   AL   A   L +  K        +T  + I++ D NDN+P+ +    S  I E       + ++T  D D   N +  +S    DT+   +   M+  L+ K E                    +RE V  Y++ I   D+GSP +TS ++ +V+V D NDN P+F    Y   + ENS  S+ + +V+A D D   NA ++YS+   GN    F IN   GVI T    D E+KS Y   V A+D+   +++   ++ ++V++ ND  P F +Q Y  ++ E+        +  +++ +  D D  G + Y I      V   D++K   F +   ++G +S   V+DRE  S   I V   D G PPLSN   VT+ + D ND+ P F           +SA  SF      F       KL A D D   N  + + L  N++      S V      ++++ +     +I++R H    Q+  I +R +    N H+  + S  LR
Sbjct: 1086 TIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELS------------VGDTSKF------EVNPATGLVTTKRPLDREDQASYSLRVTAMD-HGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNI-LRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREAL---ASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAIN-AMNGVLTVKKE-------------------INRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIIS-GNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKT---NVTIRVINLNDITPAFTQQNYTASVRENS-----PTSTSVVKVSASDRDSFGSLSYSI------VGGKDSDK---FSID-QRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSF-----SF-------KLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLR 1725          

HSP 2 Score: 161.384 bits (407), Expect = 7.939e-40
Identity = 196/766 (25.59%), Postives = 322/766 (42.04%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGL---QNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL-VGNES---LSPVT-IEKDGRVILKESIKSRSHRITQSD 2562
            S S +  ++ E+  I S ++ + A    +    +  + +ISGNV+    I  N  +GS+ + S +DRE          +     +  S    +T  + D+ND  P F    +   + E    GH I    A+D D    G   Y + +             D F  ++   L        + +  ++D E + +Y  T+ A D  T  +     + + + D+NDN PQ+    Y  TV E       +  + A DAD  +  N K+ + I +   GN      +   +      +    + +A   L +     D G L      T + ISI D NDN P  +  SR   I E+  T   +  LT  D D+  N          TY  +      S       P+ G++ +         + DRE +  Y++++   D GSPQ + +    V VLD NDN+P F KS++  EI E++   S +  V   DKD   N  I  SL   G+  F+I+  G + +K   D E  + Y  TV A D G PS+S+TA + + +++ ND  P F    +   +    ++A+  N  +++ N  D D   L +  +          +      FK+    +G +S+   +DRE  +   + V A + G    S     T+ + D+ND+ PVF  P S + S   +      G  +AK+ A D+D   N  V +EL VG+ S   ++P T +    R + +E   S S R+T  D
Sbjct:  479 SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDAN--SGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV-FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-----------TDVFSINTSTGL--------ITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDAD--SGANGKISYSILS---GNENMAFAMDRFTGEITTRVPLDRETIASYSLTIN---ADDGSLVRFMAATTVNISIADENDNQPTFTGPSR-FNISEDSPTGTRVGQLTATDRDIGPNGAV-------TYAIISGNQGNSFQLD---PRSGILSV-------RSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPE--DVAI--NTHVVKLNATDSDGTPLTFDIV----------EGNAGSSFKID-QSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFN-PGSYAKS---LHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMD 1177          

HSP 3 Score: 152.91 bits (385), Expect = 3.009e-37
Identity = 189/727 (26.00%), Postives = 308/727 (42.37%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQ------QKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRG--------HVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFS-CHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            S S + + + EN    S ++ + A  P A    +  + IISGN    N  +++  TG + ++  VDRE L         KD+     V  +F      +   + D ND  P FA  E    I E V IG  + +  A+D D        Y I     S           F  +++  +        L V K+I+RET   Y+ T+ A D    RG         + +V+N  D+NDN P +    Y  +V+E    S  + ++ A D+D     N+ L + I +   GN  K  +I   S   +       +  ++  L V             T++TI + + ND  P  +  + +A ++EN  T   +  ++  D D   +  +S     D+    + +             + G++    +        DRE V  Y++ +   D G+P L++    ++ +LDENDNSP F  S Y   I+ENS  SS    ++A D D   NA+I Y+L    N  F I    GVI   +  DRE KS Y+  + A D+G P ++S+ +I V V+D ND +P+         V    N     ++  I A+D D   N  + + +      ++N   E    F +  T  G +S    +DRE+Q+   + +   D G P LS+   V + + D +D+ P F  P+  +   V IS     G  + ++ A D D
Sbjct: 1204 SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGN--HGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF------VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS----------AFAINAMNGV--------LTVKKEINRETVPTYTLTIRASD----RGSPMMTSDKELTVVVN--DVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSD--VGANAVLRYSIIS---GNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEV---TATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQ-------------RSGIISTADV-------LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSR--NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRE--NQPKETHVMRILASDADTGLNAELTFSL------LSN---EHKSVFTLDNTT-GDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQ-PTEYN---VTISESLPRGASIVQVTARDID 1852          

HSP 4 Score: 152.91 bits (385), Expect = 3.304e-37
Identity = 195/789 (24.71%), Postives = 327/789 (41.44%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREE------LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNN--INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSD-RILVRASDQCENCHQSE 2613
            S S ++  +KEN P  +++    A    +       F II GN     +  ++  TG + +  S D E         Q +D      V + + +   ++T  I D+ND  P F+       I E   IG  +    A+DLDS   G   Y+         +++   +  F   +            ++V  ++DRET   YS  + A D  +  +     + + ++DINDNSP + G PY   V E ++   +I  + A DADD +N  +   L    D   +  S  L  +              L    + + +V +   DGG     + T + + + D NDN P  + +  +  + EN      +  +T  D D   N + S  +     L   E M+ ++    +R        +  E       DRE +  YS+ I   D    +  ++   ++ + DENDN P FT     F I E+S   + +G ++A D+D   N  + Y++     GN +      G++  +   DRE    Y   V ASD G P +S TASI V VLD ND  P F K  +   I E   + +VH+ +  ++  D+D   NG +   +            E +  F +  T  G +     +D E  +   + V ARD G P  S +  V +T+ ++ND+ P F  P+  +    +I  +      + KL+A D D      + F++V   + S   I++   +I   S+  R  R T ++  ++VRA+   E   Q E
Sbjct:  377 SPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGN--DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRG----VPVKYDTA--QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYR---------LISGNVKGAFNIDANSG--------SIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQG-PYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQ-----------LDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI-----LSGNENMAFAM----DR--------FTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP-SRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIRE---DASVHSTVLQVKVEDKDEGSNGAITLSLS----------GEGSDNFTIDST--GFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVT----SIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLI---SVAKRLDRETTANYTLVVRAT---ETGSQGE 1079          

HSP 5 Score: 149.443 bits (376), Expect = 3.223e-36
Identity = 167/647 (25.81%), Postives = 275/647 (42.50%), Query Frame = 1
Query:  577 TFLIIDM---NDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIF-SLKAFDADDQNNINSKLDFKI---DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIK--DCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCE--FSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGN--IYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYE-IGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGN 2469
            T ++ID+   ND  P F       +I E+ P   V  +  A+D DS      +Y +                   FS      M     +++ +  +D ET++ Y+  + A D  GK      ++ + D+NDN+P +    YK  V E      I   L A D D    IN++L + +   DT+             + S  +I  +GA     +    V L+  DGG    +   T+ I+  D NDN P+ S    +A + E+      +  +T  D+D   N +  +S    +T +    + ++            G+V +       ++S D E+   Y++ +   D+GSP LT +    + V D NDN P+F+ S Y+  + EN+   ++   VSA D+DS  N  + + + + GN    F+I+   G+I   +  D E K+ Y+ TV A D G P +  TA + + + D ND  P+F    Y   I ES     + + +  + A D D    G + Y  I        N DA            +G + +   +DRE   +  + V ARD G    S+S  VT+ L D+ND+ P+F  P         +S     G+ + ++ A D D + NG V + L  N
Sbjct:   54 TVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVA-IVTATDRDSGTNAAITYSL-------------------FSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFD--GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD--VGINARLSYSLVSGDTSYF----------TVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVT------------GVVTV-------SRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIK-GNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPES---TVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDA-----------NSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP-----YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN 624          

HSP 6 Score: 149.443 bits (376), Expect = 3.724e-36
Identity = 190/754 (25.20%), Postives = 329/754 (43.63%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG----SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVN---IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKI---DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM-KLVVP-----LKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDF-----YSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI---YFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE 2496
            L EN PI   +  + A      + AK  + +  G+    +  ++N  TG +     +DRE+           +  +  G    S +  +T  I D+ND  P F++ +  L++ E+   G  I   +ASD D+   G  +Y          I++    + F+  S           ++ V+  +DRE    Y+ T+ A D+ G    V+   + + + D NDNSP +        + E  +    +  + A D D+ +  N+++ + I   DT+                  +  + G L    E+ +  VP     ++  D G    T+D  LT+ + D NDN P+ +  S    ++EN  + +  ++LTV  +D ++                  V+  S+ + N+  +      ++I +          +DF     Y + +   D    + T+    ++ V++ ND +P FT+  Y   + ENS  S+ +  VSA D+DS     + YS+  +G      FSI+   G+I T +  DRE  SLY   V  +D G P  S+   + +K+LD+ND  P F    Y  +I+E   N A  +    + A D D   N  + Y +             +   F +  + +G ++L   +DRE +ST  + + ARDHG PP ++SIT+ VT+ D+NDH+P+    SS  GS V  +   ET  +  ++ A D D  LN  + F L+ NE  S  T++
Sbjct: 1108 LHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT---SKFEVNPATGLVTTKRPLDREDQASY----SLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYS---------IISGNHGNAFRIDSTTG--------RITVVGVVDREALASYNLTISAKDS-GVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS--NAQVFYSIVRGDTSAFA---------------INAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVREN--SAQSTSVLTVAADDSDVGA--------------NAVLRYSIISGNDEKR------FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSYSI--VGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILE---NSAPSSFSFKLAATDADEGTNARITYNL------------SRNDAFMIGAS-SGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLIN-SSSLRGS-VRENQPKETHVM--RILASDADTGLNAELTFSLLSNEHKSVFTLD 1770          

HSP 7 Score: 145.206 bits (365), Expect = 6.094e-35
Identity = 143/562 (25.44%), Postives = 244/562 (43.42%), Query Frame = 1
Query:  850 KKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAK---LGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPL----------KVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHL--NDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GN 2469
            +K DRE+  +Y  T++A D   +  +G   +V+++KD NDN+P++    Y   ++E T + ++  + A D D  +  N+ + + + + +   + NS+                        E++ V PL          ++    G   T    I++ D NDNAP  +++     + E+     I+  LT  D D+ +N   S  L   DT+Y  +                +G++           +FDRE    Y V +   D GSP  +      + +LD NDN P+F+ + Y   + E+    + + +V+A DKD+  NA ++YS    GN    F+++ + GV+      D EQ+S Y   +  +D G P  + T+ +L+ V D ND  P+F    Y+  + E   N         + A D D   NG + + I        N D      F +     G +S+    D E ++   + V ARD G P   ++  VT+ + D+NDH PVF+ PS+ S     I      G  +  + A D D    G + + L+ GN
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRD--SGTNAAITYSLFSGENKFMMNSK----------------------TGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVD--------------SQGVI-------RTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS-GNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE---NTPAGTQ---VSATDRDSSTNGALVFGI-----IKGNDDGV----FTID-GSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFS-PSNYSK---QIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGN 521          

HSP 8 Score: 136.346 bits (342), Expect = 3.548e-32
Identity = 118/411 (28.71%), Postives = 198/411 (48.18%), Query Frame = 1
Query: 1255 TDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKS---FDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV-GNE 2472
            T + I +KD NDNAP   + S    I+EN    ++  I+T  D D   N   +  L                S +N+        +   +T E ++    D E  D Y++ I   D             + V D NDN+P F  S+Y+  + E+    S +  ++A D D   NA++ YSL      YF+++  GVI TK  FDRE K+ Y   + A D G PSRS  A++ +++LD ND +P+F   QY  ++ E   ++A+   +  + A+D+D   N  + Y    TS   N+        F +     G +++   +D E++S+  + +   D G PPL+++  + + +ND+ND+ PVF+   SA  S V  ++   T     ++ A D+D + NG++VF ++ GN+
Sbjct:   54 TVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQV-AIVTATDRDSGTNAAITYSL---------------FSGENK-------FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL----ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDE---DVAIGAAMVTVTASDKDNGNNADLRYSF--TSGNTNHA-------FTLDAVT-GVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS--PSAYQSRVKENTPAGT-----QVSATDRDSSTNGALVFGIIKGND 417          

HSP 9 Score: 60.4622 bits (145), Expect = 4.407e-9
Identity = 61/253 (24.11%), Postives = 110/253 (43.48%), Query Frame = 1
Query: 1831 VIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            +  T  KFDRE +S Y  TV+A D           +++ V D+ND  P F    Y FNI E+     V     ++ A D D   N  + Y +                +F +  +K G++     +D E + +  + + A D GK     +    +T++D+ND+ P F      +G + +++     G ++ +L A D D  +N  + + LV  ++ S  T++  G +  K +    +     S ++ +RA D
Sbjct:   21 ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQV----AIVTATDRDSGTNAAITYSL-----------FSGENKFMMN-SKTGEIRTVTPLDHETKDSYTMRISAFD-GK---HTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVA----VGSIVRQLTAVDLDVGINARLSYSLVSGDT-SYFTVDSQGVIRTKGAFDRETK---ASYQVALRAQD 245          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 158.688 bits (400), Expect = 6.076e-39
Identity = 208/813 (25.58%), Postives = 338/813 (41.57%), Query Frame = 1
Query:  271 HFSISKLDKSSSLFE-----IELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGS--LHLISSVDREELCQQKDNDCSHIVIISFGS------FIFELTFLIIDMNDEVPTFAKQEIELSILEDVP----IGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALK-------GMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNN-LGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKV-QITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSIT-VTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS 2610
            H S++ L+ +  +F+     +E  EN  I   +  LKA    + K A  RF+I  GN       ++  V GS  + L   +DRE     +DN    +  +  G        I  +T  ++D+NDE P F+K E   +I E       IGHV             + I+  K  N      I     ++    +S   L ++          ++D E       T+ A D  T    G+ N+ + + DINDNSPQ+      + + E T      +++  FDAD              +  LG           +  NL    GAL        G +     +P++  DGG     +T  L + + D ND +P+    S +A + E       +  +   D D   N   S       Y    +V +     +N     G + I           DRE ++ Y++ +I ID G+P+ +SS    VIV D NDN+P F ++ Y F + EN   ++ +G+VSA D D   N  + Y  D     +      G I T +  DRE K+ Y F+++A+D G   R     + V V D NDC P F K +Y   + E   ++ V ++ L LI  +D+    N  + Y I      V  P     K F + Q+T  G L+L   +DRE      + V+A D G      +IT + + + D+ND+ PVF   +    +F  +  +   G ++A + A D D   NG V +++V   +     I +   VI   ++++    +T    + V A+D  +   ++
Sbjct:  586 HVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNAD-----EVFSVDGSGLITLAKLLDRE----TQDNYLLTVKAVDGGGQDSVNKAIVNIT--VLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHV-------------HAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQ---------SEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDAD--------------SGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRIS-------YAFDSKVDTSKFGLRNG----GKIFI-------KSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNE---DLPVGSSLLTLIATDDDQQGPNSDITYMI------VAGP-----KAFSLNQVT--GVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINET----TFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVI--STLRALDFEVTNRYVLRVSATDMGKKQQKT 1311          

HSP 2 Score: 153.295 bits (386), Expect = 2.479e-37
Identity = 160/596 (26.85%), Postives = 265/596 (44.46%), Query Frame = 1
Query:  856 IDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWI-GLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXX--XXXXXEGALKGMAEMKL---VVPLKVVDGGGLQNTT--DLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSP-QLTSSQQFSVIVLDENDNSPIFTKSIY---EFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFS-----INMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVT-IEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            +DRE    Y+ T+V   T  K     +++ ++D+NDNSP ++ G   K+ V E   + + F  K    D     NS   + I +  +GN  KL        +    +++  +  G+   +L   V+ +   DGG   N     L+I+++D NDN P  S  S S  I EN      +  ++  D+D+  N E    +         E  S   +     P  G+++        N   D E    Y +++   DKGS  QL+SS    + VLD NDN+P+   S      +++ EN+   +++  VS  D DS +N ++  +L E G+ YFS     +N   +I   +  DRE    +    +  D G+P R++  S  + V D NDC P F R  YE  + E   N  V+  + ++ A D+D   N  + Y I  T+      ++     +      +G ++    +DRE+   + + V+  D G PPLS++ +V V L D ND+ P F   S  +  F N  S    G  + +L A+D D   N  +++ +     L+P T    D R  L  + ++  H +  S    V A+D
Sbjct:   20 LDREKVSAYNLTIVEFSTPPK--SYTVLVYVQDLNDNSPSFVRGTSAKLVVFE---NDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI---------ETHSDPQAIFGIHPTTGVIV-------NNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTL-EGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWE---NATVNTLVAIVNAVDQDFGSNSELVYTIANTT------ESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPS----GSPVVQLLAQDPDIGENSLILYSI-----LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATD 575          

HSP 3 Score: 141.739 bits (356), Expect = 8.929e-34
Identity = 192/736 (26.09%), Postives = 316/736 (42.93%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLP-TAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGS--FIFELTFL---IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVN---IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLG-----NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTV-KDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDE-IGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            + + + E+ P+ S L+ L A         +   ++I++G         LN VTG L L+S +DRE   +       H+V    G    +  +T++   ++D+ND  P F  +    ++ E +PIG V+   +A D D    G   YKI N   +TD         FK +    +        +  ++ +D E   +Y   + A D   K+   +   + + ++D NDN P +   P    + E    +  + ++KA D  D + +NS++ + ID+         NS           +   + E +LK  A  +        +   L NT  L I I+D NDNAP     + +  +++     ++ +I  +  D     N E+     DT    L               K G++ +         S D E V  Y++ I   D GSP LTS Q F+V+V+D NDN P FT+ ++   + EN    + +  V+A D+DS  NA++ YS+   +    FSI+ + G+I T    DRE+K  Y  TV A+    P R S+ S+ + V+D+ND  P F        + E+     ++     +   D D   N  V Y I +      N D   T          G+LS    +DRE +++  + V A+D   P  +    +T+ + D ND+ PVF     +S     IS     G  +  L A DKD   NG++V+ L
Sbjct: 1124 YSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAG----PKAFSLNQVTGVLTLVSPLDREVTHRH----ILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVN--GNTD-------GTFKINETTGV--------ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHD--DDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQ-----AFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDL-------------KTGVLKLI-------GSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYT----LTVQDLDYGNNTKVLYSIMS-----GNTDGAFTIG-----RSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSS----TISELTPPGTSILNLTASDKDSGSNGNIVYTL 1789          

HSP 4 Score: 132.109 bits (331), Expect = 8.015e-31
Identity = 161/643 (25.04%), Postives = 272/643 (42.30%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQ--NTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQ-LTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHG---KPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV 2463
            L   ++D+ND  P F        +LE  P    I   VA+D+DS + G  SY  ++   ++          F                  +  K+DRE  E+Y+  ++A+D  T  +    ++ + + D+NDN+P +    Y   VKE    +  + ++ A D+D+ +N +    F    A+    ++  +I              L   A+   V  +   DGG     + T +T+ ++D ND +P  S    S  + E+      L  L   D+D +         +D TY+ +    + SL+        G++ +           DRE    + + ++  DKG  Q L +     + VLD NDN P+F        + E     S + +V A D D  +N K++Y +   GN    F IN   GVI T    D E  + Y   V A+D G+   ++S   + + V D ND +P F K      +  Y N+ ++ N+  I+A+D+D   N  +WY I + SP  +         FK+  ++ G +     IDREE S   + V A D     +  L N+ T+ + + DLND+ P F    S + ++V     F   + +  + A D D    G+V + +V
Sbjct:  898 LELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIF------------------IKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQ---------VLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPN------SDITYMIVAGPKAFSLNQVT-----GVLTLV-------SPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVN-GNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWI--YENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH---------FKIN-SETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV---SRNLTYVMEDEPFN--FQVTSITALDPDTGQGGNVEYRIV 1477          

HSP 5 Score: 130.568 bits (327), Expect = 2.621e-30
Identity = 162/647 (25.04%), Postives = 271/647 (41.89%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEI---ELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIEN---YFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQN-NINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG---LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNER----PKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGN 2469
            ++D+ND  P             + E+  IG  +     SD DS K G  +  +E    YF              KF  + D  +      + V + +DRET + +    V +D     +    +  +N+ D+ND +P++    Y+  V E  T   + ++   +A DQ+   NS+L + I  A    SR       I  ++ ++         ++  VV   +V   G   L +   + +++ D NDN P  + +S +A + EN  +   +  L  +D D+  N                 ++  S+ T N      P++G+V         +++ D E    Y+  +   D G     ++   S+   D NDN P+F  S Y  E  EN+     I  + A D+DS + A  ++ +++ GN    FS++  G+I   +  DRE +  Y  TV A D G     + A + + VLD ND  PIF K +Y F I E    ++V   +G + A   D   N  V Y I           ++      V I   G L L   +D E+  ++Y+ V A+D G PPL     VT+ + D+ND+ P F    ++S   V +  +   G+    +   D D  + G V F L+ N
Sbjct:  269 VLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYF------------SMKFDVLNDESI------IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAI--VNAVDQDFGSNSELVYTI--ANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENS----------------LILYSILTPNTPFFLDPRKGLV-------TNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLT--DLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQ-GNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSV---IGHVHAISRDKGTNAEVVYSI-----------SKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF----NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSN 849          

HSP 6 Score: 128.257 bits (321), Expect = 1.172e-29
Identity = 174/753 (23.11%), Postives = 308/753 (40.90%), Query Frame = 1
Query:  394 AKHRFVIISGNV-RLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSF-------IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSP-----QWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTT----YLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKV-QITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            +   + I+SGNV  +  LI      G L+    V+   +   ++   S+++ IS              L+  + D ND  P F+      +I E++ +G  I    ASD D        Y IE +     I           ++++ L+ +  +  L V+K  D+ +  + S + +            + + + D+NDN+P       +G  Y++T +  T   ++  +   DAD   N    +     T + G+     +   ++  ++I +  +L         +    +D G    TT+    I++ D ND AP     +   ++ EN     ++ I+   D+D   N E    + +TT    YLH   +           P  GM+             DRE++    + ++  D+GSP L+ +    V + D NDN P F +S Y   + ENS   S +  + A D D  EN+ I YS+      +F     G++      D E +S Y F V A+D G   RS  A++ V + D ND +P+F    Y    VE + N  +  ++  ++A D D  +  +  + I            E+    +V  +  +G ++L  ++DRE Q    + V A D G     N   V +T+ D+ND  P+F   S A  +F  I    +   ++  + A  +D   N  VV+ +    + + V I   G + L+  +    H    S  + V+A D+
Sbjct:   90 STQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVR-LDYEAKRSYLIVVKAEDKGSSHQLSSSAI------------VRIEVLDVNDNNPVIHVSYTLGGSYQVT-ENATIGTQVARVSVSDADSGKNGEVNV-----TLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAI----------DPSSGMI-------TTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYS---VEYFENTRIGQSICQLKAIDRDSPKFAITRFII------------EQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIF---SKAEYNFT-IQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVD---HEKIPSLYLTVQAKDK 782          

HSP 7 Score: 118.627 bits (296), Expect = 9.592e-27
Identity = 165/689 (23.95%), Postives = 289/689 (41.94%), Query Frame = 1
Query:  328 ENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFE--------LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTA----KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQI--ETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDE--NGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF 2331
            EN PI++ +  +KA    +   ++  + I S + R     ++N  TG +     +DREE+ +      S  V  +  +F  +        L  +I D+ND  P F  + +   ++ED P    +    A D D+ + G   Y+I +             D  KFS   DL+  +    LK+I  +D E   +Y+  + A D        +    + + D+NDN P++    +  TV E   T   +  + A+D D  +N  ++L + I +     K    +    I+  S  +    +     +    +  P +V       ++T + I++ D NDN P       + K+ EN     I T LTV+D D   N +            L  +MS +          G   I +   E +     DRE    Y + +   D   P  T+    ++ + D+NDN P+F +S+Y   I E +   + I +++A DKDS  N  I Y+L ++   +Y   +  G++++  +F+   K  YNF  IA D G+  + +   + +K+ D+N+  P F K  YE +I   + N +    + ++ A D D D+  NG V Y +          D++ +    V  +  G +          Q    + +IA DHG PPL     V + + ++ D  P F
Sbjct: 1341 ENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAH--FKINSETGLIQTTHPIDREEISE-----YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVS------------PDTGKFS--LDLKTGV----LKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSN--AELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRV-------SSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYT-LTVQDLDYGNNTKV-----------LYSIMSGNTD--------GAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHI---FPNTSASALVTMVTATDADTDKSTNGKVTYRLD---------DSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRF 1962          

HSP 8 Score: 113.62 bits (283), Expect = 3.285e-25
Identity = 174/713 (24.40%), Postives = 296/713 (41.51%), Query Frame = 1
Query:  466 GSLHLISSVDREELCQQKDNDCSHIVIISFG----SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG---LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQL-TSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD-EIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNG--EPSR-SSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFE-TGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRIT 2553
            G + + S +DRE++ +        ++ I  G    S   ++  ++ D+ND  P F +      + E+ P+   +    ASD D    G  +Y              RF+       +     KI   Q+     +DRE +  Y F++VA D  +  +     + + ++D+ND SP++    Y +TV E       + +L A D DDQ   NS + + I       S      +    +        L      + ++ +   D GG   L+  T + I++ D NDN P+    +    + E      ++  +   D D   N +          +  K V   +  T       G++          ++ D E  + Y + +   D G  Q  TS Q  ++ V D NDN P F K+     I EN   ++ + ++ A D DS  N++I Y++D +    +F IN   G+I T    DRE+ S Y+  V A+D    E  R  +TA++ + + D ND  P F  +   N+     +   +  +  I A D D  + G V Y I +       PD   T +F + + K G L L G +D E+     + + A D G PPL++     V + D+ND+ P FT        F+   SE + TG  + K+ A D+D   N  + + +     +   +I+K   +I+  SI  R  + T
Sbjct:  966 GKIFIKSKLDREDIEEYN----LKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTY--------------RFDTQVAQFIVDKQTGKITTSQV-----LDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATD-DDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVS-------PLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGK----------VRYKIVNGNTDGTFKINETTGVISTL-------RALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR---NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVS-------PD---TGKFSLDL-KTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFT-----RDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDT 1611          

HSP 9 Score: 105.916 bits (263), Expect = 6.735e-23
Identity = 137/574 (23.87%), Postives = 236/574 (41.11%), Query Frame = 1
Query:  856 IDRETREKYSFTLVALDTEGK---RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTS-REIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSL-STKNERPKRGMVII------YQIETNENKSFDREKVD------FYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQ-ENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-----QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK 2499
            +D E+ + +   LVA   +G     G++ + +N+ D NDNSP +        + E T + +  F +K    D  +  N K+ + I T   GN   +  I   +           +  A   LV+  +  D G    +T+  + + + D NDN PL    S    I+E+ RT  ++T +   D D E    ++     T  + +  V +    S  N + K    I       Y+I+ +      R  +D      F  + +  +D+G P   +     +I+  E    P F    Y  ++ EN++  + + +V   D  +     +I Y+++   + YF I    GVI   +  D E K  +   V A D+  PS+     + + V D ND KP+F +     Q+   I    G + V+     + A D+D   NG VW+ I +          +    F +   K G +     +D E   T ++ V A D G PP+   ++VT+ + DLND+ PVF  P       V +         L +++A D+D   N  + F ++G        I+K
Sbjct: 2025 LDYESTKNFRLHLVAT-PQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWT---GNEAGVFTIDSTTGEITTAKLLDRETTASFDLVI--RGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSE-VNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIEN--SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGI--PVGTIVVN-----VSAADKDSGANGRVWFAIQS---------GDDKGSFAID-RKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND---VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDK 2565          

HSP 10 Score: 100.523 bits (249), Expect = 3.251e-21
Identity = 182/759 (23.98%), Postives = 302/759 (39.79%), Query Frame = 1
Query:  322 LKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDRE------------ELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD---TEGKRGHVNIVLNI--KDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKI---DTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM------KLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVE-SYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAE-----KTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFT--------FPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            + E  PI S +  + A         K R+ I++GN       ++N  TG +  + ++D E            ++ +++      +V           T  + D ND  PTF K  I   I E+VPI   +    A D DS       Y I+         ++     FK +S    E  +IQ        IDRE   +YS  + A D   TE  R +    L I  +D+NDN+P+++       +++   + ++ S+ A D D     N  ++++I   DT K     K                G LK +  +      +  + +   D G   L +     + + D NDN P  +       + ENK T   +  +T  D D   N E +  +     +    +   S          G+++        N   DREK D Y + +       P   SS    + V+D NDN P F   +   ++ ENS  +  I +++  D D   N K+ YS+   GN    F+I    G + T  K DRE K+ Y  +V A D   P  ++ A+I + + DQND  P+F++  Y   I E +    ++ N    + A+D+D   NG + Y +   +  V + D+         RF+  I             ++E +      IA+D G+ P    + V + + D N+H P FT        FP++++ + V          ++   DA D D + NG V + L
Sbjct: 1233 VPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD--GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLV-----------TIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTID---------SQSPRAHFKINS----ETGLIQ----TTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGN--VEYRIVSPDTGKFSLDLKT---------------GVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHS----------GLIV-------TNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENS-PARLIYTLTVQDLDYGNNTKVLYSIMS-GNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILN----LTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSI-------------KQEYNFF---CIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVT---------MVTATDA-DTDKSTNGKVTYRL 1895          

HSP 11 Score: 98.2117 bits (243), Expect = 1.883e-20
Identity = 176/737 (23.88%), Postives = 288/737 (39.08%), Query Frame = 1
Query:  307 LFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG-SFIFELTFL-----IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGK--RGHVNIVLNIKDINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNNINSKLDFKIDTAKLG--NSRKXXXXXXXXXXXXXXXE------GALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLE--MNCEFSCHLNDT---TYLHLKEVMSRSLSTKN--ERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIF-TKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVI--FTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEF-NIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            LF   + ENKP  + ++ + A    +   A+  + I SG V +     ++  +G +   S +DRE+       D   + + + G S+ F ++       ++D ND  P F    + L + E+ P   +  L V  DLD   YG       N      IM+   +  F               +L    K+DRET+  Y  ++ A D          NI + I+D NDN P +    Y  T+ E T     I +L A D D  +N N       DT  +   +SR             I  E         +G      +VP++              I I+D N++AP  + T     I  N     ++T++T  D D +   N + +  L+D+   T L + E  + S+ T      P +G   +Y                     II  D GSP L       +++ +  D+ P F  ++     I ENS   S I +V A    +  +A++ YS+     G  ++     GVI   + +  D E    +   ++A+  G  S +    + + V+D+ND  P F        + E  G       +  + A D D   NG V Y I             +   F +  T  G+++   ++DRE  ++  + +   D G PP S +  V V + DLND+ P+F  P S     VNI  +  TG ++  + A D D
Sbjct: 1545 LFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSG-VEMDKF-SIDKHSGLIVTNSILDREK------KDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTV-QDLD---YG------NNTKVLYSIMSGNTDGAFTIGRSTG--------ELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVR--------------IKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALY---------------------IIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRA---RASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVK-VTATDVDSGTNGKVTYSIWT---------GNEAGVFTIDST-TGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD-PLSE----VNIREDTRTGAVVTSVVATDTD 2201          

HSP 12 Score: 97.8265 bits (242), Expect = 2.210e-20
Identity = 177/775 (22.84%), Postives = 314/775 (40.52%), Query Frame = 1
Query:  313 EIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVI-----ISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPI--GHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTT----------------SREIFSLK-------------AFDADDQNNINSK----------LDFKIDTAKLG--NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNC---EFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL---DEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENG-LVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY---IDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVF 2454
             + + EN  + S +  ++A+   A  +A+  + IISGN + R      F TG +  ++S D  +    K N   H+V      +S   ++  L   +ID ND  P F    +   + ED        +    A+D+DS   G  +Y I          T      F   S           ++   K +DRET   +   +   D+    K  +  + + + D+NDN P +  L  ++ ++E T                 SR  ++LK             A D D  +N   K          +D+KID A  G  ++R+   +    S   I ++   +G+   + +V ++++          +T          P   + S   K+ EN   +   ++LTV+  D          S ++ ++ Y  + +             + G++ +       NK  D E    + +++  ID  +P         + V D ND  P+F +S Y  +  E     + + +VSA DKDS  N ++ +++   D+ G+  F+I+   GVI T+   D E    ++ +V A+D G P   +  S+ ++VLD ND  P+FR     N V+   N+ +++ L  I A D D   N  L +  IG T   +   D     +F   +T N            E + +Y   + + A D G PPLS++IT+ V + D +++ P F   +     F ++    + G  + ++ A D+D    G V F
Sbjct: 1969 RVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGN-KGRAFYVDPF-TGVIS-VASADALDYESTK-NFRLHLVATPQGWVSLNGYMI-LDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI---------WTGNEAGVFTIDSTTG--------EITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLS-EVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKID-ADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRII----------IT--------REPKFELPSYFGKVPENA--MMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQ-------------RSGVISV-------NKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS--FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGP-NDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLID-----KFSGWLTTNITFDY-------ENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKF-DVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 13 Score: 54.6842 bits (130), Expect = 2.939e-7
Identity = 62/220 (28.18%), Postives = 94/220 (42.73%), Query Frame = 1
Query: 1828 GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYG---------VIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            GVI TK   DRE+ S YN T++  +   P +S T  +LV V D ND  P F +     +V    +      L    A D D   N    Y I   S  V N        FK+   ++    LY           +DRE   +  +++ A D G P     + +++T+ D ND+KP F+   S SG+   I    + G  + ++ A DKD   N  + + +
Sbjct:   12 GVITTKTVLDREKVSAYNLTIV--EFSTPPKSYT--VLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL---IAVDSDFGSNSTQSYTI--VSGNVGN-------VFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFS-NVSYSGT---IPENIDVGTSILQVSASDKDIGTNAEIQYSI 211          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 157.147 bits (396), Expect = 1.459e-38
Identity = 188/742 (25.34%), Postives = 317/742 (42.72%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG----SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRK-XXXXXXXXXXXXXXXEGALKGMAEM---KLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDE-DLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFE---TGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            +S  F + + EN    + +I + A  P A   AK  +    G+    N   ++  +G ++   + DRE     KD+   ++     G    S    +   + D ND  P F        I ED  +G  I    ASD D  +    +Y I +  K+T                    M  +  ++ V +++DRE    YS  + A D  T      + I + + D ND+ P ++     + + E  +   EI +L+A D D  + +N+++ +   T    NS    S    + +   +  E   +   E+    L VP K        + T++T+ ++D NDN P+ +++  +A++ E      I+T++    ED ++  + S      TY  + +     L   NE    G + I           DRE    Y++ +   D GSP L+S     V VLD+ND++P+FT +    ++ E++   + +  VSA D D   NA + YS          I +   I  K        ++YN TV A +   P   + A+I ++VLD ND  P+F K  Y    V+  G+     ++G +EA D+ D   N LV YE  A S          T RF+V   + G++ +   +  +   T YI V A D G+P +S++  V V + + N H PVF+         V  +SE E    G  L  + A D+D+  NG + ++++   S
Sbjct:   16 TSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGS--HGNKFAIDASSGRIYTTGTFDRE----TKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKAT------------------FSMNPVTGEITVGQRLDREG-ANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGD--SGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRK-------DSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVTVVA---EDRDIGSDGS-----VTYC-ITQGREGGLFVINE--NTGTIGI-------TAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTG-------MITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGV---SIGRVEAVDKFDYGPNALVRYE--AIS-------GNGTGRFRVA-PETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFS-------KAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNS 678          

HSP 2 Score: 138.272 bits (347), Expect = 7.615e-33
Identity = 104/291 (35.74%), Postives = 149/291 (51.20%), Query Frame = 1
Query: 1630 SVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTI 2493
            ++ V D NDN+P+FT   +   I EN    + + +V+A D D+ +NAK+ Y+      GN +      G I+T   FDRE K  Y+  V ASD+G PS+SST  +LV V D ND  P F    Y F+I E   + AV  ++G + A+D D+ EN  + Y I   SP       EK       +T  G++++   +DR E +   I V A D G PPLS S+ +TV ++D NDH+PVF    S  G+ V I      G  +  L A D D  +N  + +  V   S +  TI
Sbjct:    2 TITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHGNKFAIDASSGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAE---DAAVGASIGTVSASDADIGENARLTYSI--VSP-------EKATFSMNPVT--GEITVGQRLDR-EGANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFL---SHIGT-VFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTI 273          

HSP 3 Score: 137.502 bits (345), Expect = 1.452e-32
Identity = 167/688 (24.27%), Postives = 290/688 (42.15%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFG----SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH--VNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDK-DSQENAKIKY---SLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFT 2334
            +  ++ E+  + + +  + A      + A+  + I+S     +    +N VTG + +   +DRE       N    +     G    S   E+T ++ D ND  P F      + I E+   G  I    A D DS       Y           +T    + F  +SI          +L+  + +DRET  +++  ++A D    R     N+ + ++D+NDN P +    Y   V E      I ++ A D D    I S  D  + T  +   R+    +   +   I I   L    + K  + ++  DGG   L +  D+ +++ D ND+AP+ +  + + K++E+  +   +  ++  D D+  N        D TY      ++R+++ K           +    N N          Y++ +   +   P   +     + VLD ND++P+F KS+Y    ++++     IG V A DK D   NA ++Y   S +  G    +     V+      D   K+ Y   V ASD G+P  S TA + V+V ++N   P+F K  Y+ +  E   ++AV + L  + A D D   NG + Y+I A             + F + +T NG L +   +D E Q    ++V A D GK P ++  TV +TL D+ND+ PVF+
Sbjct:  125 YVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPE---KATFSMNPVTGEITVGQRLDREGA-----NYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAF---------VTGNSNNSFTINSITG--------RLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVTVVAEDRD----IGS--DGSV-TYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNA-------DVTYSTGMITLNRAIAFKP----------FSALPNPN---------IYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYY-IRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENE---DIAVGSALLTVTATDRDFGRNGEISYDIIA---------GNSQEYFGIGLT-NGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFS 740          

HSP 4 Score: 135.961 bits (341), Expect = 4.054e-32
Identity = 133/513 (25.93%), Postives = 225/513 (43.86%), Query Frame = 1
Query:  934 IVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS-LDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVF 2454
            + + ++D+NDN+P +    + +++ E       + ++ A D D  +N       K+  A  G S      +  SS  +    G      +    + +   D G     +T  + +++ D NDN+P          I E+      +  ++  D D+  N          TY     ++S   +T +  P  G + + Q         DRE  + YS+ +   D G+P L++S + +VIV D ND+ P+F   I    I EN+   +EI ++ A D DS  NA+I+Y+ +    N  F+IN + G + T    DRE    +   V+A D G P + S  ++ V + D ND +P+F   +Y   + E      V +N+  + A D D+  +G V Y I             +   F +     G + +   +DRE +S   + V A D G P LS+   V V + D NDH PVFT P++ +   V +  +  +G  + K+ A D D   N  V +
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNA------KVSYATYGGSHGNKFAIDASSGRIYTT-GTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARL-------TY----SIVSPEKATFSMNPVTGEITVGQ-------RLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEG----VVESNIVTVVAEDRDIGSDGSVTYCI---------TQGREGGLFVIN-ENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFT-PATLT---VKVQEDTGSGTTVIKVSAVDGDVGSNADVTY 469          

HSP 5 Score: 135.961 bits (341), Expect = 4.527e-32
Identity = 133/462 (28.79%), Postives = 204/462 (44.16%), Query Frame = 1
Query: 1261 LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYL---LAKLDAEDKDYALNGSVVFELV-GNESLSPVTIEKDGRVILKESIKSRSHRITQSDRIL-VRASDQCENCHQSEVGSLI 2628
            +TI+++D NDNAP+ +    +  I EN      +  +T  D D   N + S       Y           +      +     IY   T     FDRE  D YS+ +   D G+P  +S+    V V D NDNSP F    Y F+I E++   + IG+VSA D D  ENA++ YS+       FS+N + G I   ++ DRE  + Y+  V A+D G P  S++  I V V D ND +P+F        ++   N +    +  ++A D D   N  + Y       +V          F +  +  G+L     +DRE      ++V+A D G P   +   VTV L D+ND++PVFT    A        +E   G +   +  + AED+D   +GSV + +  G E    V  E  G +     I ++  R T+S   L V+A+D       SE   ++
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVS-------YATYGGSHGNKFAIDASSGR-----IYTTGT-----FDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDE--NASPGTEIITLQAVDGDSGVNAEIRYA------FVT---GNSNNSFTIN-SITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYA--------AEVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTI----GITAKLDRETKSKYTLRVQATDGGSPALSSEADVIV 420          

HSP 6 Score: 90.8929 bits (224), Expect = 2.485e-18
Identity = 137/601 (22.80%), Postives = 237/601 (39.43%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIF--SLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVV-------DGGGLQNTTD----LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHL----NDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY--SLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKP 2325
            + + N   P F+K   + S  ED+ +G  +    A+D D  + G  SY         DI+    ++ F         + +    L V K +D E +E YS  + A D   E K  +  + + ++D+NDN+P +  + Y+  + E TT R +   S++A D D++   + +         LG S K   ++   +       G ++   E    V +          +G   Q T D    + I I   N+  P+   +  +A + EN      +  ++  D+D   +     HL    N   +       + S+S   +  + G+V +  I  N                 +  +  +P   +     V V D ND  P F KS+Y   + E S     + +V+A D DS   + I+Y  S    GN +    + G + T  + DRE  + Y  TV A+DNG P  +  A+++V + D ND  P          V    N      +  + A D DL+ N           P+  +        F++ ++ +G +S    +DRE+Q    I +   D     LS      + + D ND++P
Sbjct:  624 VTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISY---------DIIAGNSQEYFG--------IGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSI------LGGSGKDKFVIDERT-------GEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKN-----------------LFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRS-IRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTE--NKPQGTQVMTLNAEDPDLNPN---------RGPFKYSISGSDYGSFRLNVS-SGVVSTVKSLDREKQDAYNISIKVTDARG--LSAVNFCMIHVEDQNDNRP 1161          

HSP 7 Score: 81.2629 bits (199), Expect = 2.379e-15
Identity = 106/418 (25.36%), Postives = 174/418 (41.63%), Query Frame = 1
Query: 1219 LKVVDGGGLQNTTDLT--ISIKDCNDNAPLISITSRSAKIKENK--RTLEILTI-LTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKG-SPQLTSSQQFSVIVLDENDNS--PIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL---DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIA----SDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKD 2427
            +   DGG    T+  T  I+++D NDN P+ S      ++ EN   R++ + ++  T +DE  + +  +S             ++  S   K    +R   I   +E      FD E      ++I   D+G SPQ T+    SV +L    N   P+F +S++   + EN+     +  VSA DKD   +  + Y L   D         N  G +      D E+  +    VIA     ++  PS  + A+I+V V D ND     +  Y  ++ E      V  N+  ++ +D D+     + Y I           A  T    V     G +     +DRE  +   + V A D+G PP++ + T+ VTL+D+ND+ P  T P    G    ++     G  +  L+AED D
Sbjct:  709 VSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYS-------------ILGGSGKDKFVIDERTGEIRATVE------FDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNT-GTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSAHVTEGSRIGHVVTNVTAVD-DDSDIRS---IRYGI----------SAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLT-PLPCIG---RVTENKPQGTQVMTLNAEDPD 1088          

HSP 8 Score: 56.6102 bits (135), Expect = 7.531e-8
Identity = 69/290 (23.79%), Postives = 111/290 (38.28%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVA----SDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKEC-TTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHL 1422
            +   + D ND  P F K      + E   IGHV+    A    SD+ S +YGI++    N F                       M  +   ++   ++DRE   +Y  T+ A D  T    G+  +V+ + DINDN P    LP    V E      ++ +L A D D   N      + I  +  G+ R       +S+   +  E       +    + +KV D  GL       I ++D NDN P    TSR   +   +       +  V+ +D +++   +C L
Sbjct:  943 IVVTVTDANDP-PRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSIRYGISAGNTGNAFV----------------------MDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPN-RGPFKYSISGSDYGSFRLNVSSGVVSTVKSLDRE------KQDAYNISIKVTDARGLSAVNFCMIHVEDQNDNRP--KATSRDVYVHTFEGKFLGGVVADVRPDDPDIDDLMTCAL 1200          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 156.762 bits (395), Expect = 1.705e-38
Identity = 178/684 (26.02%), Postives = 298/684 (43.57%), Query Frame = 1
Query:  592 DMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKK--IDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKID-TAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDL---TISIKDCNDNAPLISIT------SRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL---DEIGNIYFSINMY-GVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            D+ND  P F      L I E + +     +  A+D D+   G   Y I +   +T   +     C   S+            L VI K  +DRET + Y   + A D  T    G+  I + I D ND++P +    Y  ++ E  T   +  L+   AD  +  N  + + ID  A   NS                ++  +K      +     +   GG+ +  DL   TI++ D NDN+P + IT         A   EN      +  + V D+D   N +    + +       +V                +  Y I+    K  DRE V FY++ +   DKG P  ++     + V D NDNSP FT + Y   I E +   S +  ++A D D  +N  + YS+   +++G  +F ++   G++ T +  DREQ S    T+ A D+G   ++ + ++ V ++D ND KP F K  Y+  I E     ++   +  + A D D  +NG + YEI ++       DA+    F++  T+ G L     +DRE +S     V+A+DHG P L +S+ V +T++D+ND+ PVF +P      F +I      G LL ++ A D D   N  + ++++G  +    +I+    VI   ++ S  H + +   +++ A D
Sbjct:   87 DINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIAS-GDNTATFSLGTTACPTGST------------LCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAE-NTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNV-----IASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVE--------------FLGFYFIQL--QKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEG---ASIGATVLQVSATDVDSGDNGRITYEISSS-------DAQVNGLFELN-TQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEY---FASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVI--STLASLDHEVEEFFSLIISAKD 715          

HSP 2 Score: 146.362 bits (368), Expect = 2.748e-35
Identity = 175/673 (26.00%), Postives = 275/673 (40.86%), Query Frame = 1
Query:  586 IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQW--IGLPYKITVKECTTSREIFSLK---AFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALK----GMAEMKLVVP------------LKVVDGGGLQNTTD--LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKY---SLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVI 2514
            I+D ND  P F +     SI E+   G  I    A+D DS   G   Y I+              D  + +SI DL+       ++  + +D E +  Y+F ++A D     K     + +N+ D NDNSPQ     LP     K   +   + +         D  +N NS+ + KI                         EG  K    G   ++L  P            L V D G    +T   + I + D NDN+P  +  + +A I E  +    +  L   D D   N   S  +     L   +V  +S          G+V          K  DRE+V   ++ I   D GS   T S   +V ++D NDN P F KS Y+  I E +   + +  VSA D DS +N +I Y   S D   N  F +N   GV++TK + DRE KSLY+FTV+A D+G+P   S+  + + + D ND  P+F   +Y  +I+E+         L  + A D D   N ++ Y+I                 F +  +  G +S    +D E +    + + A+D G    + +  V VT+ +  D+ PVF +       + N+      G L+ ++ A  KD   NGS+ + +V  +  +   ++  G +I
Sbjct:  196 ILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAID-------------WDAIQSNSIFDLDSS--TGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGD--------------------DEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQS----------GLVTTA-------KPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN----EPPGKLLQVTATDADEGTNAVISYDIIG---------GNNNGNFSID-SSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPK----GTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGII 796          

HSP 3 Score: 141.354 bits (355), Expect = 8.737e-34
Identity = 131/450 (29.11%), Postives = 199/450 (44.22%), Query Frame = 1
Query: 1267 ISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLD----EIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEAN-------DEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE-KDGRVIL-----KESIKSRSHRITQSDR 2565
            + + D NDN P       + +I+E+        I T  D D   N        D T        + SL T        + +I +      K  DRE  DFY + I   D+G+P L      ++ +LDEND++P+FT++ Y   I EN+     I  VSA D+DS  N  IKY++D    +  +I+   +  GVI TK+  D E K+ Y F VIASD G PS++  A++ + VLD ND  P  +  Y   +    G+ A+ +   LI  N       D+D + N     +I        N D E    FKV+      + L   +DRE      + +   D G P  S    V + + D+ND+ P FT    ++    NIS   + G  + +L+A D D   NG+V + + G   L    ++ + G V       +E + S +  IT  D 
Sbjct:   83 VQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTV-----DYTIASGDNTATFSLGTTACPTGSTLCVITK------KPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITY---LPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI-------TNGDDEGC--FKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFT----SNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDH 505          

HSP 4 Score: 119.783 bits (299), Expect = 3.735e-27
Identity = 163/688 (23.69%), Postives = 290/688 (42.15%), Query Frame = 1
Query:  574 LTFLIIDM---NDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVV--DGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNEN-----KSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            L F++ID+   ND  P F       +I E    G  +    A+D D    G  SY I               D   F    D +  ++       K +DRE     + T+ A D  +  K G   + + I D NDN P+++   YK T+ E  +    +  + A D D  +N   ++ ++I ++   +++        +   ++  +  L    E K +    V+  D G   L ++  + ++I D NDNAP+       A I EN+   ++L + T  D D   N                 V+S  +   N          + I+++        S D E  +F+S++I   D G+     +   +V VL++ DN P+F   +Y F + EN    + +G V A  KD  +N  I Y++   +  N++   +  G+I      DRE+K+ Y   VIA        S+ A++ ++VLD+ND  P F       IV+  G   V   +    A D D  +NGLV Y++ +        +AE         + +G + L   +   +++   + V+A D G PP  +++T+ +TL+   +H P FT  S  +    +    ++  Y++A     D+D   NG + + +          I   G++ +++S+      +  S  ++VRA+D
Sbjct:  408 LGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITG-----------GNDLGWFQ--VDFQSGLV----TTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDN--GRITYEISSS---DAQVNGLFELNTQTGVLWTKSQLD--RETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNA----------------VISYDIIGGNNNGN------FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSV--IVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS--------NAEGLLWIN---STSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI--NHPPKFTLSSYVTHVLASQPLSYQFFYVVAV----DQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLL---QALKGSYDLIVRATD 1024          

HSP 5 Score: 119.398 bits (298), Expect = 5.564e-27
Identity = 178/746 (23.86%), Postives = 299/746 (40.08%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCS--HIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKR--GHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNI---------NSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEM--------KLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKEN--KRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSF-VNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNES 2475
            EL +N    S ++ L A  P         + I  GN       Q++F +G +     +DRE++        +  H      GS    +T  IID ND  P F K   + +I E   IG  +    A+D+DS   G  +Y+I     S+D                  E+      L    ++DRET+  YSFT++A D    +    V + L I DINDN+P +  + Y  ++ E     ++  + A DAD+  N          N+  +F ID++                       G +  +A +         L++  K  DGG      T  + +++ +  DN P+      +  + EN  K TL      T KD++  ++  ++    D T L L +               G++ I       N   DRE+   Y + +I        L++    ++ VLD NDN+P F+ S    +I    +    + + +A D D+ +N  ++Y L         IN   GVI    K     ++ Y   V+ASD+G P + ST +I +  L  N         Y  +++ S     +      + A D+D  +NG ++Y I         P   +   F   I   GKL +   + +  + +  + V A D G P  S S+ VT+ + D NDH+ +F      + +F   ++     G L+  L A   D++    +V+ L+ +ES
Sbjct:  436 ELAQNG---SYVLQLNATDPDEGDNGTVSYSITGGNDL--GWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVT--IIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEI----SSSDAQVNGL-----------FELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSST----------------------GVISTLASLDHEVEEFFSLIISAK--DGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSIS--YAIVSGDPTNLFLVDSTG------------GIIKI-------NGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHI-TLSINHPPKFTLSSYVTHVLAS---QPLSYQFFYVVAVDQDSGKNGQLFYSI---------PQGNEEGLFG--IFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLF-----VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES 1094          

HSP 6 Score: 117.087 bits (292), Expect = 2.603e-26
Identity = 109/408 (26.72%), Postives = 186/408 (45.59%), Query Frame = 1
Query: 1267 ISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI--YFSI-NMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREE----QSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVF-TFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELV 2463
            +++ D NDNAP+ S    +  + E       +  +   D D   N +F   L   T +  K  ++ S                  E + +K+ DRE    Y++++   D  +  L S+ +  + V D ND  P+F +S Y   I E+++  S + +++A DKD  +N  IKYS+   GN+   F + +  G +   +  D E   LY  T+ A D+G    SST ++ V VLD ND  P+F  Q     + E   N+     +G   A+D D   N  + + + + +P         +K F V  +   +++    ID E     + +  + V+A D G P LS   ++TV + D ND+ P F + P++A+GS +N+ +          + AED D   NG V + ++
Sbjct: 1147 VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD-KFFINSSTG----------------ELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN-GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRE---NVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP---------SKTFSVN-SATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNVMT----------ITAEDPDRNSNGKVTYSII 1513          

HSP 7 Score: 107.842 bits (268), Expect = 1.535e-23
Identity = 126/525 (24.00%), Postives = 208/525 (39.62%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVAL--------DTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECT-TSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL-DEIGNIYFSINMYGV-IFTKEKFDREQ----KSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI 2103
            +T  I D ND    F       ++ E+   G ++   VA  LD  +     Y +                    SS     + +   Q+    ++DRE   K + + V +        DT  KR    +++ + D+NDN+P +    Y ITV E +     +F +KA DAD+ +  N+K  + + +   G       I   +    +      +  +   LVV         L +T  + I++ D ND  P+   +  +  I E+     ++  L   D+D+  N      +++     + +V S +          G +I+        KS D E    Y + I   D G   L+S+   +V VLD NDN+P+F        + EN      +G  +A D+D+  NA I +S+  +  +  FS+N     I T    D E     +  +   V+A+D G P  S+  SI V+V D+ND  P F       +           N+  I A D D + NG V Y I
Sbjct: 1036 VTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL-------------------ISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD--NAKFFYSLVS---GTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESAT----------GRLIVA-------KSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF-------VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSI 1512          

HSP 8 Score: 102.449 bits (254), Expect = 7.055e-22
Identity = 145/570 (25.44%), Postives = 237/570 (41.58%), Query Frame = 1
Query:  298 SSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQ----KDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEG---KRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXX-XXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAP-LISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMV-IIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL--DEIGNIYFSINMYGVIFTKEKFDRE-QKSLYNFTVIASDNGEPS-RSSTASILVKVLDQN 1962
            S +++ I + E     S +  +KA        AK  + ++SG    +  I  N  TG LHL  ++DRE         K  D S+  + S      ++   + D ND+ P F + +  ++I ED  IG ++    ASD D  + G+  Y I N                  +++ D+E      +L V K +D ET + Y  T+ A D  G       VN+ +N+ D+NDN+P +   P  +TV+E   T   +    A D D     N+ + F + +     +  ++     I++   I +E    G    +LVV         L     +T+ + D NDN+P  +S  + +A       +L ++TI T +D D   N +        TY     ++S +    N  P  G + +I+QI  N            Y + I   D G P   +    SV         P F+ + Y+  + EN V  + + +V A    S  N  I+Y L  D     +  +   GV+ T    DRE   + +N  V A D   PS R+S+A++ + V D N
Sbjct: 1160 SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFI--NSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTA----KIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN---------------GNLAAMFDVESA--TGRLIVAKSLDFETTQLYELTITAQD-HGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRD--TGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAA-----GSSLNVMTI-TAEDPDRNSNGKV-------TY----SIISGNNGYFNLHPSTGQLQMIHQIPDNPT---------IYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 9 Score: 91.6633 bits (226), Expect = 1.421e-18
Identity = 88/339 (25.96%), Postives = 151/339 (44.54%), Query Frame = 1
Query: 1567 YSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMY-GVIFTKEKFDREQ--------------KSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVE-SYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIE-KDGRVILKESI 2529
            Y +++   D G P  ++S   ++ + D ND+  +F  + + F + ENS   + +G++ A   D      I YSL      +F++++  G I T+ + DRE+              +++YN T I  D         A ++V V D ND  P+F R  Y   + E S     V      I+A D D  +N   +Y + +              +F +  +  G+L L   +DRE  S+  + V A D     L ++  + +T+ D ND +PVF      S   VNI+ +   G L+  L+A DKD   NG + + +      +   +E   GR+I+ +S+
Sbjct: 1016 YDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS-SESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDK--------AIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFR----IKAMDADEGDNAKFFYSLVS---------GTGMDKFFIN-SSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVF----PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSL 1327          

HSP 10 Score: 88.1965 bits (217), Expect = 1.505e-17
Identity = 139/635 (21.89%), Postives = 250/635 (39.37%), Query Frame = 1
Query:  490 VDREELCQQKDNDCSHIVIISFGSFIFELTF---------LIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH--VNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDAD-DQN----------NINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSS-EIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY-IDVIARD-HGKPPLSNSITVTVTLNDLN 2313
            +DREEL +   N  S++ I+   +   + T           + D+ND  P F++    +++ E       + LP          G   ++I+          + F      + +    +     +L + K +DRET   Y+  + A D      +    I + + D ND  P +    Y + + E       + +L A D D  QN          N+ +  D +  T +L  ++ L                 L   A+   ++PL         +T ++T+++ D NDNAPL      +  ++EN  T   +   T  D D   N   +  +         +  S++ S  +   +   +    +ET           D + ++++  D+GSP+L++ +  +V V DENDNSP F            + GSS  + +++A D D   N K+ YS+    N YF+++             +  ++Y  T+ ASD G+PSR +   + V         P F    Y+ ++ E   N     ++  + A       NG + Y + +        D+ K   F+V +   G +     IDRE     + + V A D  G    ++S TVT+T+ D+N
Sbjct: 1111 LDREELIK---NTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE-------LSLP----------GSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYE--------LTITAQDHGLIPLS--------STVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM-------YSQTPSKTFSVNSATCEITTIAAIDLETMPAGR------DSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSP------PAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTE---NKVAGTSVVTVLAAYPQSSLNGNIEYYLTS--------DSSK-GGFEV-VKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 153.295 bits (386), Expect = 6.505e-38
Identity = 157/600 (26.17%), Postives = 253/600 (42.17%), Query Frame = 1
Query:  565 IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTE--GKRGHVNIVLNIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVL-----IICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI--GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPV 2328
            + E+   ++D ND  P F    I+ +I E   IG  +    A+D DS   G   + I +                   S    E+      ++V   +DRE +  Y   + A+D     + G+  + + ++D+NDN+P++    + + V E       I +  A D D  +N           A +  S         S+   + I   L    +      +   DGGGL++   + + I D NDN+P          + +      I+  +  +D D+  N   +  +     L L  ++          P  G +       N +   DRE+   Y+++     +   D G  Q TS    ++ V D NDN P F +S Y   ++EN    +++  V+A D+DS  N++I YSL   G+  FSI    G I  ++  +RE K  Y+ T+ ASD G P  SS A + V VLD ND  P+F  + YE  + E  GN A    +  + A D D++ NG V Y I  GA   +  N   E T   + Q          GV++RE +    + V+ARD G  P  +  T+ V + D ND+ P+
Sbjct:  317 LAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINS------------------GSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSN-----------AAITYSMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI-----LILPFIIV---------PDTGNI-------NTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTG-GDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSE--GNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTIN---ETTGVIRTQ----------GVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 2 Score: 148.288 bits (373), Expect = 2.965e-36
Identity = 181/781 (23.18%), Postives = 340/781 (43.53%), Query Frame = 1
Query:  328 ENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVR--LRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISF-GSFIFELTFL------IIDMNDEVPTFAKQEIELSILEDVPIGHVIDLP---VASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGH---VNIVLNIKDINDNSPQWIGLPYKITVKECTT-SREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFT-----VIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI-GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSE--FETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            EN P+ + L+++ A    + + A   + + +G+     R + +++   G++ +  ++DRE       ND  ++ I +  G      T +      I+D ND VP F+      SI E+   G  + +    +A+D D +      Y++               D  +F+   +    +I  ++     +D E    Y+F ++A D  G  GH     +V+++ D NDN+P++I    + T+ E  +  + +  + A D D  + +N ++ F I++   G      +     S+ ++ + G+L   A+   V+ +  +DG     +    +T++++D NDN P  +  + +  + E      ++   T  D D   N   +  ++   +     + S + S    RP                  DRE    YS  +   D G   L S+   +V + DENDNSP F    Y+ ++++ +   + + +V+A D+D   N  + Y++  +   +  +   G I T  K DREQ+SLY        +  +D+G    +S A + + V D ND +P F + +Y   ++E   NM V   + ++ A DED   N  + Y + G    +   P               G++ L   I+RE +   ++ + A D G P LS+   V V + D+ND+ PVFT     S  +    SE     G  + +++A D D   NG V + ++ + +L   TI +   VI  + + +R  +   +  ++V A DQ
Sbjct:  125 ENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSN-HGTIEVAGNLDREV------NDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNG------------SDSIQFA--VNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGT-GHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPD--SGLNGRIFFSINSGSEG------KFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGF----AINSNTGSVTITRP-----------------LDRETKQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL--PFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLE---NMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEP-------------STGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFT-----SRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIM-HGALGMFTINETTGVIRTQGVLNRESKDFYT--LIVMARDQ 826          

HSP 3 Score: 122.865 bits (307), Expect = 2.382e-28
Identity = 170/708 (24.01%), Postives = 292/708 (41.24%), Query Frame = 1
Query:  571 ELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVL-NIKDINDNSPQWIGLPYKITVKECTTS----REIFSLKAFDADDQNNINSKLDFK-IDTAKLG-NSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRK-QYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIY------IDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNE---SLSPVTIEKDGRVILKESIKSRSHR-----ITQSDR-ILVRASDQCENCHQSEV 2616
             ++ ++ D+ND  P F       ++ E+ P+G  +    A+D DS +    +Y +     +       F    K S+   +E         V   +DRE  + Y+ T+ A D      R  + I L  I D NDN P++    Y  +++E +      +   S+ A D D ++N + +      D+ +   N R       +S    +  E            V      G G ++  ++ I + D NDN P    +S  + I E     + +  +T  D D  +N      +N  +    +  + RS          G+V +       + S DRE    Y + +  ID            +V + D NDN+P FTK  +  ++ E     S I + +A D D   NA I YS+   G   F+IN   G +      DRE K  Y+FTV A D G     S  ++ V++ D+ND  P F   QY+ ++++      V   +  + A D D+  NG V Y I    P++  PD              G ++    +DRE+QS +Y      +++   DHG    ++   + +++ D ND++P F     ++    N+      G  +  + A D+D  +N  +++ L G +   S+ P T    G++ L+++I   +       IT SDR   V +SD   + H  +V
Sbjct:   99 RVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSV-----TAGDSHGLFRAVTKVSNHGTIE---------VAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTN----YTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFE--IGRS---------DGVVRV-------SGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG---FAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVID---RTPVGTIVLAVNAEDRDVGNNGHVTYAI-LILPFIIVPDT-------------GNINTSSKLDREQQS-LYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENM----PVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPST----GQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDV 739          

HSP 4 Score: 120.553 bits (301), Expect = 1.287e-27
Identity = 118/399 (29.57%), Postives = 178/399 (44.61%), Query Frame = 1
Query: 1297 PLISITSRSAKIKENKRTLEILTILTVK--DEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSL---DEIG--NIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEP-SRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSP--YVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL 2460
            P+ +  S +A   E   T  +L I TVK  D D   N +    + D           RS S     P  GM     I+T  N   +R++   Y++ I   D G P  +++ + S++V D NDN+P+F  + Y   + ENS   + +  V+A D DS +NA + YS+   D  G       ++ +G I      DRE    YN T+ A+D G P SR++ A  LV++LD+ND  P F   +Y  +I E+ G          I A D D++ N  V Y +  +    +  NP      R  V  T   ++S    +D E  +     VIA D       +   V + + D ND+ P F  PSS   +   IS     G  +A++ A D D  LNG + F +
Sbjct:    1 PVFTPASYNATFTEGSSTRGVL-IATVKATDSDDGANGDVDYSIVDGNVGD-----PRSNSDFTLDPNTGM-----IKTARN--LERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNP------RTGVITT---RVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRF-IPSSIQST---ISEAASIGQSVARVTANDPDSGLNGRIFFSI 373          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 209.149 bits (531), Expect = 1.700e-54
Identity = 213/795 (26.79%), Postives = 353/795 (44.40%), Query Frame = 1
Query:  319 ELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLIS-SVDREEL--CQQ--KDNDC---------SHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVL---NIKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAE------MKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI-YFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKD-GRVILKESIKSRSHRITQSDRILVRASDQ 2589
            +L E +P ++ + +L A L     ++ H + +  G+  LR    ++  TG ++     +DRE L  C+   +D+ C           +  I  G  + E    ++D+ND  P F+   + LSI E+   G +  +PVA D DS   G+A Y +     +  +        F     +D++ KI  PQ+ VI  +DRE ++ Y   +  +D  GK    +  L    + D NDN+P++    Y+  + E       +  ++A DAD     N  +D+ +  A     R L                 +KG+ +      +K  V  +        +   +TISIKD NDNAP I I            A I E+      + ++ V D D   N   +C +       L+        + N+R ++     Y ++T      D E++  Y + I+ +D G+P L+S+    V V D NDN+P F+ ++ E    E++    ++  V A D DS  NA++ YS+ E      F IN   G I  + + DRE    Y F V A+D G PS++ TA +++ V D+ND  P F    Y F++ E   NM   N +G++  +D D  EN  V   +         PD  K       I +NG  ++   I  DRE++ST    + A D G PP S+ + VT+ + D ND+ P  T P+++S + +  SS  +T   + K  AED D  +N  + + + G        I  + G + L +    +   +    R++VR SD+
Sbjct:   44 KLSEEQPPNTLIGSLAADL--GLPDSGHLYKLEVGSPYLR----VDSKTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQL--------FGLQVAEDVDEKI--PQVIVIGNLDREKKDSYDLNIRVVDG-GKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDAD--TGANGDIDYSLHQASDTVQRLLRIDRSTGIIY-------VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPAS----ESANDRKRK-----YFLQT--TTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNE---NMPPLNPVGVVTVSDADKGENSQVTLFV--------EPDNGKF------IIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVK--AEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGL---HRLVVRVSDK 779          

HSP 2 Score: 128.257 bits (321), Expect = 2.142e-29
Identity = 154/640 (24.06%), Postives = 256/640 (40.00%), Query Frame = 1
Query:  478 LISSVDREELCQQKDNDCSHIVIISFG------SFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTE--RFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLP----YKITVKE-CTTSREIFSLKAFDADDQNN------INSKLDFKIDTA-KLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMK-LVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKN-GKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            +I ++DRE    +KD+   +I ++  G      S +  +T  + D ND  P F K + E  + E+ P GH +    A+D D+   G   Y +    +++D +    R +       +K L              +DRE      F +VA D     K     + ++IKD NDN+P    + IGL     +   + E       +  ++  D D+  N      +   + F++  A +  N RK    L  +          L     +K   + +  VD G   L +T  L + + D NDN P  S         E+ +  + +  +   D D  +N E    + +++   L E+ S +                  E       DRE V+ Y   +   DKG P  T +    + V D NDN P F  S Y F + EN    + +G V+  D D  EN+++   ++     +   N  G I +   FDRE++S Y F + A D G+P RSS   + + VLD+ND  P   K    +      +      + +++A D D   N  ++Y I   +P+              QI+ N G++ L      + +    + V   D GKPP   +  V V +N+
Sbjct:  217 VIGNLDRE----KKDSYDLNIRVVDGGKPPRASSALLRIT--VTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLH---QASDTVQRLLRIDRSTGIIYVKGL--------------VDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTT---------TLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTG-----------------EIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPH-----------GLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNE 796          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 207.994 bits (528), Expect = 1.882e-54
Identity = 199/697 (28.55%), Postives = 321/697 (46.05%), Query Frame = 1
Query:  565 IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNI--KDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNT--TDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIY----FSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFR-KQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVI--DREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEK-DGRVILKESIKSRSHRITQSDRILVRASDQ 2589
            + E    + D+ND  P F    + +S+ E+  +G +  +P+A+D DS++ G+A Y +       D  T      F      D   K+  PQL V+  +DRE ++ Y  T+ A+D    + +   +L +   D NDNSP++    Y+  V E       +  +KA D+D     N ++++ +  A          +    +  +I ++G L       L   +   D G    +  T +TI + D NDNAP + I            A I E+      + ++ V D+D   N   +C +       L+     S ST + + K      Y ++T      D E+V  Y V I+ +D G+P L+S+    V V D NDNSP+F+ +I+E +  E +     I  V+A D DS  NA++ Y++  +G+ Y    F I+   G +  +   DRE K  Y F V A+D G P    TA++++KVLD ND  P F    Y F+++E   NM   + +G++   D D  EN  V   +         PD  K   F VQ   NG  ++   I  DRE++S+    + A D G+PP S+ + VT+ + D ND+ PV T PS++  SF  +S        +  ++AED D   N  +VF + G        I    G + L + + +R H      R++VR SD+
Sbjct:  115 LIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALT---AGPDAAT-----LFGLQVADDRGGKL--PQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSD--MGPNGEIEYSLHQAV---DPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPA---SDSTSDNKRK------YFLQTT--TPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNI--VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLE---NMPPLSPVGMVTVLDMDKGENAHVHLSV--------EPDGGK---FVVQ---NGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNS--SFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEM-TRKHGGLH--RLVVRVSDR 761          

HSP 2 Score: 146.362 bits (368), Expect = 4.910e-35
Identity = 153/604 (25.33%), Postives = 244/604 (40.40%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPYKITVKE--------CTTSREIFSLKAFDADDQNN------INSKLDFKIDTAK---LGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGG--GLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLH-LKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L  ++ D ND  P F     E  + E+ P+GH +    A D D    G   Y +           +  +   K   I D    II     V   +DRE     SF +VA D   + K     + + + D NDN+P    + IGL   +T  E              +  ++  D D+  N      +   + F++  A      N RK         +   + E  ++ +A          VD G   L +T  L + + D NDN+P+ S T       E  +  E +  +T  D D   N E   ++   +Y+  L E+   +   K   P                  DRE  + Y   +   DKGSP    +    + VLD NDN P F  S Y F ++EN    S +G V+  D D  ENA +  S++  G  +   N  G I +   FDRE++S Y F + A D GEP RSS   + + VLD+ND  P+  K    +  +     +  +++ ++EA D D   N  + + I   +PY         + F++  + +G+++L   + R+      + V   D GKPP   +  V + +N+
Sbjct:  230 LRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLH----------QAVDPVPKLLRI-DRTTGIIY----VKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGL---VTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVA----------VDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTP-----------------LDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPY---------QLFRISPS-SGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 778          

HSP 3 Score: 102.449 bits (254), Expect = 1.461e-21
Identity = 139/575 (24.17%), Postives = 239/575 (41.57%), Query Frame = 1
Query:  310 FEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVII--------SFGSFIFELTFLIIDMNDEVPTFAKQEIEL--------SILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDT--EGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSRE-IFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGL--QNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETN--ENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGS--SEIGSVSAPDKDSQENAKIKYSLDEIGNIY--FSIN-MYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKV 1950
            +E E+ EN P+   ++ +KA         +  + +      +  L++++  TG +++   +DREE+     N  S  V+         S  +F+   T  + D ND  P    + I L        +I ED+P+G  + L   SD D  +  + +  +     + D+    F+      S  D + K     L+    +D E  ++Y   +VA+D+         ++ + + D+NDNSP +    +++   E     E I  + A DAD  +  N++L + I    +G+S          +   +     L    + +    +   D G    + T  + I + DCNDN P   ++  S  + EN   L  + ++TV D D   N           ++HL           +  P  G  ++         + SFDREK   Y+  +  +D G P  +S    ++ VLDENDN P+ TK         + V S  S +  V A D DS  NA + +S+   GN Y  F I+   G I   ++  R+   L+   V  SD G+P R +TA + + V
Sbjct:  249 YEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEI-----NSLSFYVVARDKGPQPKSSKTFV---TIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVV-----AGDVP---FQLRPASDSTSDNKRKYF---LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDAD--SGTNAELFYNI----VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENA----------HVHL-----------SVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSI-AGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 4 Score: 100.138 bits (248), Expect = 9.124e-21
Identity = 87/308 (28.25%), Postives = 138/308 (44.81%), Query Frame = 1
Query: 1600 SPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEK------------FDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIF-RKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEI-GATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPS----SASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGN 2469
            SP+L   +   + V D NDN+P F  S+    + EN++  +      A D+DS+ N    Y+L    +   +  ++G+    ++             DRE K  Y+ T+ A D G P R S A + V V D ND  P F    YE  + E   N  V +++  ++A+D D+  NG + Y +  A  P          K  ++  T  G + + G +DREE +++   V+ARD G  P S+   VT+ + D ND+ P          + S    NIS +   G  +A +   DKD   N  V   + G+
Sbjct:  112 SPRLIEGR---IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPD---AATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSE---NSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPV--------PKLLRIDRT-TGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGD 401          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 208.764 bits (530), Expect = 2.112e-54
Identity = 224/837 (26.76%), Postives = 381/837 (45.52%), Query Frame = 1
Query:  259 CLNFHFSISKL---DKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHL-ISSVDREEL--CQQ--KDNDC----SHIVIISFGSFI--FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI-----ENYFKSTDIMT-----ERFEDCFKFSSIKDLEMKII-----QPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLN--IKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVI-LKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYY 2640
            CL +   I +L     +  +    L E  P    + N+ A L       +  F + SG+       +++ +TG L      +DRE+L  CQ    +N+C       VI    S++  FE   +I+D+ND  P+F    + LS+ E+ PIG +  LP A+D D  + GI  Y++     EN  +S           RF++    SS+ +L++        QPQL +   +DRE R+ Y  TL   D          +L   I D+NDN+P++    Y+  + E  +    I  LKA DAD    +N ++++ +  A   + R+L R+   +    +L     + +++++  V  +        +   + ++IKD NDN P I I            A + E+      + ++ V D D   N   +C +       LK     +   + E+ K+   +      + +   D E    Y+V+I+ +D GSP LTS+    V V D NDN PIF+K++ +    EN+     + +V+A D DS +NA+I YSLD   N  FSI+   G I      DREQK  Y F VIA D G  +   +A+++V V D+ND +P F +  + F + E   N+  ++ +G++   D D  +N     E+G           E+ +       + G +      DRE+++T    V A D G PP S + TV++ + D ND+ P  TFP ++S + +  SS   T  ++  + A D D  +N  + + ++G        I+    VI L   ++ + + +    R++V+ +D   N   S+  + ++  Y
Sbjct:   10 CLYYCMLILQLAHQPAAKQVLRYRLAEEGPADVRVGNVAADLGMVAGSREVTFTLESGS----EFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADAD--VGVNGQIEY-VFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKP----ASEMEGEQNKKKYFL------HTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE---NLDPNSPVGMVTVIDADKGQNA----EMGLFI--------EEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRT--VVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGL---HRLVVQVTD---NGQPSQSTTTLVHVY 806          

HSP 2 Score: 130.568 bits (327), Expect = 3.903e-30
Identity = 160/606 (26.40%), Postives = 253/606 (41.75%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPY-----KITVKECTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNE-----NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYG----NMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L  +I D+ND  P F K   E  + E+   G  I    A+D D    G    +IE  F +      R            L +      L V+ +IDRE   +  FT++A D     K     +VLNIKD NDN P    + IG  +         ++      I  ++  D D   N      +   + F++  A      +  +  ++ ++  +  E       E  +V+    VD G   L +   L + + D NDN P+ S         EN    E +T +T  D D   N E S  L+               S+ N         I+ I+++      N + DRE+ + Y   +I  DKG   L  S    V+V D+NDN P F + ++ F + EN   +S +G V+  D D  +NA++   ++E   I+   N  G IF+   FDREQK+ Y F V A D G+P RS+TA++ + V+D+ND  P       F I  SY     +  V   +  + A D D   N  + Y I   +P+         + F++     G +SL   ++++      + V   D+G+P  S +  V V +N+
Sbjct:  262 LRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNG----QIEYVFGAATESVRRL-----------LRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETT----QEYNVVI--VAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLD---------------SSVNG--------IFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTV----TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPF---------RLFEID-GATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNE 809          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 209.149 bits (531), Expect = 2.180e-54
Identity = 214/779 (27.47%), Postives = 357/779 (45.83%), Query Frame = 1
Query:  259 CLNFHFSISKL---DKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHL-ISSVDREEL--CQQ--KDNDC----SHIVIISFGSFI--FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI-----ENYFKSTDIMT-----ERFEDCFKFSSIKDLEMKII-----QPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLN--IKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGN 2469
            CL +   I +L     +  +    L E  P    + N+ A L       +  F + SG+       +++ +TG L      +DRE+L  CQ    +N+C       VI    S++  FE   +I+D+ND  P+F    + LS+ E+ PIG +  LP A+D D  + GI  Y++     EN  +S           RF++    SS+ +L++        QPQL +   +DRE R+ Y  TL   D          +L   I D+NDN+P++    Y+  + E  +    I  LKA DAD    +N ++++ +  A   + R+L R+   +    +L     + +++++  V  +        +   + ++IKD NDN P I I            A + E+      + ++ V D D   N   +C +       LK     +   + E+ K+   +      + +   D E    Y+V+I+ +D GSP LTS+    V V D NDN PIF+K++ +    EN+     + +V+A D DS +NA+I YSLD   N  FSI+   G I      DREQK  Y F VIA D G  +   +A+++V V D+ND +P F +  + F + E   N+  ++ +G++   D D  +N     E+G           E+ +       + G +      DRE+++T    V A D G PP S + TV++ + D ND+ P  TFP ++S + +  SS   T  ++  + A D D  +N  + + ++G 
Sbjct:   14 CLYYCMLILQLAHQPAAKQVLRYRLAEEGPADVRVGNVAADLGMVAGSREVTFTLESGS----EFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADAD--VGVNGQIEY-VFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKP----ASEMEGEQNKKKYFL------HTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE---NLDPNSPVGMVTVIDADKGQNA----EMGLF--------IEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRT--VVRTVIATDTDTGINADLNYSIIGG 758          

HSP 2 Score: 130.954 bits (328), Expect = 3.464e-30
Identity = 160/606 (26.40%), Postives = 253/606 (41.75%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPY-----KITVKECTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNE-----NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESY----GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L  +I D+ND  P F K   E  + E+   G  I    A+D D    G    +IE  F +      R            L +      L V+ +IDRE   +  FT++A D     K     +VLNIKD NDN P    + IG  +         ++      I  ++  D D   N      +   + F++  A      +  +  ++ ++  +  E       E  +V+    VD G   L +   L + + D NDN P+ S         EN    E +T +T  D D   N E S  L+               S+ N         I+ I+++      N + DRE+ + Y   +I  DKG   L  S    V+V D+NDN P F + ++ F + EN   +S +G V+  D D  +NA++   ++E   I+   N  G IF+   FDREQK+ Y F V A D G+P RS+TA++ + V+D+ND  P       F I  SY     +  V   +  + A D D   N  + Y I   +P+         + F++     G +SL   ++++      + V   D+G+P  S +  V V +N+
Sbjct:  266 LRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNG----QIEYVFGAATESVRRL-----------LRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETT----QEYNVVI--VAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLD---------------SSVNG--------IFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTV----TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPF---------RLFEID-GATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNE 813          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 209.149 bits (531), Expect = 2.219e-54
Identity = 214/779 (27.47%), Postives = 357/779 (45.83%), Query Frame = 1
Query:  259 CLNFHFSISKL---DKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHL-ISSVDREEL--CQQ--KDNDC----SHIVIISFGSFI--FELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI-----ENYFKSTDIMT-----ERFEDCFKFSSIKDLEMKII-----QPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLN--IKDINDNSPQWIGLPYKITVKE-CTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRS--------AKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINM-YGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQ-YEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGN 2469
            CL +   I +L     +  +    L E  P    + N+ A L       +  F + SG+       +++ +TG L      +DRE+L  CQ    +N+C       VI    S++  FE   +I+D+ND  P+F    + LS+ E+ PIG +  LP A+D D  + GI  Y++     EN  +S           RF++    SS+ +L++        QPQL +   +DRE R+ Y  TL   D          +L   I D+NDN+P++    Y+  + E  +    I  LKA DAD    +N ++++ +  A   + R+L R+   +    +L     + +++++  V  +        +   + ++IKD NDN P I I            A + E+      + ++ V D D   N   +C +       LK     +   + E+ K+   +      + +   D E    Y+V+I+ +D GSP LTS+    V V D NDN PIF+K++ +    EN+     + +V+A D DS +NA+I YSLD   N  FSI+   G I      DREQK  Y F VIA D G  +   +A+++V V D+ND +P F +  + F + E   N+  ++ +G++   D D  +N     E+G           E+ +       + G +      DRE+++T    V A D G PP S + TV++ + D ND+ P  TFP ++S + +  SS   T  ++  + A D D  +N  + + ++G 
Sbjct:   10 CLYYCMLILQLAHQPAAKQVLRYRLAEEGPADVRVGNVAADLGMVAGSREVTFTLESGS----EFFKIDNITGELTTNEKRIDREKLQQCQMIFDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADAD--VGVNGQIEY-VFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKP----ASEMEGEQNKKKYFL------HTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVNGIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKE---NLDPNSPVGMVTVIDADKGQNA----EMGLF--------IEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTFPINSSYTLLPPSSTVRT--VVRTVIATDTDTGINADLNYSIIGG 754          

HSP 2 Score: 130.568 bits (327), Expect = 3.859e-30
Identity = 160/606 (26.40%), Postives = 253/606 (41.75%), Query Frame = 1
Query:  574 LTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALD--TEGKRGHVNIVLNIKDINDNSP----QWIGLPY-----KITVKECTTSREIFSLKAFDADDQNN------INSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGG--LQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNE-----NKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESY----GNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLND 2307
            L  +I D+ND  P F K   E  + E+   G  I    A+D D    G    +IE  F +      R            L +      L V+ +IDRE   +  FT++A D     K     +VLNIKD NDN P    + IG  +         ++      I  ++  D D   N      +   + F++  A      +  +  ++ ++  +  E       E  +V+    VD G   L +   L + + D NDN P+ S         EN    E +T +T  D D   N E S  L+               S+ N         I+ I+++      N + DRE+ + Y   +I  DKG   L  S    V+V D+NDN P F + ++ F + EN   +S +G V+  D D  +NA++   ++E   I+   N  G IF+   FDREQK+ Y F V A D G+P RS+TA++ + V+D+ND  P       F I  SY     +  V   +  + A D D   N  + Y I   +P+         + F++     G +SL   ++++      + V   D+G+P  S +  V V +N+
Sbjct:  262 LRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNG----QIEYVFGAATESVRRL-----------LRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETT----QEYNVVI--VAVDSGSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLD---------------SSVNG--------IFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTV----TFPINSSYTLLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPF---------RLFEID-GATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYVNE 809          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000005378.1 (SMESG000005378.1)

HSP 1 Score: 2032.3 bits (5264), Expect = 0.000e+0
Identity = 1073/1074 (99.91%), Postives = 1073/1074 (99.91%), Query Frame = 1
Query:  256 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYIIILYCXXXXXXXXXXXXXXXXXYFYSAGRNLNGLLERKPESKQNDCNIYSSNNQYFESIPFETTGQNEACNYPNGMESQTVYRMQNPDNNYMQLMTNTATSRCQTYTPINLYSSNLTKLPSNTLTYLNTHPINSFESPSQFSYDFNTSHLNSPNSVLPLINDENHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDRASKPLVDNKYQLSKDVSLNQTKLNEKYISSSFV 3477
            VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKLSRILYISSNNLILIEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYIIILYCLAAVVFIIFLIVLCVLIYFYSAGRNLNGLLERKPESKQNDCNIYSSNNQYFESIPFETTGQNEACNYPNGMESQTVYRMQNPDNNYMQLMTNTATSRCQTYTPINLYSSNLTKLPSNTLTYLNTHPINSFESPSQFSYDFNTSHLNSPNSVLPLINDENHENSGKIKSKSK ISSILKPNSKSSNIKSHSLSSIDSNSLDRASKPLVDNKYQLSKDVSLNQTKLNEKYISSSFV
Sbjct:    6 VCLNFHFSISKLDKSSSLFEIELKENKPIHSELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKLSRILYISSNNLILIEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYIIILYCLAAVVFIIFLIVLCVLIYFYSAGRNLNGLLERKPESKQNDCNIYSSNNQYFESIPFETTGQNEACNYPNGMESQTVYRMQNPDNNYMQLMTNTATSRCQTYTPINLYSSNLTKLPSNTLTYLNTHPINSFESPSQFSYDFNTSHLNSPNSVLPLINDENHENSGKIKSKSKHISSILKPNSKSSNIKSHSLSSIDSNSLDRASKPLVDNKYQLSKDVSLNQTKLNEKYISSSFV 1079          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 454.521 bits (1168), Expect = 3.026e-140
Identity = 290/776 (37.37%), Postives = 435/776 (56.06%), Query Frame = 1
Query:  310 FEIELK--ENKPIHSELINLK-----AKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSS-IKDL-EMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKL----VVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS-LDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLS---PVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            F I+LK  ENK    +LINLK      KLP     +   + IIS    + N   L   +G L   +++DRE +C+  D  C  I++IS    + E+   I D ND +P F+ +   LSI E+  IG  + LP A DLDS+   I  Y I++          +F+    F+  IK +  MKI  P LK+IK+IDRE  +++   L+A D+  ++G   I ++I D+NDNSPQW  +    TVKEC     +  L+AFD DD +  N ++ +KI      NS K   I  +       +  + +G+  M L       +  VDGGG +N+T +TI I+DCND+AP I+I   +A I+EN RT  +LT + V D+D  +N +F+C LNDTTY  +  V     +  N R     + +Y I+   +  FDRE + FYSVLI CID G P L   + F+V ++DENDN+P F      F + EN+   + IG V A D DS EN ++ Y  L+   N YF+I + G I  K KFDRE K  Y+ T++A DNGEPS + T ++ +++LD NDC P+F++QY + I E  G   +H  LG + A+D+DL ENG V+Y I     + N  +       K+ +   G L++YGV+DRE+  +I  ++IA D+GKP LS    V V + D+ND+KP F +P +   +F+NIS++ + G +LA  +AED D   NG++ + ++ ++ +    P  ++ DGR+IL + ++ R   I   DR+++RASD
Sbjct:    7 FYIKLKISENKGSGEDLINLKNYIIIHKLPI---NSSGTYNIISNEPDINNYFILQSHSGILKQRNNIDRETMCKHAD-VCQKIILISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTMNRMKI--PYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKIS----DNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM--VKEDVYNQSNGR----QLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINLE--GILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKM-NFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLRER-EGIRLPDRLIIRASD 762          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000007877.1 (SMESG000007877.1)

HSP 1 Score: 436.032 bits (1120), Expect = 4.314e-134
Identity = 265/704 (37.64%), Postives = 401/704 (56.96%), Query Frame = 1
Query:  505 LCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSS-IKDL-EMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKL----VVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYS-LDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLS---PVTIEKDGRVILKESIKSRSHRITQSDRILVRASD 2586
            +C+  D  C  I++IS    + E+   I D ND +P F+ +   LSI E+  IG  + LP A DLDS+   I  Y I++          +F+    F+  IK +  MKI  P LK+IK+IDRE  +++   L+A D+  ++G   I ++I D+NDNSPQW  +    TVKEC     +  L+AFD DD +  N ++ +KI      NS K   I  +       +  + +G+  M L       +  VDGGG +N+T +TI I+DCND+AP I+I   +A I+EN RT  +LT + V D+D  +N +F+C LNDTTY  +  V     +  N R     + +Y I+   +  FDRE + FYSVLI CID G P L   + F+V ++DENDN+P F      F + EN+   + IG V A D DS EN ++ Y  L+   N YF+I + G I  K KFDRE K  Y+ T++A DNGEPS + T ++ +++LD NDC P+F++QY + I E  G   +H  LG + A+D+DL ENG V+Y I     + N  +       K+ +   G L++YGV+DRE+  +I  ++IA D+GKP LS    V V + D+ND+KP F +P +   +F+NIS++ + G +LA  +AED D   NG++ + ++ ++ +    P  ++ DGR+IL + ++ R   I   DR+++RASD
Sbjct:    1 MCKHADV-CQKIILISINGQVLEVMVDINDENDNIPQFSMRHKTLSIQENSDIGSELSLPTADDLDSEPNSIIRYFIKDIHSRDIRRMNQFQASRYFTIFIKTMNRMKI--PYLKLIKEIDREEIDRFELILIAEDSGKQQGSCTITVSIIDVNDNSPQWPTVNISKTVKECDRQGPLVELQAFDRDDSSTPNGQIKYKIS----DNSPKKELINRLFYIAGSSLFLSSQGLQLMDLKTYITFFITAVDGGGRENSTAVTIEIEDCNDHAPNIAIYKSTASIRENDRTPLVLTSVMVNDDDKGINSQFNCDLNDTTYFTM--VKEDVYNQSNGR----QLFMYNIKKIPDTFFDRESLSFYSVLIRCIDLGRPPLVGEKLFTVTIIDENDNAPKFGSDDIRFTLTENNNIGAPIGYVRAYDPDSNENGRVSYQILNNDENYYFTITILGKIEAKWKFDREIKDQYSLTIMAKDNGEPSLNDTCTVHIRILDVNDCVPVFKQQYFYQITEGNGLATIHAILGKVTADDKDLGENGTVYYAIRQKYDHSNRQNNIGLNLLKINL--EGILNIYGVVDREQMVSIQAEIIAYDNGKPQLSAVANVIVDVLDVNDNKPKFKYPINKM-NFINISTDSQVGKVLANFEAEDPDKGENGTITYSIISHKHMEQNLPYQLQNDGRLILTKYLRER-EGIRLPDRLIIRASD 687          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000066775.1 (SMESG000066775.1)

HSP 1 Score: 429.098 bits (1102), Expect = 4.625e-131
Identity = 281/786 (35.75%), Postives = 435/786 (55.34%), Query Frame = 1
Query:  451 LNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKI--------ENYFKSTDIMTERFEDCFKFSSIKDLEMKI--IQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMK-LVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTK---RFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVGNESLS--PVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYI 2760
            LN  +G L + S +DRE +C+     CS  + +   +   ++   I D+ND VP F   +  ++I E++PIG    LPVA D DS KYG+ +Y I        EN  K+         + F+F  IK+ + K   I P L++IK IDRE    + F L+A D   + G   + + + D+NDN+P+W    YK+ ++EC +  +I  L A D DD N  N  + +++ + +  + + +S+I YI+ N L L    + G+     + + +   DG G  N T + I+I+DCND+ P+ISI +R  K+ EN++   ILT + VKDED   N  F C LND+  L+LK +                  IY+IET  + SFDREK+  Y+V I C+D+G+P ++S Q+FS+ ++D NDN+P F   I  F ++EN+   S +G V A D DS  N  I YS+    N  F+I++YG I +K KFDRE+   Y F V A DNGEP  + +  + VK+ D NDC P+F K Y F I ESYG    +  L  I+A D+DL +NG V Y +    P +  P   K K   R  ++++ +G +S+YG +DREE S+I + V A D G P LS + T+ + + DLND+ PVF FPS+ + +FVN+S E+E G  +  +  +D D  +NG++   L+ +      P  I+ +G +I+  S+K  S+  +  DR++++ASD  +N  ++ + +L +RY   +    N+ P    K S  S + NF   ++ K+ N N I
Sbjct:   65 LNRTSGDLIVKSFLDRETICENTKETCSMKLYLDQDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKT-------IGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFGNQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELIANDRDDPNTKNGLVSYQL-SDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATDGNGRMNETSVDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDD-----------NFAIYKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILN-SNDNFAISIYGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKP-IGIPGNSKLKAELRNLIKVSFDGAISIYGNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSN-NMNFVNVSVEWEIGKTICTVKTKDLDQGINGTITHSLINSNKRENFPFKIQSEGEIIIAHSMKEFSNFRSLPDRLIIKASDLGQN-PKNNIATLYIRY---IHSLTNSNPTSIGKKSHSSDNNNFG--FRLKNDNKNPI 822          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000059440.1 (SMESG000059440.1)

HSP 1 Score: 419.853 bits (1078), Expect = 8.022e-128
Identity = 302/881 (34.28%), Postives = 461/881 (52.33%), Query Frame = 1
Query:  262 LNFHFSISKLDKSSSLF---EIELKENKPIHS--ELINLKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELCQQKDNDCSHIVIISFGSF----IFELTFLIIDMNDEVPTFAKQEIELSILEDVPIGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKDLEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDINDNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAKLGNSRKXXXXXXXXXXXXXXXEGALKGMAEMKLVVPLKVVDGGGLQNTTDLTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEFSCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKVDFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENSVGSSEIGSVSAPDKDSQENAKIKYSLDEIGNI----YFSINMYGVIFTKEKFDREQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVESYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFKVQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDLNDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFELVG-NESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQSEVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYIIILYCXXXXXXXXXXXXXXXXXYFYSAGRNLNGL 2862
            L F +++ K + S  L+   E   K N PI +  +LI  + K     K    +      N   R+LI ++   G + + S++DREE+CQ   + C     +++  F    IFEL   IID+ND  P+F   E  + I E+V       LPVA D DS+KYG+  Y    Y KS  I +  +E+ F+           I P L+VI  +DRE  + + F L A D  G +G   I++ I D+NDN+PQW+GLPY+  + ECTT  ++  L A D DD   I  ++ FKI +    N   + RI YI+ + L L  GALK   E K  + +   DG G  N T + + IKDCND+ P+I + S S KIKEN+++  ++T +TV DED  +N EFSC LNDT ++ L  + +  L    ++       I+Q+ +     FDREK   YSV +IC D G+P ++SS+  ++ + DENDN P F      F I E++    EIG V A D DS  N  I YS+  IG+      F IN  G I   +  DRE K  Y FTV A DNGEP+ + +  I + VLD ND  P     Y F IVES+     H  +G + A+D D+ +NG   + + + S  ++           +Q+   GK+  +G IDRE+   I + V   D+G PP + + TV + + D+ND++P FT+P   + +++NI+ +   G ++ ++ A D+D+ LNGS+++ L   N +    +I+ DG++ILK+ + +   +I   DR++V A DQ      S   +L +RY+ P   +  +  N +S  SK    K++       +   N  IIL  L   + +I ++V  + IY Y  G+ L+ L
Sbjct:    8 LFFLYTVVKSEFSVKLYLSVEENQKPNSPIGNLIKLIQNQTKSTEILKTKSFQLESEKSNTYGRHLISVDQKKGDIWVTSAIDREEICQPI-SKCLTGAFLNYIIFADHQIFELQIEIIDINDNFPSFQPDEKTIKIPENVARSSEFSLPVAKDRDSEKYGVKKY----YLKS--ISSSIYENYFELID----HGNNINPYLRVIGDLDRENIKSFEFHLYASDGGGNQGKCRIIVEITDVNDNTPQWVGLPYRKEISECTTEAKVLQLNAQDKDDPQTIGGQIRFKI-SENSQNYEMIVRIFYITESILYLNIGALKSFKENKASIVVIAADGEGRSNETTIELEIKDCNDHRPVIKVHSSSLKIKENEKSKILVTRITVTDEDQGINSEFSCSLNDTNFVSLDSMYTSPLENGGQKK------IFQLNSIPGLYFDREKASRYSVEVICNDNGTPTMSSSEIITIFISDENDNPPHFETEFKTFSISEDAKIGHEIGIVIAKDSDSSPNNIITYSI--IGDYEVKETFGINHNGQIHLNKILDREVKDRYEFTVEAKDNGEPNLNDSCKIRIIVLDVNDNIPEISTSYSFKIVESWEREHKHFYIGKLNASDRDIGQNGTFRFRVRSRSTPID-----------IQVYNEGKIIYFGNIDREKVDKIDVLVDVIDNGNPPRTATTTVHIEVLDVNDNRPKFTYPLLNAHNYLNITDDMAAGSIVGEVKATDEDFGLNGSIIYNLTNQNHTKDLFSIQSDGQIILKKKLDT---KIKNPDRLVVEARDQG-TPSLSATTTLYIRYFKPRDSF--DRSNENSMNSKYINPKDYPRTVNKSNGLPNNAIILVLLVVSIMMIVIVVGGIAIYIYCRGKGLSRL 851          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11.236e-6127.06protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH12.221e-6127.19protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11X2.735e-5527.78protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X2.850e-5527.78protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X3.137e-5527.82protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-18.665e-3727.17FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.261e-3627.17FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.955e-2624.18CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-44.916e-2624.26Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-88.993e-2024.09CaDHerin family [Source:UniProtKB/TrEMBL;Acc:U4PR... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan4.113e-4526.10gene:FBgn0024836 transcript:FBtr0303223[more]
stan4.113e-4526.10gene:FBgn0024836 transcript:FBtr0088214[more]
stan4.738e-4526.10gene:FBgn0024836 transcript:FBtr0330601[more]
stan5.098e-4526.10gene:FBgn0024836 transcript:FBtr0339463[more]
stan5.174e-4526.10gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CT030123.14.343e-5928.05protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.15.249e-5928.05protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.15.564e-5928.05protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.16.010e-5928.05protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.16.022e-5928.05protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh174.018e-6427.81protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.214e-6427.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.062e-6427.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.525e-6427.81protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh179.757e-6427.81protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh12.261e-6228.04protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh12.261e-6228.04protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh13.768e-6028.01protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11x1.095e-5728.30protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.516e-5728.30protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN5.936e-6127.06Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA7|PC11X_HUMAN1.507e-5427.78Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WYY1|PC11X_PANPA1.971e-5427.66Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR2.076e-5427.66Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q9BZA8|PC11Y_HUMAN3.514e-5427.53Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S0C67.967e-10429.31Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YTS11.932e-6928.94Putative cadherin OS=Fasciola gigantica OX=46835 G... [more]
A0A068WE581.973e-6928.61Protocadherin gamma B1 OS=Echinococcus granulosus ... [more]
A0A068YEU76.478e-6928.43Protocadherin gamma B1 OS=Echinococcus multilocula... [more]
W6USW63.375e-6829.34Protocadherin beta-11 OS=Echinococcus granulosus O... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.808e-5727.40protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a2.493e-5727.10protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.135e-5727.10protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000003988.21.567e-5327.34FAT atypical cadherin 4 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000031516.11.605e-5327.34FAT atypical cadherin 4 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.11.654e-4524.29pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.11.733e-4425.10pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004042.18.295e-4225.47pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.11.095e-4125.47pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
si:ch211-199f5.11.153e-4024.81protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461899.811e-4526.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404706.076e-3925.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354131.459e-3825.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.705e-3826.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348156.505e-3826.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.700e-5426.79protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a1.882e-5428.55protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh7b2.112e-5426.76protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b2.180e-5427.47protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
pcdh7b2.219e-5427.47protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005378.10.000e+099.91SMESG000005378.1[more]
SMESG000007877.13.026e-14037.37SMESG000007877.1[more]
SMESG000007877.14.314e-13437.64SMESG000007877.1[more]
SMESG000066775.14.625e-13135.75SMESG000066775.1[more]
SMESG000059440.18.022e-12834.28SMESG000059440.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034737 ID=SMED30034737|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3701bp
TTTTTTTTTAAATACAAAAATTTTTTAATTTTATTTTAACTTTTTATAAA
AAACATTTATTACATAATATAGGGTCTATGATTTCTTTGATAATTTCTTC
GCTGAATTCTGATTGGTTAGAATTTGAATCCATTGGACGAATCATAATTG
GAAAATGTTTTAGGATTAATTGAAACCATATCCTTCTGTGTTTTCATTTT
TATCATAAAAATGTATTCAATGAACATGATATCAATAATTATGTATATTG
GAATCGTATGCTTGAATTTCCATTTTTCCATATCAAAATTAGACAAATCC
TCAAGTTTATTTGAAATTGAATTAAAAGAAAATAAACCAATTCATTCTGA
ATTAATAAACTTGAAAGCAAAACTACCAACAGCCTTCAAAGAAGCCAAAC
ATCGGTTCGTCATAATTTCCGGAAATGTACGATTGCGCAATTTGATTCAA
CTGAATTTCGTTACCGGGTCTTTGCATTTAATTTCTTCGGTTGACAGAGA
AGAATTGTGTCAGCAGAAAGACAATGATTGTTCTCATATCGTAATTATTT
CATTTGGTAGTTTTATTTTTGAGTTGACATTTTTAATTATCGACATGAAT
GATGAGGTTCCGACTTTTGCCAAACAGGAAATTGAGCTATCAATTCTAGA
AGACGTTCCAATTGGACATGTTATAGACTTGCCAGTGGCATCGGACTTAG
ACAGCCAGAAATACGGAATAGCGTCGTATAAAATTGAAAACTATTTCAAA
TCAACTGACATAATGACGGAGAGATTTGAAGATTGTTTCAAATTTAGTTC
CATTAAAGATTTGGAAATGAAAATAATTCAACCTCAACTCAAAGTGATAA
AGAAAATTGACAGAGAAACACGAGAGAAATATAGTTTTACCTTAGTTGCA
TTAGACACTGAAGGTAAGCGGGGACACGTAAATATTGTTTTGAATATAAA
AGACATAAATGATAATAGTCCACAATGGATTGGTTTACCGTATAAAATAA
CCGTCAAAGAATGTACGACTTCGAGAGAAATATTCAGCTTGAAGGCCTTT
GACGCCGACGATCAAAATAACATTAATAGTAAATTGGACTTCAAAATTGA
TACGGCTAAATTAGGAAATTCGAGGAAATTGTCGAGAATTTTGTATATAT
CTAGTAACAATTTGATTTTAATAGAAGGAGCATTAAAAGGAATGGCAGAA
ATGAAATTGGTCGTACCTTTAAAAGTTGTTGATGGGGGTGGCCTACAAAA
CACGACAGATTTAACTATTTCAATTAAAGATTGCAACGATAATGCGCCTT
TAATTTCAATCACGAGCCGATCGGCAAAAATTAAAGAAAATAAGCGAACT
CTCGAAATTTTAACAATACTTACAGTCAAAGACGAGGATTTGGAAATGAA
TTGTGAGTTTAGTTGTCATTTAAATGACACTACGTATTTACACTTGAAAG
AAGTAATGAGCCGCTCTTTGTCAACAAAAAATGAAAGACCGAAACGAGGA
ATGGTTATTATATATCAAATAGAAACGAATGAAAACAAATCGTTTGATCG
GGAAAAAGTCGACTTTTACTCAGTGCTAATCATCTGCATTGATAAAGGTA
GTCCGCAACTGACTAGCAGCCAACAGTTCAGTGTCATAGTTCTGGATGAA
AATGACAATTCCCCTATATTCACCAAGTCCATTTATGAATTCGAAATAAT
GGAGAATTCGGTGGGCAGTTCAGAAATCGGAAGTGTCAGTGCACCAGACA
AAGATTCACAGGAAAATGCAAAAATAAAATATAGCCTTGATGAAATTGGA
AACATTTATTTTTCAATTAACATGTACGGTGTAATATTTACAAAAGAAAA
ATTCGATAGAGAACAAAAAAGTTTATATAATTTTACAGTCATAGCTTCAG
ACAATGGAGAACCGTCCAGGTCCTCTACAGCAAGTATTTTAGTAAAGGTA
TTGGATCAAAATGATTGCAAACCGATATTTCGCAAACAATATGAGTTTAA
TATCGTTGAGAGTTATGGTAACATGGCTGTCCACAATAACTTAGGTTTAA
TTGAAGCAAACGATGAGGATTTAGACGAAAATGGGCTTGTTTGGTATGAA
ATAGGTGCCACTAGTCCCTATGTAAATAATCCCGACGCTGAAAAAACGAA
ACGATTTAAAGTTCAAATCACAAAAAATGGTAAACTTTCTTTATACGGAG
TTATAGACAGAGAGGAGCAAAGCACAATCTACATTGATGTCATAGCCAGG
GATCATGGAAAGCCTCCTTTATCGAATTCCATAACAGTCACAGTAACTCT
TAATGATCTCAATGATCATAAACCGGTGTTTACGTTTCCATCAAGTGCAA
GCGGTAGTTTTGTAAATATTAGCAGTGAATTTGAAACTGGGTACTTATTG
GCGAAACTCGACGCCGAAGACAAAGATTATGCTTTGAATGGAAGTGTGGT
TTTTGAACTTGTTGGTAACGAATCACTTAGTCCGGTGACAATTGAAAAGG
ATGGCAGGGTGATTTTAAAAGAATCTATTAAATCTCGGTCACATAGAATT
ACTCAATCTGACAGAATACTTGTTAGAGCTTCTGATCAGTGTGAAAATTG
TCACCAATCAGAAGTTGGAAGCTTAATTTTGCGTTATTATTGGCCAATGA
AAGGATATATAAATAACTATCCAAATGGCGATTCTAAGGCATCAAAAAAG
TCTCCCGATAAAAACTTTAATGAAGATTACAAGTCGAAATCATACAATTC
TAATTATATAATTATTCTTTATTGCCTGGCTGCTGTTGTTTTCATAATTT
TCCTCATTGTACTCTGTGTCCTAATATACTTCTATTCTGCTGGTCGAAAT
TTAAATGGACTGTTAGAGAGGAAACCGGAATCGAAACAAAATGATTGCAA
TATATATTCGTCCAACAATCAATATTTTGAATCAATCCCATTTGAAACAA
CCGGGCAAAACGAGGCATGCAATTACCCCAATGGAATGGAATCACAAACT
GTATACAGAATGCAGAATCCTGACAACAATTACATGCAATTAATGACGAA
TACGGCAACATCACGTTGTCAAACGTATACCCCAATCAATCTTTATTCCT
CAAATCTAACGAAACTTCCCAGCAACACATTGACTTACCTCAATACTCAT
CCAATAAATAGTTTTGAATCTCCTTCTCAATTCAGCTATGATTTCAATAC
CTCTCACCTCAACAGCCCAAATTCTGTTCTTCCATTAATTAACGACGAAA
ACCATGAAAACAGTGGGAAAATAAAAAGCAAATCCAAACCTATATCATCT
ATTTTGAAACCCAATTCCAAGTCCTCCAATATCAAATCTCATAGTCTATC
TTCAATAGACTCGAACAGTCTCGATAGAGCCTCGAAACCACTCGTAGATA
ATAAATATCAGCTTTCAAAAGATGTATCATTGAACCAGACAAAACTCAAC
GAAAAATACATCAGTTCAAGCTTTGTTTAAATTCATTTTAATTCGAAATT
TCAAATTTTTAAAACACTGAAAAAAAATTAAAAAAATCAAAATATTAGCA
AGGTCATTGAAATTATTTGTAAACTATTCGACTTTTTCAGGATTTTGTTT
AAATAAATAATACCACAATATTGTGAATCATAACCATTATGGCTCATGTT
TTATAAATATCTGTAAATTCTTTAATTGTACATGAAATACATCGGTTTTG
T
back to top

protein sequence of SMED30034737-orf-1

>SMED30034737-orf-1 ID=SMED30034737-orf-1|Name=SMED30034737-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1090bp
MYSMNMISIIMYIGIVCLNFHFSISKLDKSSSLFEIELKENKPIHSELIN
LKAKLPTAFKEAKHRFVIISGNVRLRNLIQLNFVTGSLHLISSVDREELC
QQKDNDCSHIVIISFGSFIFELTFLIIDMNDEVPTFAKQEIELSILEDVP
IGHVIDLPVASDLDSQKYGIASYKIENYFKSTDIMTERFEDCFKFSSIKD
LEMKIIQPQLKVIKKIDRETREKYSFTLVALDTEGKRGHVNIVLNIKDIN
DNSPQWIGLPYKITVKECTTSREIFSLKAFDADDQNNINSKLDFKIDTAK
LGNSRKLSRILYISSNNLILIEGALKGMAEMKLVVPLKVVDGGGLQNTTD
LTISIKDCNDNAPLISITSRSAKIKENKRTLEILTILTVKDEDLEMNCEF
SCHLNDTTYLHLKEVMSRSLSTKNERPKRGMVIIYQIETNENKSFDREKV
DFYSVLIICIDKGSPQLTSSQQFSVIVLDENDNSPIFTKSIYEFEIMENS
VGSSEIGSVSAPDKDSQENAKIKYSLDEIGNIYFSINMYGVIFTKEKFDR
EQKSLYNFTVIASDNGEPSRSSTASILVKVLDQNDCKPIFRKQYEFNIVE
SYGNMAVHNNLGLIEANDEDLDENGLVWYEIGATSPYVNNPDAEKTKRFK
VQITKNGKLSLYGVIDREEQSTIYIDVIARDHGKPPLSNSITVTVTLNDL
NDHKPVFTFPSSASGSFVNISSEFETGYLLAKLDAEDKDYALNGSVVFEL
VGNESLSPVTIEKDGRVILKESIKSRSHRITQSDRILVRASDQCENCHQS
EVGSLILRYYWPMKGYINNYPNGDSKASKKSPDKNFNEDYKSKSYNSNYI
IILYCLAAVVFIIFLIVLCVLIYFYSAGRNLNGLLERKPESKQNDCNIYS
SNNQYFESIPFETTGQNEACNYPNGMESQTVYRMQNPDNNYMQLMTNTAT
SRCQTYTPINLYSSNLTKLPSNTLTYLNTHPINSFESPSQFSYDFNTSHL
NSPNSVLPLINDENHENSGKIKSKSKPISSILKPNSKSSNIKSHSLSSID
SNSLDRASKPLVDNKYQLSKDVSLNQTKLNEKYISSSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013164Cadherin_N
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 223..235
score: 29.72
coord: 538..564
score: 30.42
coord: 77..96
score: 30.0
coord: 344..363
score: 43.22
coord: 485..498
score: 35.37
coord: 572..589
score: 41.71
coord: 136..165
score: 28.62
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 614..705
e-value: 2.2E-16
score: 70.5
coord: 277..363
e-value: 1.5E-4
score: 31.1
coord: 509..588
e-value: 9.5E-26
score: 101.5
coord: 158..254
e-value: 5.2E-7
score: 39.3
coord: 387..485
e-value: 3.8E-8
score: 43.1
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 609..697
e-value: 5.6E-9
score: 36.3
coord: 492..581
e-value: 2.8E-17
score: 62.9
IPR013164Cadherin, N-terminalPFAMPF08266Cadherin_2coord: 75..105
e-value: 1.3E-4
score: 21.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 131..251
e-value: 2.0E-16
score: 62.4
coord: 483..586
e-value: 2.6E-30
score: 107.2
coord: 252..360
e-value: 1.8E-9
score: 40.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 34..130
e-value: 6.6E-6
score: 28.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 587..702
e-value: 1.4E-20
score: 75.9
coord: 361..482
e-value: 4.7E-16
score: 61.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 703..806
e-value: 2.3E-8
score: 36.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1033..1052
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 535..956
coord: 19..600
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 257..365
score: 13.356
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 590..707
score: 20.7
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 30..136
score: 10.944
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 488..590
score: 26.575
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 366..487
score: 16.359
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 137..256
score: 15.767
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 491..585
e-value: 1.79727E-29
score: 110.866
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 140..252
e-value: 5.53291E-13
score: 63.8717
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 34..101
e-value: 0.00302107
score: 36.1374
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 371..483
e-value: 4.93094E-11
score: 58.4789
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 593..703
e-value: 2.21321E-18
score: 79.2797
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 260..361
e-value: 0.00148366
score: 36.9078
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 717..802
e-value: 8.35027E-4
score: 37.6782
NoneNo IPR availableTMHMMTMhelixcoord: 850..872
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 353..363
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 475..485
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 695..705
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 359..487
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 250..365
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 475..596
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 700..795
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 126..258
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 578..711