SMED30034727

Overview
NameSMED30034727
Smed IDSMED30034727
Length (bp)506
Neoblast Clusters

Zeng et. al., 2018



▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034727 (SMED30034727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034727 (SMED30034727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top

 

Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30034727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034727SMESG000004185.1 dd_Smed_v4_16873_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034727SMESG000004185.1 dd_Smed_v4_16873_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034727SMESG000004185.1 dd_Smed_v4_16873_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034727 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005019:15377..25394 -2375
v31.005019:26079..34170 -1855
Homology
[Close]
BLAST of SMED30034727 vs. Planmine SMEST
Match: SMESG000004185.1 (SMESG000004185.1)

HSP 1 Score: 205.682 bits (522), Expect = 4.327e-69
Identity = 126/128 (98.44%), Postives = 128/128 (100.00%), Query Frame = 2 
Query:   50 MQSQDSDIVNVXXXXXXXXXXXXXXXXXXXXXXRLCRKRKSPPPCDEDKTPLMVSGMTLERYQKEKDILSTNQCRKEFFMTNSTDSLREDADGDEVNLKNDNINLSNLEIRNPIHEFSSTKESNNFHN 433
            MQSQDSDIVNVIIICSSIFGFGIFAFFIILILCRLCRKRKSPPPCDEDKTPLMVSGMTLERYQKEKDILSTNQCRKEFFMTNSTDSLREDADGDEVNLKNDNINLSNLEIRNPIHEF+STKESNNFH+
Sbjct:    1 MQSQDSDIVNVIIICSSIFGFGIFAFFIILILCRLCRKRKSPPPCDEDKTPLMVSGMTLERYQKEKDILSTNQCRKEFFMTNSTDSLREDADGDEVNLKNDNINLSNLEIRNPIHEFTSTKESNNFHH 128
The following BLAST results are available for this feature:
BLAST of SMED30034727 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034727 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000004185.14.327e-6998.44SMESG000004185.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034727 ID=SMED30034727|Name=SMED30034727|organism=Schmidtea mediterranea sexual|type=transcript|length=506bp
GAATTTAACATTCATGTTAAACTATCTGTAACTTTTCCCCAATATATAAA
TGCAATCCCAGGATTCTGACATTGTCAATGTAATTATCATTTGTTCATCA
ATATTTGGTTTTGGTATCTTCGCTTTCTTTATCATTCTTATTTTATGTCG
CTTATGTCGAAAGCGTAAAAGTCCTCCACCCTGTGACGAGGATAAAACAC
CTCTAATGGTTTCTGGAATGACCCTTGAAAGGTACCAAAAGGAAAAAGAT
ATTCTGTCAACTAATCAGTGCAGAAAGGAGTTCTTCATGACGAATTCTAC
TGACTCCCTCCGCGAGGATGCAGATGGGGATGAAGTTAATTTAAAGAATG
ATAATATCAATCTTTCAAACCTCGAAATAAGAAATCCAATTCACGAATTC
AGTTCTACAAAAGAGTCAAACAATTTCCATAATTAACTTTCAAAATTTAA
CTTTCGACATAAATTTATTTTCACATTCAAATTTTTGATAACTAATAAAG
TTTTAC
back to top

protein sequence of SMED30034727-orf-1

>SMED30034727-orf-1 ID=SMED30034727-orf-1|Name=SMED30034727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
MQSQDSDIVNVIIICSSIFGFGIFAFFIILILCRLCRKRKSPPPCDEDKT
PLMVSGMTLERYQKEKDILSTNQCRKEFFMTNSTDSLREDADGDEVNLKN
DNINLSNLEIRNPIHEFSSTKESNNFHN*
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32