Actin-related protein 10-like

Overview
NameActin-related protein 10-like
Smed IDSMED30034724
Length (bp)1732
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-related protein 10-like (SMED30034724) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-related protein 10-like (SMED30034724) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-related protein 10-like (SMED30034724) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-related protein 10-like (SMED30034724) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034724

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034724h1SMcG0022456 dd_Smed_v4_2141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034724h1SMcG0022456 dd_Smed_v4_2141_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30034724h1SMcG0022456 Contig27931newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30034724h1SMcG0022456 dd_Smed_v4_2141_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-related protein 10-like vs. Ensembl Human
Match: ACTR10 (actin related protein 10 [Source:HGNC Symbol;Acc:HGNC:17372])

HSP 1 Score: 299.286 bits (765), Expect = 2.069e-95
Identity = 164/399 (41.10%), Postives = 245/399 (61.40%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGA-PSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVV++ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E    +D T+  KE + L +    +   VLEDIK R C VS + R  K +      D +   PS  P       DY L     G+  L +   IR+   E LF+ + EE ++A+++LD+++  PID R+ L EN++VIGGT  +PGF  RLLAEIR L +       L  +T+++H PP  AN   WLG AIFG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQ-CTVD-TSVAKE-QSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPP-----NVDYPLD----GEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. Ensembl Human
Match: ACTR10 (actin related protein 10 [Source:HGNC Symbol;Acc:HGNC:17372])

HSP 1 Score: 200.29 bits (508), Expect = 5.135e-59
Identity = 113/291 (38.83%), Postives = 176/291 (60.48%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGA-PSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAIL 956
             +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVV++ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E   +   T+  KE + L +    +   VLEDIK R C VS + R  K +      D +   PS  P       DY L     G+  L +   IR+   E LF+ + EE ++A+++LD+++
Sbjct:   11 GEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTV--DTSVAKE-QSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPP-----NVDYPLD----GEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLI 289          
BLAST of Actin-related protein 10-like vs. Ensembl Human
Match: ACTR10 (actin related protein 10 [Source:HGNC Symbol;Acc:HGNC:17372])

HSP 1 Score: 149.828 bits (377), Expect = 1.370e-41
Identity = 69/151 (45.70%), Postives = 107/151 (70.86%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPV 509
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVV++ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPI 151          
BLAST of Actin-related protein 10-like vs. Ensembl Human
Match: ACTR10 (actin related protein 10 [Source:HGNC Symbol;Acc:HGNC:17372])

HSP 1 Score: 147.132 bits (370), Expect = 9.315e-41
Identity = 69/150 (46.00%), Postives = 105/150 (70.00%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNV---VKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIP 506
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  +   V+ +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVV++ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+   P
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVNP 150          
BLAST of Actin-related protein 10-like vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 110.153 bits (274), Expect = 1.474e-25
Identity = 96/408 (23.53%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Match: arp-11 (Actin-Related Proteins [Source:UniProtKB/TrEMBL;Acc:Q9GYR2])

HSP 1 Score: 126.716 bits (317), Expect = 1.411e-31
Identity = 102/388 (26.29%), Postives = 185/388 (47.68%), Query Frame = 3
Query:  135 LTKLGFSGESSPRAIIPTVVKQDNVVKYLTD-IVDPEEQKNFLISFIY--EIYYRKL------LVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQ-LGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEET----TLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDWTD 1253
            + ++G +GE +PR II T    D      +D ++    +K    S  Y  EI Y+ L      ++ P DR V+ VESI  S   R  +  I+ +     S++F P H+ + F    Q+ +V+D G+ E   +P+ EG  ++  +++A+ +   Q+E+R+   + + G + +   E + I +  +  +I   +++E + +    +   +RA+ W +W  +++ +  P    +  +  F  N      G I +  P+ + E +TE  F+     T    +L  ++   +   PID R+ L  NIL+ GG   IPG   RL  EI+ + + NN    +  + Y+  +      +  WLGA++ G L +TI  +SLT E +       DWTD
Sbjct:    1 MFRIGCAGEITPRHIIRTEYVDDEGKLITSDELLALNNRKTATKSTEYYEEILYKFLRIVFLKVLAPTDRPVIFVESIFMSESLRNTITKIVVEKIRCKSLMFMPSHVCATFPFNTQNALVVDIGHSECIAVPIIEGVTMLNEFESARSICGRQLERRVREQMEKYGQIAELNGERRAITE-NDWQDIDACKLIETLSLSLICLDK-ERAENWTKWEASEEGE-KPDIETLCKERLFPNN------GKIFVVPPV-VFETSTEIFFNENLNPTSFDLSLPKLLHKLVSKCPIDLRKKLFPNILLTGGVSTIPGLMKRLEQEIQVIDEKNNSKIAVIVKFYQFSEIKNTPLFVSWLGASLLGSLRETIERKSLTLEEWKNGKLAADWTD 378          
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 110.923 bits (276), Expect = 3.518e-26
Identity = 98/408 (24.02%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITVGNERFRCP--------EALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 110.923 bits (276), Expect = 3.518e-26
Identity = 98/408 (24.02%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITVGNERFRCP--------EALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 110.923 bits (276), Expect = 3.518e-26
Identity = 98/408 (24.02%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITVGNERFRCP--------EALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 108.227 bits (269), Expect = 2.238e-25
Identity = 96/408 (23.53%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            ++ +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +G+VLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITVGNERFRCP--------EALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Match: Arp10 (gene:FBgn0031050 transcript:FBtr0345991)

HSP 1 Score: 237.269 bits (604), Expect = 2.142e-72
Identity = 135/405 (33.33%), Postives = 223/405 (55.06%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPT--VVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYS-RLQQE-TYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQK 1268
            MP  +Y + + +K  ++ DIG + TKLGF+ E+ PR I+PT  V+    + K L D   PEE  + L+ F+  I+++ LLV+PK+R+ V+VE++  S   RE LA +LF HF+V S+LF P+HL++L T+ + + +V+D GY E + +PV+ G  ++  ++    G   +   ++  ++ESG+        KE         +LT  VLEDIKVR C V+ ++RA         K       ++P    D  DY +      D  +++P  +RE A E +F++  E  +L  ++L +IL   +D RR L E++ ++GG   + G  +RL  E++ L   +  Y+ R   E  +K  +     N+T WLG A+ G  D I  RSL +ETY++   VPDW++  + +
Sbjct:    1 MP--IYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVESGV--------KE--------SLLTESVLEDIKVRTCFVTTMERA---------KARANGDENQPTPAPDV-DYIVSDN---DAVIQVPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVPDWSNLCDNR 374          
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Match: Arp10 (gene:FBgn0031050 transcript:FBtr0074760)

HSP 1 Score: 237.269 bits (604), Expect = 2.142e-72
Identity = 135/405 (33.33%), Postives = 223/405 (55.06%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPT--VVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYS-RLQQE-TYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQK 1268
            MP  +Y + + +K  ++ DIG + TKLGF+ E+ PR I+PT  V+    + K L D   PEE  + L+ F+  I+++ LLV+PK+R+ V+VE++  S   RE LA +LF HF+V S+LF P+HL++L T+ + + +V+D GY E + +PV+ G  ++  ++    G   +   ++  ++ESG+        KE         +LT  VLEDIKVR C V+ ++RA         K       ++P    D  DY +      D  +++P  +RE A E +F++  E  +L  ++L +IL   +D RR L E++ ++GG   + G  +RL  E++ L   +  Y+ R   E  +K  +     N+T WLG A+ G  D I  RSL +ETY++   VPDW++  + +
Sbjct:    1 MP--IYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVESGV--------KE--------SLLTESVLEDIKVRTCFVTTMERA---------KARANGDENQPTPAPDV-DYIVSDN---DAVIQVPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVPDWSNLCDNR 374          
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Match: Act88F (gene:FBgn0000047 transcript:FBtr0083143)

HSP 1 Score: 111.694 bits (278), Expect = 2.414e-26
Identity = 97/408 (23.77%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D  A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G   + T+P+YEGF L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  + + A +     ++ +++  +     +G+   + P        E LF   F   E   +   V ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDAGALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYVA------------LDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITALAPSTIK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Match: Act57B (gene:FBgn0000044 transcript:FBtr0071519)

HSP 1 Score: 111.309 bits (277), Expect = 2.782e-26
Identity = 97/408 (23.77%), Postives = 174/408 (42.65%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            ++ +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  + + A +     ++ +++  +     +G+   + P        E LF   F   E   +   V ++I+   +D R+ L  NI++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     +++E Y E G
Sbjct:    4 DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYVA------------LDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCP--------ESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITSLAPSTIK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKEEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Match: Act87E (gene:FBgn0000046 transcript:FBtr0346242)

HSP 1 Score: 110.923 bits (276), Expect = 4.299e-26
Identity = 96/408 (23.53%), Postives = 174/408 (42.65%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            ++ +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  + + A +     ++ +++  +     +G+   + P        E LF   F   E   +   V ++I+   +D R+ L  NI++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYVA------------LDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCP--------ESLFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANIVMSGGTTMYPGIADRMQKEITALAPSTIK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Match: actr10 (actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-040426-768])

HSP 1 Score: 302.368 bits (773), Expect = 6.779e-97
Identity = 165/400 (41.25%), Postives = 241/400 (60.25%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQ---DNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+G + TK GF+GE+ PR IIP+ +K      VV  +   ++ EE    L  FI+ +Y+R LLVNP+DRRVVV+ESIL     R+ L+ +LF+HFEVPS+LF P HL+S+ T+GLQS +V+DCGY E   +P+YEG  ++  W+A  +G   + K L+S++ E       T +      L+ PS I  +  +V+EDIKVR C VS + R  K ++     D     ++RP    D  DY L     G   L +   IR+   E LF+ + EE ++A+++LD ++  PID R+VL EN+L+IGGT  +PGF  RLLAEIR L +       L  +++++H PP   N T WLG AIFG L D +G RS++R+ Y   G++PDW
Sbjct:    1 MPLFEGLGSGGEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIKNPGSQEVVAVVQFNINTEELYTILKEFIHLLYFRHLLVNPRDRRVVVIESILCPSHYRDTLSRVLFRHFEVPSVLFAPSHLMSIMTLGLQSALVMDCGYTETLVLPIYEGIPILSAWEALPMGGKAIHKELQSLLSEQC-----TVDTDSSTGLQLPSVISHIPEDVVEDIKVRTCFVSDLQRGLKIQEAKFNTD-----AERPAPPPDV-DYPLD----GQKILHVKGFIRDSVAEMLFEQDNEEKSIATLLLDTLVKCPIDTRKVLSENLLIIGGTAMLPGFLHRLLAEIRSLVEKPKYRDALATKSFRIHSPPAKPNCTAWLGGAIFGALQDILGSRSVSRDYYNHTGRIPDW 385          
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Match: actr10 (actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-040426-768])

HSP 1 Score: 142.51 bits (358), Expect = 2.138e-38
Identity = 83/203 (40.89%), Postives = 119/203 (58.62%), Query Frame = 3
Query:  648 LKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            L+ PS I  +  +V+EDIKVR C VS + R  K ++     D++     RP    D  DY L     G   L +   IR+   E LF+ + EE ++A+++LD ++  PID R+VL EN+L+IGGT  +PGF  RLLAEIR L +       L  +++++H PP   N T WLG AIFG L D +G RS++R+ Y   G++PDW
Sbjct:   21 LQLPSVISHIPEDVVEDIKVRTCFVSDLQRGLKIQEAKFNTDAE-----RPAPPPDV-DYPLD----GQKILHVKGFIRDSVAEMLFEQDNEEKSIATLLLDTLVKCPIDTRKVLSENLLIIGGTAMLPGFLHRLLAEIRSLVEKPKYRDALATKSFRIHSPPAKPNCTAWLGGAIFGALQDILGSRSVSRDYYNHTGRIPDW 213          
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Match: actc1a (actin alpha cardiac muscle 1a [Source:ZFIN;Acc:ZDB-GENE-040520-4])

HSP 1 Score: 109.383 bits (272), Expect = 1.532e-25
Identity = 98/407 (24.08%), Postives = 170/407 (41.77%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            + +A++ D G  L K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F VP++      ++SL+  G  +GIVLD G      +PVYEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  +++ A +     ++ +++  +     +G+   + P        E LF   F   E   +     + I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         KM  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAE---------------REIVRDIKEKLCYVA------------LDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCP--------ETLFQPSFIGMESAGIHETTYNGIMKCDIDIRKDLYANNVLSGGTTMYPGIGDRMQKEITALAPSTMK--------IKMIAPP-ERKYSVWIGGSILASLSTFQQMWISKDEYEEAG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Match: actc1a (actin alpha cardiac muscle 1a [Source:ZFIN;Acc:ZDB-GENE-040520-4])

HSP 1 Score: 109.383 bits (272), Expect = 1.622e-25
Identity = 98/407 (24.08%), Postives = 170/407 (41.77%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            + +A++ D G  L K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F VP++      ++SL+  G  +GIVLD G      +PVYEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  +++ A +     ++ +++  +     +G+   + P        E LF   F   E   +     + I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         KM  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAE---------------REIVRDIKEKLCYVA------------LDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCP--------ETLFQPSFIGMESAGIHETTYNGIMKCDIDIRKDLYANNVLSGGTTMYPGIGDRMQKEITALAPSTMK--------IKMIAPP-ERKYSVWIGGSILASLSTFQQMWISKDEYEEAG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Match: actc1c (actin alpha cardiac muscle 1c [Source:ZFIN;Acc:ZDB-GENE-040625-46])

HSP 1 Score: 109.383 bits (272), Expect = 1.622e-25
Identity = 98/407 (24.08%), Postives = 170/407 (41.77%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            + +A++ D G  L K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F VP++      ++SL+  G  +GIVLD G      +PVYEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  +++ A +     ++ +++  +     +G+   + P        E LF   F   E   +     + I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         KM  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAE---------------REIVRDIKEKLCYVA------------LDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCP--------ETLFQPSFIGMESAGIHETTYNGIMKCDIDIRKDLYANNVLSGGTTMYPGIGDRMQKEITALAPSTMK--------IKMIAPP-ERKYSVWIGGSILASLSTFQQMWISKDEYEEAG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Match: actr10 (actin-related protein 10 homolog [Source:NCBI gene;Acc:496410])

HSP 1 Score: 302.368 bits (773), Expect = 1.072e-96
Identity = 165/403 (40.94%), Postives = 243/403 (60.30%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAII------PTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR II      P + K   VV+Y    ++ EE  ++LI FI+ +Y+R LLVNP+DRRVV++ES+L+    RE L  +LFK+FEVPS+LF P HL+SL T+G+ S +VLDCGY E+  +P+YEG  ++  W A  +G   + K LES ++E     + T      KD   PS +  ++ E++EDIKVR C VS + R  K +      D     ++RP+   D  DY L     G   L +   IR+   E LF+ + EE ++AS++LD+++  PID R+ L EN+++IGGT  +PGF  RL+AEI  L +       L  + +K+H PP   N   WLG AIFG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIRSEIRKPGMSKPIKVVQYH---INTEELYSYLIEFIHMLYFRHLLVNPRDRRVVLIESVLSPSHFRETLTRVLFKYFEVPSVLFAPSHLMSLLTLGINSAMVLDCGYAESLVLPIYEGIPILSCWGALPMGGKAIHKELESQLLE-----ECTANTGTAKDQSLPSVMSSISEEIVEDIKVRICFVSDLQRGLKLQAARFNLDGT---AERPIPPPDV-DYPLD----GQKILHVKGSIRDSVAELLFEQDNEEKSVASLILDSLVQCPIDTRKQLAENLVIIGGTAMLPGFLHRLMAEIHYLVEKPKYKETLATKIFKVHTPPAKPNCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Match: actr10 (actin-related protein 10 homolog [Source:NCBI gene;Acc:496410])

HSP 1 Score: 289.656 bits (740), Expect = 9.751e-92
Identity = 162/407 (39.80%), Postives = 237/407 (58.23%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAII------PTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI------LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR II      P + K   VV+Y    ++ EE  ++LI FI+ +Y+R LLVNP+DRRVV++ES+L+    RE L  +LFK+FEVPS+LF P HL+SL T+G+ S +VLDCGY E+  +P+YEG  ++  W A  +G   + K LES ++E     + T      KD   PS +       T      +KVR C VS + R  K +      D     ++RP+   D  DY L     G   L +   IR+   E LF+ + EE ++AS++LD+++  PID R+ L EN+++IGGT  +PGF  RL+AEI  L +       L  + +K+H PP   N   WLG AIFG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIRSEIRKPGMSKPIKVVQYH---INTEELYSYLIEFIHMLYFRHLLVNPRDRRVVLIESVLSPSHFRETLTRVLFKYFEVPSVLFAPSHLMSLLTLGINSAMVLDCGYAESLVLPIYEGIPILSCWGALPMGGKAIHKELESQLLE-----ECTANTGTAKDQSLPSVMSIGCKRYTIFYFSFVKVRICFVSDLQRGLKLQAARFNLDGT---AERPIPPPDV-DYPLD----GQKILHVKGSIRDSVAELLFEQDNEEKSVASLILDSLVQCPIDTRKQLAENLVIIGGTAMLPGFLHRLMAEIHYLVEKPKYKETLATKIFKVHTPPAKPNCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDW 391          
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Match: actr10 (actin-related protein 10 homolog [Source:NCBI gene;Acc:496410])

HSP 1 Score: 275.018 bits (702), Expect = 2.888e-86
Identity = 154/401 (38.40%), Postives = 232/401 (57.86%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAII------PTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR II      P + K   VV+Y    ++ EE  ++LI FI+ +Y+R LLVNP+DRRVV++ES+L+    RE L  +LFK+FEVPS+LF P HL+SL T+G+ S +VLDCGY E+  +P+YEG  ++  W A  +G+  ++K+    +  +                K+  +  T      +KVR C VS + R  K +      D     ++RP+   D  DY L     G   L +   IR+   E LF+ + EE ++AS++LD+++  PID R+ L EN+++IGGT  +PGF  RL+AEI  L +       L  + +K+H PP   N   WLG AIFG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIRSEIRKPGMSKPIKVVQYH---INTEELYSYLIEFIHMLYFRHLLVNPRDRRVVLIESVLSPSHFRETLTRVLFKYFEVPSVLFAPSHLMSLLTLGINSAMVLDCGYAESLVLPIYEGIPILSCWGALPMGA--LKKKYMCWVYTA-------------SSYKSGCKRYTIFYFSFVKVRICFVSDLQRGLKLQAARFNLDGT---AERPIPPPDV-DYPLD----GQKILHVKGSIRDSVAELLFEQDNEEKSVASLILDSLVQCPIDTRKQLAENLVIIGGTAMLPGFLHRLMAEIHYLVEKPKYKETLATKIFKVHTPPAKPNCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDW 375          
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 109.768 bits (273), Expect = 2.044e-25
Identity = 96/408 (23.53%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 108.612 bits (270), Expect = 4.914e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Match: Actr10 (ARP10 actin-related protein 10 [Source:MGI Symbol;Acc:MGI:1891654])

HSP 1 Score: 298.13 bits (762), Expect = 3.846e-95
Identity = 161/400 (40.25%), Postives = 244/400 (61.00%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVVV+ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E       T +    K    PS +  +   VLEDIKVR C VS + R  + +      D +   ++RP    +  DY L     G+  L +   IR+   E LF+ + EE ++A+++LD++L  PID R+ L EN+++IGGT  +PGF  RLLAEIR L +       L  + +++H PP  AN   WLG A+FG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMSKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELETQLLEQC-----TVDTGAAKGQSLPSVMGSVPEGVLEDIKVRTCFVSDLKRGLQIQAAKFNIDGN---NERPTPPPNV-DYPLD----GEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLLQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQDILGSRSISKEYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Match: Actr10 (ARP10 actin-related protein 10 [Source:MGI Symbol;Acc:MGI:1891654])

HSP 1 Score: 132.109 bits (331), Expect = 8.410e-36
Identity = 59/123 (47.97%), Postives = 87/123 (70.73%), Query Frame = 3
Query:  231 VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIE 599
            ++ EE  ++L  FI+ +Y+R LLVNP+DRRVVV+ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E
Sbjct:   12 INTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELETQLLE 134          
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 110.153 bits (274), Expect = 1.012e-25
Identity = 96/408 (23.53%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 108.612 bits (270), Expect = 3.292e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 108.612 bits (270), Expect = 3.292e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Match: sp|Q9NZ32|ARP10_HUMAN (Actin-related protein 10 OS=Homo sapiens OX=9606 GN=ACTR10 PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 9.934e-95
Identity = 164/399 (41.10%), Postives = 245/399 (61.40%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGA-PSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVV++ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E    +D T+  KE + L +    +   VLEDIK R C VS + R  K +      D +   PS  P       DY L     G+  L +   IR+   E LF+ + EE ++A+++LD+++  PID R+ L EN++VIGGT  +PGF  RLLAEIR L +       L  +T+++H PP  AN   WLG AIFG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQ-CTVD-TSVAKE-QSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPP-----NVDYPLD----GEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Match: sp|Q3ZBD2|ARP10_BOVIN (Actin-related protein 10 OS=Bos taurus OX=9913 GN=ACTR10 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.697e-94
Identity = 161/398 (40.45%), Postives = 245/398 (61.56%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVVV+ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E   +   T   KE + L +    +   +LEDIKVR C VS + R    +      D +   ++RP    +  DY L     G+  L +   IR+   E LF+ + EE ++A+++LD+++  PID R+ L EN++VIGGT  +PGF  RLLAEIR L +       L  +T+++H PP  AN   WLG AIFG L D +G RS++++ Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKKAGMPKPIRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTV--DTGAAKE-QSLPSVMGSIPEGILEDIKVRTCFVSDLKRGLNIQAAKFNIDGN---TERPSPPPNV-DYPLD----GEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLMQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLATKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKDYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Match: sp|Q9QZB7|ARP10_MOUSE (Actin-related protein 10 OS=Mus musculus OX=10090 GN=Actr10 PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 2.691e-94
Identity = 161/400 (40.25%), Postives = 244/400 (61.00%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDI---VDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
            MP    + +  +K+AV+ D+GE+ TK GF+GE+ PR IIP+V+K+  + K +  +   ++ EE  ++L  FI+ +Y+R LLVNP+DRRVVV+ES+L     RE L  +LFK+FEVPS+L  P HL++L T+G+ S +VLDCGY+E+  +P+YEG  ++  W A  LG   + K LE+ ++E       T +    K    PS +  +   VLEDIKVR C VS + R  + +      D +   ++RP    +  DY L     G+  L +   IR+   E LF+ + EE ++A+++LD++L  PID R+ L EN+++IGGT  +PGF  RLLAEIR L +       L  + +++H PP  AN   WLG A+FG L D +G RS+++E Y + G++PDW
Sbjct:    1 MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMSKPIKVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELETQLLEQC-----TVDTGAAKGQSLPSVMGSVPEGVLEDIKVRTCFVSDLKRGLQIQAAKFNIDGN---NERPTPPPNV-DYPLD----GEKILHVLGSIRDSVVEILFEQDNEEKSVATLILDSLLQCPIDTRKQLAENLVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQDILGSRSISKEYYNQTGRIPDW 387          
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Match: sp|Q9Y896|ACT2_SCHCO (Actin-2 OS=Schizophyllum commune OX=5334 GN=ACT2 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.894e-30
Identity = 111/403 (27.54%), Postives = 172/403 (42.68%), Query Frame = 3
Query:  108 AVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            AV+ D G  + K GF+G+ +PRA+ P++V   +   V+  L++    + D  + K  +++  Y I                  YY +L V P++  V++ E+ LN    RE +  I+F+ F VP+   +   ++SL+  G  +GIVLD G     T+P+YEGF L    Q   L    + +RL   + E G     + E               +EV+ DIK R C V     A  + Q L+T     A            +Y L   P G I        R  A E  F   F   E   +A +V  +I    +D RR L  NI++ GGT   PG   R+  E+  ++  N +         K+  PP    Y+ W+G +I   L T      +++ Y E G
Sbjct:    7 AVVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGVMVGLSNKDSYVGDEAQAKRGVLTLKYPIEHGTVTNWDDMEKIWHHTYYNELRVAPEEHPVLLTEAPLNPKTNREKMTQIMFETFNVPAFHVSIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGFSLPHAIQRLDLAGRDLTERLVLHLTERGYTFTTSAE---------------KEVVRDIKERLCYV-----ALDFDQELITAAQSSALEK---------NYEL---PDGQIITIGNERFR--APEVFFQPSFAGMESGGIADLVYTSIQRCDLDIRRELYGNIVMSGGTTMFPGISDRMQRELSNMAPANMK--------VKIVAPP-ERKYSVWIGGSILASLSTFQNMWCSKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Match: sp|Q8SWN8|ACT_ENCCU (Actin OS=Encephalitozoon cuniculi (strain GB-M1) OX=284813 GN=ECU01_0460 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 3.205e-27
Identity = 103/403 (25.56%), Postives = 172/403 (42.68%), Query Frame = 3
Query:  108 AVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASI---VLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            A++ DIG  + K GF+G+ +PRA+ P++V   K   V+  +      + D  + K  ++   Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F VPS   +   ++SL+  G  +GIV D G   +  +P+YEG+ L        L    +   L+ ++ ESG     T E               RE++ DIK + C VS            L  + D   ++    +  T++      P G + + +  E R  A E LF  +     L  I   + D+I+   +D R+ L  NI++ GGT   PG   R+L EI+ L+    +   +          P    Y+ W+G +I   L T     +++  Y E G
Sbjct:    7 ALVIDIGSGVVKSGFAGDDAPRAVFPSIVGFPKHKGVMVGMGQKDAYVGDEAQTKRGILHIKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKITQIMFETFNVPSFYISIQAVLSLYASGRTTGIVFDSGDGVSHVVPIYEGYSLPYAINRIDLAGRDLTDYLQLILTESGNSFTTTAE---------------REIVRDIKEKLCYVS------------LNYEEDMRNTEHLASITKTYE-----MPDGQV-ISIGNE-RFRAPELLFQPKLRGLELKGIHQNIYDSIMKCDVDIRKELYGNIVLSGGTTMYPGLAERILNEIKALAPPVIKIGVVA---------PPERKYSVWIGGSILASLSTFQQMWVSKAEYQEHG 366          
BLAST of Actin-related protein 10-like vs. TrEMBL
Match: G4V8Q5 (Actin-related protein 10, arp10 OS=Schistosoma mansoni OX=6183 GN=Smp_093230 PE=3 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.238e-113
Identity = 183/399 (45.86%), Postives = 261/399 (65.41%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVD-PEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIE----IRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQ--QETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQK 1268
            + +K+AV+FDIG   TK GF+GE+ PR IIPT +      K      D  ++++ FL +F+Y IYYR LLVNPKDRRVVVVES+L     RE+LA++ F HFE PS+LF   HL++LFT+G+ S +VLDCGY +A  +PVYEG+ L+  WQ+AQLGS ++ + + S + E+  L+D  N   ++     P   ++  ++EDIKVR C VSP +RA +W+ W   KDS  + + +P L Q+TF +     PL  +  + PI+    IRELA ECLF  + ++ TL +++L +IL APID RR L ENI++IGGT  +PGF SRL+ E+  L +    +S+LQ  + ++K H+PP  ANY GWLG AIFG L+ +  RSL+R +++E G VPDW    +QK
Sbjct:    9 LGEKTAVVFDIGSVYTKCGFAGETGPRFIIPTEITLPTGEKRSISSCDGKDKRREFLTTFLYNIYYRHLLVNPKDRRVVVVESVLCPSSFREVLADVFFNHFEAPSVLFATSHLMALFTLGISSAVVLDCGYMDAQVLPVYEGYTLLNAWQSAQLGSKKIHENIRSYLNENAKLVDVINGESQLTPC--PDCFISEHIIEDIKVRTCFVSPHNRAVQWKAW---KDSAESSAAKPNLYQETFIF-----PLDKLGNERPIQVTSDIRELAVECLFAGDNDQITLTTLILRSILLAPIDIRRKLAENIVLIGGTTMLPGFVSRLMEELNSLVEL-PEFSKLQALKGSFKFHNPPGEANYIGWLGGAIFGALECLPGRSLSRSSFLENGLVPDWCTQIDQK 396          
BLAST of Actin-related protein 10-like vs. TrEMBL
Match: A0A183RC52 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.553e-113
Identity = 182/399 (45.61%), Postives = 262/399 (65.66%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPT-VVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIE----IRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQ--QETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQK 1268
            + +K+AV+FDIG   TK GF+GE+ PR IIPT +       + ++     ++++ FL +F+Y IYYR LLVNPKDRRVVVVES+L     RE+LA++LF HFE PS+LF   HL++LFT+G+ S +VLDCGY +   +PVYEG+ L+  WQ+AQLGS ++ K + S + E+  L+D  N   ++     P   ++  ++EDIKVR C VSP +RA +W+ W   KDS  + + +P L Q+TF +     PL  +  + PI+    IRELA ECLF  + ++ TL +++L +IL APID RR L ENI++IGGT  +PGF SRL+ E+  L +    +S+LQ  + ++K H+PP  ANY GWLG AIFG L+ +  RSL+R +++E G VPDW    +QK
Sbjct:    9 LGEKTAVVFDIGSVYTKCGFAGETGPRFIIPTEITLLTGEKRNISSCDGKDKRREFLTTFLYNIYYRHLLVNPKDRRVVVVESVLCPSSFREVLADVLFNHFEAPSVLFATSHLMALFTLGISSAVVLDCGYTDVQVLPVYEGYTLLNAWQSAQLGSKKIHKNIRSYLNENAKLVDVINGESQLTPC--PDCFISEHIIEDIKVRTCFVSPHNRAVQWKAW---KDSAESSAAKPNLYQETFIF-----PLDKLGNERPIQVTSDIRELAVECLFTGDNDQITLTTLILRSILLAPIDIRRKLAENIVLIGGTTMLPGFVSRLMEELNSLVEL-PEFSKLQALKGSFKFHNPPGEANYIGWLGGAIFGALECLPGRSLSRSSFLENGLVPDWCTQIDQK 396          
BLAST of Actin-related protein 10-like vs. TrEMBL
Match: A0A4S2M0J3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003716 PE=3 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 7.754e-113
Identity = 176/392 (44.90%), Postives = 256/392 (65.31%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDN-VVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTK-DSDGAPS-DRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQ--QETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTD 1253
            + +K+AV+FDIG   TK GF+GE+ PR I PT + Q N  VK+   +   +E++ FL  F++++YYR LLVNPKDRRVVVVESIL + + RE+LA++L+ HFE+PS LF P HLV+LFT+GL SG+VLDCGYKEA  +PV EG+ L+  WQAAQLGS  V   ++S++    +L++   +   + +  +   +LTREVLED+  R C VSP  RA++W +W   + ++ G      P + +  F Y L++  +    L++P  +REL  ECLF  + +  TLAS++L +++  P+D RR L  NI++IGGT  IPGF +RLL E+    + +  +S L+  + T+++H PP   NY  WLG AIFG L+ +  RSL R  Y+EK  +PDWT 
Sbjct:    9 LGEKTAVVFDIGSVYTKCGFAGETGPRFIFPTEITQPNGQVKHFLSLRTAKEKRKFLTIFLHQLYYRHLLVNPKDRRVVVVESILCTTEFRELLADVLYNHFEIPSALFAPAHLVTLFTLGLSSGLVLDCGYKEAVVVPVSEGYTLLNAWQAAQLGSRAVYANMKSLLHRDALLVEEHGQTCALAEQPDTETMLTREVLEDLVARTCFVSPSQRAEEWDKWSSAQLNTTGVDKMAEPKVAEKHFVYPLNNLQVNKR-LQVPSRLRELGVECLFRGDNDRITLASLLLKSLVTCPVDIRRTLATNIILIGGTINIPGFAARLLEELDSFLELDE-FSNLRALKGTFRIHQPPAEPNYVAWLGGAIFGALECLPGRSLERSVYLEKKTLPDWTS 398          
BLAST of Actin-related protein 10-like vs. TrEMBL
Match: A0A1S8WZV3 (Actin OS=Opisthorchis viverrini OX=6198 GN=X801_04123 PE=3 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 1.522e-112
Identity = 182/400 (45.50%), Postives = 257/400 (64.25%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDN-VVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEV-------PSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQW----LLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQ--QETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWT 1250
            + +K+AV+FDIG   TK GF+GE+ PR I PT + Q N  VK+   +   +E++ FL  F++++YYR LLVNPKDRRVVVVESIL + + RE+LA++L+ HFEV       PS LF P HLV+LFT+GL SG+VLDCGYKEA  +PV EG+ L+  WQAAQLGS  V   ++S++    +L++   +   + +  +   +LTREVLED+  R C VSP  RA++W +W    L T D D      P + ++ F Y L++  +    L++P  +RELA ECLF  + +  TLAS++L + +  P+D RR L  NI++IGGT  IPGF SRLL E+    + +  +S L+  + T+++H PP   NY  WLG AIFG L+ +  RSL R  Y+EK  +PDWT
Sbjct:    9 LGEKTAVVFDIGSVYTKCGFAGETGPRFIFPTEITQPNGQVKHFLSLKTAKEKRKFLTVFLHQLYYRHLLVNPKDRRVVVVESILCTTEFRELLADVLYNHFEVTAFYRAIPSALFAPAHLVTLFTLGLSSGLVLDCGYKEAVVVPVSEGYTLLNAWQAAQLGSETVYANMKSLLHRDALLVEEHGQTCALAEQPDTETMLTREVLEDLVARTCFVSPSQRAEQWDRWSSAQLNTTDDDEVA--EPKVAEEHFVYPLNNLQVNKR-LQVPSRLRELAVECLFRGDNDRITLASLLLKSFITCPVDIRRTLAANIILIGGTVNIPGFASRLLEELDSFLEWDE-FSNLRALKGTFRIHQPPAEPNYVAWLGGAIFGALECLPGRSLERSVYLEKKTLPDWT 404          
BLAST of Actin-related protein 10-like vs. TrEMBL
Match: A0A430QDA8 (Actin-related protein 10 OS=Schistosoma bovis OX=6184 GN=DC041_0009167 PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 4.002e-112
Identity = 181/399 (45.36%), Postives = 260/399 (65.16%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVD-PEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIE----IRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQ--QETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQK 1268
            + +K+AV+FDIG   TK GF+GE+ PR I+PT +      K      D  ++++ FL +F+Y IYYR LLVNPKDRRVVVVES+L     RE+LA++LF HFE PS+LF   HL++LFT+G+ S +VLDCGY +A  +PVYEG+ L+  WQ+AQLGS ++ + +   + E+  L+D  N   ++     P   ++  ++EDIKVR C VSP +RA +W+ W   KDS  +   +P L Q+TF +     PL  +  + PI+    IRELA ECLF  + ++ T+ +++L +IL APID RR L ENI++IGGT  +PGF SRL+ E+  L +    +S+LQ  + ++K H+PP  ANY GWLG AIFG L+ +  RSL+R +++E G VPDW    +QK
Sbjct:    9 LGEKTAVVFDIGSVYTKCGFAGETGPRFIMPTEITLPTGEKRSISSCDGKDKRREFLTTFLYNIYYRHLLVNPKDRRVVVVESVLCPSSFREVLADVLFNHFEAPSVLFATSHLMALFTLGISSAVVLDCGYMDAQVLPVYEGYTLLNAWQSAQLGSKRIHENIRGYLNENAKLVDVINGESQLTPC--PDCFISEHIVEDIKVRTCFVSPHNRAVQWKAW---KDSAESSVTKPNLYQETFIF-----PLDKLGNERPIQVASDIRELAVECLFAGDNDQITITTLILRSILLAPIDIRRKLAENIVLIGGTTMLPGFVSRLMEELNSLVEL-PEFSKLQALKGSFKFHNPPGEANYIGWLGGAIFGALECLPGRSLSRSSFLENGLVPDWCTQIDQK 396          
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Match: actr10 (actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-040426-768])

HSP 1 Score: 277.715 bits (709), Expect = 3.175e-87
Identity = 148/369 (40.11%), Postives = 222/369 (60.16%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNV---VKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGA 1163
            MP    + +  +K+AV+ D+G + TK GF+GE+ PR IIP+ +++  V   +K +   ++ EE    L  FI+ +Y+R LLVNP+DRRVV++ESIL     RE L+ + FKHFEVPS+LF P HL+S+ T+G+ S +V+DCGY E   +PVYEG  ++  W+A  +G   + K L+S++ E   +   +     +     P+ I++ EV+EDIKVR C VS + R  K ++     D     ++RP    D  DY L     G+  L +   IR+   E LF+ + EE ++A+++LD ++  PID R+VL EN+LVIGGT  +PGF  RLLAEIR L +       L  +++++H PP   N T WLGA
Sbjct:    1 MPLFEVLGSGGEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIQRPGVQQPIKVVQYNINTEELYTNLKEFIHMLYFRHLLVNPRDRRVVIIESILCPSHFRETLSKVFFKHFEVPSVLFAPSHLMSIMTLGINSALVMDCGYTETLVLPVYEGIPILSAWEALPMGGKAIHKELDSLLTEQCTVDTDSGTGHSL-----PTVIVSEEVVEDIKVRTCFVSDLQRGLKIQEAKFNMDGT---AERPAPPPDV-DYPLD----GEKILHIKGSIRDSIAEMLFEQDNEEKSIATLILDTLVKCPIDTRKVLSENLLVIGGTSMLPGFLHRLLAEIRLLVEKPKYCDALATKSFRLHSPPAKPNCTAWLGA 356          
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Match: actc1c (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103039206])

HSP 1 Score: 109.383 bits (272), Expect = 1.374e-25
Identity = 98/407 (24.08%), Postives = 170/407 (41.77%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            + +A++ D G  L K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F VP++      ++SL+  G  +GIVLD G      +PVYEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+            L  +++ A +     ++ +++  +     +G+   + P        E LF   F   E   +     + I+   ID R+ L  N ++ GGT   PG   R+  EI  L+    +         KM  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 ETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAE---------------REIVRDIKEKLCYVA------------LDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCP--------ETLFQPSFIGMESAGIHETTYNGIMKCDIDIRKDLYANNVLSGGTTMYPGIGDRMQKEITALAPSTMK--------IKMIAPP-ERKYSVWIGGSILASLSTFQQMWISKDEYEEAG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 107.842 bits (268), Expect = 4.636e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    8 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMGTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 107.842 bits (268), Expect = 5.144e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMGTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 107.842 bits (268), Expect = 5.291e-25
Identity = 95/405 (23.46%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMGTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Match: actr10 (actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-040426-768])

HSP 1 Score: 280.026 bits (715), Expect = 4.773e-89
Identity = 158/389 (40.62%), Postives = 228/389 (58.61%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNV---VKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPL-GDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDW 1247
             +K+AV+FD G + TK GF+GE  PR I+P+ VK       VK +   V+ +E    L  FI+ +Y+R LLVNP+DRRVVVVES+L     RE +A + FKHFEVPS+LF P HL+++ T+G+ + +V+DCGY E   +PV EG  ++  W+A  LG     K L   +++   L          K  ++PS +L  +VLEDIKVR C VS + R    +      +   A + RP    D       S PL G+  L +  EIR+   E LF  + EE ++A+++LD ++  P+D R  L +N++V+GGT ++PGF  RLLAEI++L Q     + L   +  +H PP   NY  WLG AIFG L + +G RS++RE Y + GK+PDW
Sbjct:   11 GEKTAVVFDFGAAFTKCGFAGEPGPRCILPSEVKGPGTSTPVKVVQYHVNTDELYQNLKDFIHMLYFRHLLVNPRDRRVVVVESMLCPTYFREAVARVFFKHFEVPSVLFAPSHLMAVLTLGINTALVMDCGYNETLVLPVCEGIPVVSAWEAMPLGG----KALHRNVLKGWSLQRAEVHAAGRKPSQSPS-LLPEDVLEDIKVRTCFVSDLLRGQNLQAARFPTE---ASAKRPTPPPDV------SYPLDGENILIVKGEIRDSLCEILFVQDNEEKSVATLMLDCLVKCPMDLRTTLAKNLVVMGGTAQLPGFTHRLLAEIKQLLQQPKYQAVLSVTSVCVHTPPAKPNYVAWLGGAIFGALQEVLGSRSVSRELYGQTGKIPDW 385          
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 3.166e-26
Identity = 95/405 (23.46%), Postives = 171/405 (42.22%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    7 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 6.303e-26
Identity = 94/405 (23.21%), Postives = 170/405 (41.98%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVVKQD-------NVVKYLTDIVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V           + +  + + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    7 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMATAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 1.977e-21
Identity = 99/415 (23.86%), Postives = 165/415 (39.76%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV----KQDNVV------------KYLTDIVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSE---FEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            D  AV+ D G  L K GF+GE++PR  +P++V    ++D ++                 I      +  ++S  Y +                  Y  +L   P+D+ V++ E+ LN ++ RE  A +LF+ F  P++      ++SL+  G+ +G+ +  G      +PV+EG+ L R    + +    V   L  ++ E G     + E                E++ DIK + C V     A  + + L  K  + A            DY L   P G +        R  A E LF       +   +  +V  ++  + ID R+ L  NIL+ GG+   PG   RL  E+ KL+              ++  PP    Y+ W+G +I   L T     +T   Y E G
Sbjct:    6 DNPAVVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEW---------------EIVADIKEQVCYV-----AGDYEKELRRKPEELA-----------VDYKL---PDGQVITLHSQRFR--APELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRG--------APVRIFAPP-ERKYSVWIGGSILASLSTFQQMWITAPEYKEFG 375          
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Match: actl6a (actin-like 6A [Source:ZFIN;Acc:ZDB-GENE-020419-36])

HSP 1 Score: 61.6178 bits (148), Expect = 6.498e-11
Identity = 47/217 (21.66%), Postives = 91/217 (41.94%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV-----KQD---------------------------------NVVKYLTDIVDPEEQKNFLI-------SFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHL----IRNWQAAQLGSYQVEKRLESMIIE 599
            ++  A++FD+G    + GF+GE  P+A  PT +     ++D                                 +V +   ++  P   KN +I       + +   Y R +   P    V++ E+  N+  +RE L  ++F+H+ +P+       +++ F  G  + +VLD G    T IPV++G+ L    +++  A    + Q  +  + M IE
Sbjct:    9 DEVGALVFDLGSYSVRTGFAGEDCPKADFPTALGMMLEREDGTTPMDVDGLERVGMESGHVGARRSYHIGVNALHVAREGMEVTSP--LKNGMIEDWDCFQAILDHTYKRNIKSEPDLHPVLMSEAPWNARGKRERLTELMFEHYNIPAFFLCKSAVLTAFANGRSTALVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCREMFQEMNIE 223          
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 106.686 bits (265), Expect = 1.510e-25
Identity = 96/404 (23.76%), Postives = 164/404 (40.59%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTD-------IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSE---FEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +A++ D G  + K GF+G+ +PRA+ P++V +      +         + D  + K  +++  Y I                  +Y +L V P++  V++ E+ +N    RE +  I+F+ F VP+   +   ++SL++ G  +GIVLD G      +P+Y GF L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T              Q +     +  P G +        R  A E LF       E   +     ++I+   +D R+ L  NI++ GGT   PG   R+  EI  L+  + +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    6 AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMQTA------------AQSSSIEKSYELPDGQVITIGNERFR--APEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMK--------VKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 89.3521 bits (220), Expect = 9.935e-20
Identity = 89/397 (22.42%), Postives = 170/397 (42.82%), Query Frame = 3
Query:  111 VIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYL-------TDIVDPEEQKNFLISFIYEIYYRKL-------------------LVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIES-GILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLP----IEI---RELATECLFDSE---FEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTI 1190
            V+ D G  + K GFSGE  P+A+   +V      K +       T I +  ++   L+   Y I +  +                   L N  +  +++ E+ +N ++ RE +A +LF+ F+V ++  +   ++SL+  G  +G V+DCG    +T+P+Y+GF L  +     +G   + ++L+  + +S G+ +  ++E               RE++  +K + C ++   + ++ +    T+D                   L ST       KLP    IE+   R  A E LF  +        L+ + + +I    +D R+ L  +I++ GGT  + GF  R+L ++  L++  ++   +          P    YT W+G +I   L T 
Sbjct:   15 VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSE---------------REIVRTMKEKVCYLAKNIKKEEEKYLQGTQD-------------------LIST------FKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKII---------APSERKYTTWIGGSILTGLSTF 362          
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 81.6481 bits (200), Expect = 4.343e-17
Identity = 96/425 (22.59%), Postives = 180/425 (42.35%), Query Frame = 3
Query:   93 INDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV--------KQDNVVKYLTDIV---DPEEQKNFL-ISFI-----------------YEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGF---HLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVS-PIDRADKW-RQWLLTKDSDGAPSDRPVLV-QDTFDYNLHSTPLGDICLKLPIEIRELATECLFDS---EFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKL----SQHNNRYSRLQQETYKMHDPPCYANYT---GWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            ++  + ++ D G    K+G +GE+ P    P++V        ++ +V   L DI+   +  E +++L IS+                  Y  + +  L +  + ++++ E  +N ++ RE +  ++F+ ++   +      +++L+  GL SG+V+D G      +PVYE     HL R    A      V + L  ++   G   +RT +                E +  IK + C VS  +D   K  R+     +S   P  R + V Q+ F+                      A ECLF     + E+  +  ++ + +  A +D R  L + I++ GG+   PG  SRL  E+++L      HN+  SRL +   ++ DPP   +     G + A+I  D D +    L+++ + E G
Sbjct:    1 MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVA---GRDVTRHLIDLLSRRGYAFNRTADF---------------ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFE----------------------APECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP-SRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMW---LSKQEWQESG 381          
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Match: ARP10 (Component of the dynactin complex; localized to the pointed end of the Arp1p filament; may regulate membrane association of the complex [Source:SGD;Acc:S000002513])

HSP 1 Score: 53.9138 bits (128), Expect = 2.008e-8
Identity = 38/160 (23.75%), Postives = 79/160 (49.38%), Query Frame = 3
Query:  105 SAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKL-LVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRL 581
            + VI  +G +  ++G S ++ P+ II       N            E+    +  I+E Y++   ++  ++ +V+++E I  S+  + I+ +ILFK F+   + F P  +V   +   ++ IV+D G    T +P+++   L +  + ++ G  QVE R+
Sbjct:    4 TIVIVYLGANRIEIGRSADACPQEIIAWKTGSIN------------EKNREELKKIFEHYFQICNILGNREVQVLILEDIFISVVEKRIICSILFKEFDCAHVSFVPRAIVHCLSCNTRNAIVIDIGTNYTTCVPIFDLRPLQQFIKYSKRGKRQVESRI 151          
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 47.7506 bits (112), Expect = 3.656e-6
Identity = 29/102 (28.43%), Postives = 48/102 (47.06%), Query Frame = 3
Query:  927 LASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            LA +V  +I+ + +D R  L  N+++ GGT  IPG   RL+ E+ K+    +   R+    + +        Y  WLG +I   L T     + ++ Y E G
Sbjct:  385 LADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILP--SLKFRILTTGHTIE-----RQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Match: EDO40166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S805])

HSP 1 Score: 277.715 bits (709), Expect = 2.218e-88
Identity = 161/388 (41.49%), Postives = 227/388 (58.51%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPT---VVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWT 1250
             +K AVI DIG + TK+GF+ E++PR IIP+    +++D  V ++ +   P+E  + L  FI+ IY+R LLVNPK+RRVV+ ESIL   Q RE+LA +LF+HFEV S+ F P HL+SLF++G+ SG+V+DCGYK      +YEG  +++      L    + + LE  ++E  ++   T     +K L +    L  E+LEDIKV  C V+P             K S      RP  +    DY L     G   L++  +IRE   + LFD + EE +LA+ +LD++L  PID R+ L ENI++IGGT   PGF+ RL+ EI  L Q      +L  +T KMH PP  AN T WLG AIFG L+ +  RS TRE Y +  K+PDW+
Sbjct:   11 GEKHAVIIDIGAAYTKVGFAKETAPRHIIPSRIFHIREDVSVFHIKN-RKPDELYSILRDFIHLIYFRYLLVNPKERRVVICESILCPTQFREVLAKVLFRHFEVLSVSFAPSHLLSLFSLGIPSGLVMDCGYKHH----IYEGTAILKATTGIPLAGKALHRHLEEQLMERSLVQIETG----VKPLSSVMGSLEEEILEDIKVLTCFVAP-------------KFSGPQNEARPASLVPQVDYPLD----GGRILRIEGQIREQTFDILFDGDEEEKSLATALLDSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQPPVNANITAWLGGAIFGSLEVLADRSTTRERYQQHPKLPDWS 372          
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 109.768 bits (273), Expect = 3.907e-26
Identity = 95/405 (23.46%), Postives = 175/405 (43.21%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P  + + +   +  S   ETT      ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMQTAASSSS-------IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETT-----YNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 107.457 bits (267), Expect = 2.321e-25
Identity = 94/408 (23.04%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E +F   F   E   +     ++I+   +D R+ L  N ++ GG+   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    4 DDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMTTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 106.686 bits (265), Expect = 4.903e-25
Identity = 94/408 (23.04%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E +F   F   E   +     ++I+   +D R+ L  N ++ GG+   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMETAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Match: EDO36117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK6])

HSP 1 Score: 105.916 bits (263), Expect = 7.616e-25
Identity = 93/407 (22.85%), Postives = 170/407 (41.77%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  ++S  Y I                  +Y +L V P++   ++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +G+V D G   +  +P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V+     D +++  +  +S       P+L +     +     +G+   + P        E +F   F   E   +   + + I+   +D R+ L  N ++ GG+   PG   R+  EI  L+  + +         K+  PP    Y+ W+G +I   L T     + +E Y E G
Sbjct:    5 DDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILSLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPSLLTEAPLNPKGNREKMTQIMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVPIYEGYALPHAILRLDLAGRDLTDYLMKLMTERGYSFTTTAE---------------REIVRDIKEKLCYVA----LDFYQEMDIDANS-------PILEKTYELPDGQVISIGNERFRCP--------EAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGSTMFPGIADRMQKEIAMLANASMK--------VKVIAPP-ERKYSVWIGGSILASLSTFQQMWIAKEEYQEYG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Match: actr10 (actin related protein 10 [Source:NCBI gene;Acc:101161062])

HSP 1 Score: 297.745 bits (761), Expect = 3.377e-95
Identity = 165/410 (40.24%), Postives = 241/410 (58.78%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVK---QDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEI--LTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDWTDTTEQKSRS 1277
            MP    + +  +K+AV+ D+G + TK GF+GE+ PR IIP+ ++   Q   VK +   ++ EE    L  FI+ +Y+R LLVNP+DRRVV++ESIL     RE L  + FK FEVPS+L+ P HLV++ T+G+ S +VLDCGY E   +PVYE   ++  W+A  LG   +   L  ++ E    +D  +  K+      P+ I  L+ +++EDIKVR C VS + R  K +      D     ++RP    D  DY L     G+  L +   +R+   E LF+ + EE ++AS++LDA++  PID R+VLCEN++VIGGT  +PGF  RLLAEIR L +     S L   ++++H PP   N T WLG AIFG L D +G RS++R+ Y + G++PDW   T     S
Sbjct:    1 MPLFDGLGSGGEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIQKPGQQQTVKVVQYNINTEELYAILKEFIHTLYFRHLLVNPRDRRVVIIESILCPSHFRETLTKVFFKQFEVPSVLYAPSHLVAIMTLGINSALVLDCGYTETLVLPVYECTPILSAWEALPLGGKAIHSELNRLVAEQ-CTVDADSSTKQ----SVPAVIGTLSEKIVEDIKVRTCFVSDLQRGLKMQAAKFNLDGT---AERPTPPPDV-DYPLD----GEKILHINGSVRDSVMEILFEQDNEEKSVASLILDALVKCPIDTRKVLCENLVVIGGTSMLPGFLHRLLAEIRLLMEKPKYSSVLVNRSFQIHVPPSKPNCTAWLGGAIFGALQDILGSRSVSRDHYNQTGRIPDWCSLTSSPPES 397          
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Match: actr10 (actin related protein 10 [Source:NCBI gene;Acc:101161062])

HSP 1 Score: 283.878 bits (725), Expect = 1.078e-89
Identity = 163/416 (39.18%), Postives = 237/416 (56.97%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVK---QDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKE-----IKDLKNPSEILTREVLEDIKV---RACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDL-DTIGVRSLTRETYIEKGKVPDWTDTTEQKSRS 1277
            MP    + +  +K+AV+ D+G + TK GF+GE+ PR IIP+ ++   Q   VK +   ++ EE    L  FI+ +Y+R LLVNP+DRRVV++ESIL     RE L  + FK FEVPS+L+ P HLV++ T+G+ S +VLDCGY E   +PVYE   ++  W+A  LG   +   L  ++ E    +D  +  K+     I +L  P        L+ IK+   R C VS + R  K +      D     ++RP    D  DY L     G+  L +   +R+   E LF+ + EE ++AS++LDA++  PID R+VLCEN++VIGGT  +PGF  RLLAEIR L +     S L   ++++H PP   N T WLG AIFG L D +G RS++R+ Y + G++PDW   T     S
Sbjct:    1 MPLFDGLGSGGEKTAVVIDLGAAYTKCGFAGETGPRFIIPSEIQKPGQQQTVKVVQYNINTEELYAILKEFIHTLYFRHLLVNPRDRRVVIIESILCPSHFRETLTKVFFKQFEVPSVLYAPSHLVAIMTLGINSALVLDCGYTETLVLPVYECTPILSAWEALPLGGKAIHSELNRLVAEQ-CTVDADSSTKQSVPAVIGNLCIP--------LDQIKLDSFRTCFVSDLQRGLKMQAAKFNLDGT---AERPTPPPDV-DYPLD----GEKILHINGSVRDSVMEILFEQDNEEKSVASLILDALVKCPIDTRKVLCENLVVIGGTSMLPGFLHRLLAEIRLLMEKPKYSSVLVNRSFQIHVPPSKPNCTAWLGGAIFGALQDILGSRSVSRDHYNQTGRIPDWCSLTSSPPES 399          
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 110.538 bits (275), Expect = 6.293e-26
Identity = 97/408 (23.77%), Postives = 173/408 (42.40%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D SA++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G   + T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMQTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 107.842 bits (268), Expect = 4.313e-25
Identity = 95/408 (23.28%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L + P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    5 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMGTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 368          
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 107.842 bits (268), Expect = 5.564e-25
Identity = 95/408 (23.28%), Postives = 172/408 (42.16%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            +D +A++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L + P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIV+D G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GGT   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    3 DDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMGTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK--------IKIIAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Match: SMESG000009976.1 (SMESG000009976.1)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 403/404 (99.75%), Postives = 404/404 (100.00%), Query Frame = 3
Query:   66 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQKSRS 1277
            MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTN+MKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQKSRS
Sbjct:    1 MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVKYLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNKMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQKSRS 404          
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Match: SMESG000063528.1 (SMESG000063528.1)

HSP 1 Score: 113.62 bits (283), Expect = 4.147e-27
Identity = 99/407 (24.32%), Postives = 174/407 (42.75%), Query Frame = 3
Query:   96 NDKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDYNLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            ND  AV+ D G  + K GF+G+ +PR++ P+++   K   V+  +      I +  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F+ P++      ++SL+  G  +GIV+D G   + T+P+Y+G+ L+       L    +   L  ++ E G     T E               RE++ DIK + C VS            +  D +   S RP+   +   Y L    +    +K+  E R    E LF   F   E   +  I  ++I+   +D R+    NI++ GG+   PG   R+  EI  L+    +   +     K         ++ W+G +I G L T+    +T++ Y E G
Sbjct:    3 NDIPAVVIDNGSGMLKAGFAGDDTPRSVFPSIIGKPKHQGVMIGMGQKESYIGNEAQSKRGILTLKYPIEHGIVTNWEDMVKLWQHTFYNELRVTPEEHAVLLTEAPLNPKGNREKMTEIMFEMFKCPAMYVAIQAVLSLYASGRTTGIVMDSGEGVSHTVPIYDGYALLHGICRMDLAGRDLTDYLTKILTERGYSFSTTAE---------------REIVRDIKEKLCYVS------------MNFDKEINLS-RPISAIEK-SYELPDKQI----IKIGTE-RFRCPEALFQPAFCGLETLGIHEITFNSIMTCNVDIRKDFYSNIVLSGGSTMFPGISDRIHKEISALAPSTVKVKIIALPERK---------HSVWIGGSILGSLSTVQQMWITKQEYNESG 366          
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Match: SMESG000066020.1 (SMESG000066020.1)

HSP 1 Score: 110.923 bits (276), Expect = 3.689e-26
Identity = 97/407 (23.83%), Postives = 171/407 (42.01%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            D SA++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GG+   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    5 DVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMSTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------EALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMK--------IKIVAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 110.538 bits (275), Expect = 4.853e-26
Identity = 97/407 (23.83%), Postives = 171/407 (42.01%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            D SA++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GG+   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    5 DISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMSTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------ESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMK--------IKIVAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Match: SMESG000057992.1 (SMESG000057992.1)

HSP 1 Score: 110.538 bits (275), Expect = 4.853e-26
Identity = 97/407 (23.83%), Postives = 171/407 (42.01%), Query Frame = 3
Query:   99 DKSAVIFDIGESLTKLGFSGESSPRAIIPTVV---KQDNVVKYLTD----IVDPEEQKNFLISFIYEI------------------YYRKLLVNPKDRRVVVVESILNSIQRREILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYEGFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSEILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTFDY-NLHSTPLGDICLKLPIEIRELATECLFDSEF---EETTLASIVLDAILGAPIDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYKMHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKG 1232
            D SA++ D G  + K GF+G+ +PRA+ P++V   +   V+  +      + D  + K  +++  Y I                  +Y +L V P++  V++ E+ LN    RE +  I+F+ F  P++      ++SL+  G  +GIVLD G     T+P+YEG+ L        L    +   L  ++ E G     T E               RE++ DIK + C V     A  + Q + T  S  +       ++ +++  +     +G+   + P        E LF   F   E   +     ++I+   +D R+ L  N ++ GG+   PG   R+  EI  L+    +         K+  PP    Y+ W+G +I   L T     ++++ Y E G
Sbjct:    5 DISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE---------------REIVRDIKEKLCYV-----ALDFEQEMSTAASSSS-------LEKSYELPDGQVITIGNERFRCP--------ESLFQPAFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMK--------IKIVAPP-ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
The following BLAST results are available for this feature:
BLAST of Actin-related protein 10-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTR102.069e-9541.10actin related protein 10 [Source:HGNC Symbol;Acc:H... [more]
ACTR105.135e-5938.83actin related protein 10 [Source:HGNC Symbol;Acc:H... [more]
ACTR101.370e-4145.70actin related protein 10 [Source:HGNC Symbol;Acc:H... [more]
ACTR109.315e-4146.00actin related protein 10 [Source:HGNC Symbol;Acc:H... [more]
ACTB1.474e-2523.53actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arp-111.411e-3126.29Actin-Related Proteins [Source:UniProtKB/TrEMBL;A... [more]
act-23.518e-2624.02Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-23.518e-2624.02Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-23.518e-2624.02Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-42.238e-2523.53Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arp102.142e-7233.33gene:FBgn0031050 transcript:FBtr0345991[more]
Arp102.142e-7233.33gene:FBgn0031050 transcript:FBtr0074760[more]
Act88F2.414e-2623.77gene:FBgn0000047 transcript:FBtr0083143[more]
Act57B2.782e-2623.77gene:FBgn0000044 transcript:FBtr0071519[more]
Act87E4.299e-2623.53gene:FBgn0000046 transcript:FBtr0346242[more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr106.779e-9741.25actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE... [more]
actr102.138e-3840.89actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE... [more]
actc1a1.532e-2524.08actin alpha cardiac muscle 1a [Source:ZFIN;Acc:ZDB... [more]
actc1a1.622e-2524.08actin alpha cardiac muscle 1a [Source:ZFIN;Acc:ZDB... [more]
actc1c1.622e-2524.08actin alpha cardiac muscle 1c [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr101.072e-9640.94actin-related protein 10 homolog [Source:NCBI gene... [more]
actr109.751e-9239.80actin-related protein 10 homolog [Source:NCBI gene... [more]
actr102.888e-8638.40actin-related protein 10 homolog [Source:NCBI gene... [more]
actb2.044e-2523.53actin, beta [Source:NCBI gene;Acc:407952][more]
actg14.914e-2523.46actin gamma 1 [Source:NCBI gene;Acc:394957][more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actr103.846e-9540.25ARP10 actin-related protein 10 [Source:MGI Symbol;... [more]
Actr108.410e-3647.97ARP10 actin-related protein 10 [Source:MGI Symbol;... [more]
Actb1.012e-2523.53actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg13.292e-2523.46actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg13.292e-2523.46actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Actin-related protein 10-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NZ32|ARP10_HUMAN9.934e-9541.10Actin-related protein 10 OS=Homo sapiens OX=9606 G... [more]
sp|Q3ZBD2|ARP10_BOVIN1.697e-9440.45Actin-related protein 10 OS=Bos taurus OX=9913 GN=... [more]
sp|Q9QZB7|ARP10_MOUSE2.691e-9440.25Actin-related protein 10 OS=Mus musculus OX=10090 ... [more]
sp|Q9Y896|ACT2_SCHCO7.894e-3027.54Actin-2 OS=Schizophyllum commune OX=5334 GN=ACT2 P... [more]
sp|Q8SWN8|ACT_ENCCU3.205e-2725.56Actin OS=Encephalitozoon cuniculi (strain GB-M1) O... [more]
back to top
BLAST of Actin-related protein 10-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V8Q51.238e-11345.86Actin-related protein 10, arp10 OS=Schistosoma man... [more]
A0A183RC521.553e-11345.61Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A4S2M0J37.754e-11344.90Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8WZV31.522e-11245.50Actin OS=Opisthorchis viverrini OX=6198 GN=X801_04... [more]
A0A430QDA84.002e-11245.36Actin-related protein 10 OS=Schistosoma bovis OX=6... [more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr103.175e-8740.11actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE... [more]
actc1c1.374e-2524.08actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
actb14.636e-2523.46actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb25.144e-2523.46actin beta [Source:NCBI gene;Acc:103030443][more]
actb15.291e-2523.46actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr104.773e-8940.62actin related protein 10 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000011113.13.166e-2623.46pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.16.303e-2623.21pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.11.977e-2123.86pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
actl6a6.498e-1121.66actin-like 6A [Source:ZFIN;Acc:ZDB-GENE-020419-36][more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT11.510e-2523.76Actin; structural protein involved in cell polariz... [more]
ARP19.935e-2022.42Actin-related protein of the dynactin complex; req... [more]
ARP24.343e-1722.59Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP102.008e-823.75Component of the dynactin complex; localized to th... [more]
ARP43.656e-628.43Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401662.218e-8841.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379763.907e-2623.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385202.321e-2523.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426464.903e-2523.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361177.616e-2522.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-related protein 10-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr103.377e-9540.24actin related protein 10 [Source:NCBI gene;Acc:101... [more]
actr101.078e-8939.18actin related protein 10 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000021726.26.293e-2623.77actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb4.313e-2523.28cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb5.564e-2523.28cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of Actin-related protein 10-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009976.10.000e+099.75SMESG000009976.1[more]
SMESG000063528.14.147e-2724.32SMESG000063528.1[more]
SMESG000066020.13.689e-2623.83SMESG000066020.1[more]
SMESG000058003.14.853e-2623.83SMESG000058003.1[more]
SMESG000057992.14.853e-2623.83SMESG000057992.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034724 ID=SMED30034724|Name=Actin-related protein 10-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1732bp
TAATATTCTACTTGAGAAATATTAACTTTTCTATTAGATTTGTTTGAATA
TTATTAGTAAACAATATGCCGTATGATTTATATGTGAATAACATAAATGA
TAAAAGTGCAGTTATTTTTGATATCGGTGAATCATTAACTAAACTTGGGT
TTTCTGGAGAATCATCTCCTCGCGCAATAATTCCAACTGTTGTTAAACAA
GATAATGTTGTAAAATATTTAACAGATATTGTCGATCCAGAAGAGCAAAA
AAATTTCTTGATAAGTTTTATATATGAAATATATTACAGGAAATTGTTAG
TTAACCCGAAAGATCGGCGAGTTGTAGTTGTCGAGTCAATATTGAATTCA
ATTCAAAGACGAGAAATTCTAGCAAATATTCTTTTCAAGCACTTTGAAGT
GCCTTCAATTTTATTTACACCAATTCATTTGGTATCTCTTTTTACCATCG
GCTTGCAATCAGGAATTGTTTTAGATTGTGGATATAAGGAAGCAACTACA
ATTCCAGTATACGAAGGTTTCCACTTAATTCGCAATTGGCAGGCTGCACA
GCTGGGAAGTTATCAAGTGGAAAAACGATTGGAATCAATGATAATTGAAT
CCGGGATATTGATAGATCGCACCAACGAAATGAAAGAGATCAAGGATCTC
AAAAATCCAAGTGAAATTCTCACGAGAGAAGTGCTGGAGGACATCAAAGT
GAGAGCTTGCGTGGTGTCACCGATTGATAGGGCTGACAAATGGAGACAAT
GGCTGCTGACAAAAGACAGTGACGGCGCTCCTAGTGACCGCCCGGTATTA
GTCCAGGACACATTTGACTACAACTTACACTCGACGCCTCTCGGAGATAT
CTGTTTGAAACTTCCGATAGAAATTCGGGAGTTGGCCACCGAGTGCCTGT
TTGATTCGGAATTTGAGGAAACGACATTGGCTAGCATAGTTCTAGATGCG
ATATTGGGAGCCCCGATCGACTGCCGACGCGTGTTGTGCGAGAATATATT
AGTTATCGGAGGAACTTGTGAAATTCCCGGATTTAGATCTCGATTGTTGG
CTGAGATCAGGAAATTGTCCCAGCACAATAATCGATACAGCAGATTGCAG
CAGGAGACGTACAAGATGCATGATCCTCCTTGCTATGCCAATTACACCGG
CTGGCTAGGAGCCGCAATATTCGGTGACCTCGACACGATCGGCGTTCGGT
CGCTCACCAGGGAAACCTACATAGAGAAGGGGAAAGTTCCTGATTGGACT
GACACAACGGAGCAGAAAAGTCGATCTTAAATCTTTATGATTTGATTATT
GGTGTGATTGAAACAATTTGGTTGCTATGAAGAGTTAAATATATCTTTGT
TCTCTTTTTATTTACTGTCGGCCACAATTTCTATTTTTCAATAAATTACT
AATATTTCATTGCAGGAGCAGAATTGGCACAGAAATTTCGTTATTGATTT
CATTATCAGAAAAAGAAAATCAATACAGGCGGAGGTGCTCCATTGTTAAA
TTCTAGCATTGACAGAAATAGCAGCACATCGTAATGACGCAAGCTGAAAA
ATCAGGCGTTCGGATTTATTTGATTTACCGGCTTTACCGACTTCATGGGC
GTAAGGGACTAAGCTACTGACTCTTTCACAATTGTTTGTAAAAAGTTTGT
TTGTAAAAAGTTTGTTTAAATATTTATAAAACATTTCCTAAAAATGCCAC
ATTGATTTCTTAGCAATAGGAATTTAAATATA
back to top

protein sequence of SMED30034724-orf-1

>SMED30034724-orf-1 ID=SMED30034724-orf-1|Name=SMED30034724-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MPYDLYVNNINDKSAVIFDIGESLTKLGFSGESSPRAIIPTVVKQDNVVK
YLTDIVDPEEQKNFLISFIYEIYYRKLLVNPKDRRVVVVESILNSIQRRE
ILANILFKHFEVPSILFTPIHLVSLFTIGLQSGIVLDCGYKEATTIPVYE
GFHLIRNWQAAQLGSYQVEKRLESMIIESGILIDRTNEMKEIKDLKNPSE
ILTREVLEDIKVRACVVSPIDRADKWRQWLLTKDSDGAPSDRPVLVQDTF
DYNLHSTPLGDICLKLPIEIRELATECLFDSEFEETTLASIVLDAILGAP
IDCRRVLCENILVIGGTCEIPGFRSRLLAEIRKLSQHNNRYSRLQQETYK
MHDPPCYANYTGWLGAAIFGDLDTIGVRSLTRETYIEKGKVPDWTDTTEQ
KSRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR027127Arp10
IPR043129ATPase_NBD
IPR004000Actin
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005869dynactin complex
GO:0035578azurophil granule lumen
GO:1904813ficolin-1-rich granule lumen
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0043312neutrophil degranulation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 327..347
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 163..285
e-value: 2.8E-70
score: 238.7
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 16..389
e-value: 2.8E-70
score: 238.7
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 121..361
e-value: 2.8E-70
score: 238.7
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 16..184
e-value: 7.58699E-5
score: 41.0352
IPR004000Actin familySMARTSM00268actin_3coord: 13..403
e-value: 1.5E-12
score: 52.4
IPR004000Actin familyPFAMPF00022Actincoord: 12..390
e-value: 2.3E-43
score: 148.3
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 10..400
IPR027127Actin-related protein 10PANTHERPTHR11937:SF14ACTIN-RELATED PROTEIN 10coord: 10..400
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 12..136
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 131..389