Smed-NDK-4

Overview
NameSmed-NDK-4 (ADD84675.1)
Smed IDSMED30034720
Length (bp)2178
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Smed-NDK-4 (SMED30034720) t-SNE clustered cells

Violin plots show distribution of expression levels for Smed-NDK-4 (SMED30034720) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Smed-NDK-4 (SMED30034720) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Smed-NDK-4 (SMED30034720) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034720

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034720SMESG000009032.1 GU592831.1smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30034720SMESG000009032.1 dd_Smed_v4_12674_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30034720SMESG000009032.1 dd_Smed_v4_12674_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30034720SMESG000009032.1 dd_Smed_v4_12674_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30034720SMESG000009032.1 SmedASXL_014712SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30034720SMESG000009032.1 dd_Smed_v4_12674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034720SMESG000009032.1 dd_Smed_v4_12674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30034720SMESG000009032.1 dd_Smed_v6_12674_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034720SMESG000009032.1 OX_Smed_1.0.01071ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30034720SMESG000009032.1 OX_Smed_1.0.17714ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30034720SMESG000009032.1 GU592831.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
anterior pole cellSMED30034720SMESG000009032.1 GU592831.1smed_ncbi_20200123PMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Smed-NDK-4 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 100.908 bits (250), Expect = 9.430e-22
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK ++ ED G Y CK   G+G    ++ + VLD+    K    P +S        ++Q  +P F      +++    + + VGSSV+  C A+G+P P+  WMK   +    +     ++   L + N++ E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   ++        N+      + FV++ T    SR         +G  ++ L      Q+D+G Y+        G ++++ +L +
Sbjct:   41 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRH-----NSTIDVGGQKFVVLPTGDVWSR--------PDGSYLNKLLITRARQDDAGMYICLGAN-TMGYSFRSAFLTV 355          
BLAST of Smed-NDK-4 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 100.908 bits (250), Expect = 9.430e-22
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK ++ ED G Y CK   G+G    ++ + VLD+    K    P +S        ++Q  +P F      +++    + + VGSSV+  C A+G+P P+  WMK   +    +     ++   L + N++ E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   ++        N+      + FV++ T    SR         +G  ++ L      Q+D+G Y+        G ++++ +L +
Sbjct:   41 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRH-----NSTIDVGGQKFVVLPTGDVWSR--------PDGSYLNKLLITRARQDDAGMYICLGAN-TMGYSFRSAFLTV 355          
BLAST of Smed-NDK-4 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 100.908 bits (250), Expect = 9.430e-22
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK ++ ED G Y CK   G+G    ++ + VLD+    K    P +S        ++Q  +P F      +++    + + VGSSV+  C A+G+P P+  WMK   +    +     ++   L + N++ E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   ++        N+      + FV++ T    SR         +G  ++ L      Q+D+G Y+        G ++++ +L +
Sbjct:   41 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRH-----NSTIDVGGQKFVVLPTGDVWSR--------PDGSYLNKLLITRARQDDAGMYICLGAN-TMGYSFRSAFLTV 355          
BLAST of Smed-NDK-4 vs. Ensembl Human
Match: FGFRL1 (fibroblast growth factor receptor like 1 [Source:HGNC Symbol;Acc:HGNC:3693])

HSP 1 Score: 100.908 bits (250), Expect = 9.430e-22
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK ++ ED G Y CK   G+G    ++ + VLD+    K    P +S        ++Q  +P F      +++    + + VGSSV+  C A+G+P P+  WMK   +    +     ++   L + N++ E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   ++        N+      + FV++ T    SR         +G  ++ L      Q+D+G Y+        G ++++ +L +
Sbjct:   41 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRH-----NSTIDVGGQKFVVLPTGDVWSR--------PDGSYLNKLLITRARQDDAGMYICLGAN-TMGYSFRSAFLTV 355          
BLAST of Smed-NDK-4 vs. Ensembl Human
Match: FGFR4 (fibroblast growth factor receptor 4 [Source:HGNC Symbol;Acc:HGNC:3691])

HSP 1 Score: 76.2554 bits (186), Expect = 1.328e-13
Identity = 61/215 (28.37%), Postives = 93/215 (43.26%), Query Frame = 3
Query:  624 VGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQDSSD 1250
             G++V+F C AAGNP P   W+K   +    + I  IR       L + ++     G YTC V N +G I Y Y L V E+ P  P +   L  N TA +     ++  +  D QP IQW K +        A   P         Y  +++T            A  N   + +L  ++V  ED+G+Y      GNS G++Y++ +L +    D
Sbjct:  164 AGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP---------YVQVLKT------------ADINSSEVEVLYLRNVSAEDAGEYTCLA--GNSIGLSYQSAWLTVLPEED 355          
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Match: igcm-4 (ImmunoGlobulin-like Cell adhesion Molecule family [Source:UniProtKB/TrEMBL;Acc:Q95XJ7])

HSP 1 Score: 83.9593 bits (206), Expect = 1.382e-16
Identity = 84/397 (21.16%), Postives = 168/397 (42.32%), Query Frame = 3
Query:  144 MDSV---VILLIVCIWLNSGV----QTLGNNIIPILHDYSSNVSVQIGS-TLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASI------TKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYP------------KLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEY-FVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDL 1253
            MDS     + L++   +NS +          + P + +  +   + +G    ++ CP  I + E +   I W+ NG     L  D +Y+   +++ L++KS+K ED+G Y C+   G+G +   F + V D+   H    S+      +     P +L  +     +  K+  + G  ++  C A GNPLPE  W + +     I   T      + +  ++  ++G Y C V N LG +S+ + + V + +              +  ++++  N++      A     +  +   +I+W K+V+D     +  + PN+     N    ++++   T+S +  E +  DN +  + L    V    +GKY+   T     + YK+  L +  + D 
Sbjct:    1 MDSFKMGAVFLLIITMVNSAIIRPHVEAARGMPPRMRNVETKFRIPLGQKQFRLVCP--IIATEKDSTMIQWSKNG---EQLDWDSQYKLSKDSKELKMKSVKFEDSGRYQCQATNGFGHKTIEFIVHVHDQ---HDKENSVKDYLVLSNTTASPSWLIDMNSEWRSPIKI--NTGGKLELRCPAQGNPLPEIRWYQNEME---ISEKTHKHVSTITVEPVESSHSGVYRCVVENPLGSLSFAFDVSVGDFFDPTTTEATEYQETAMEPVIDQPYNISVYAGHTAQFQCKVKSNENTIIKWLKEVSDPLSIRR--KDPNSTVIHVNGMNLLVLDHIQTESSLPQEDM--DNIY-TNRLTIHKVDYHHAGKYICVVTSAQGQIVYKSAELKVLSAYDF 379          
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 65.855 bits (159), Expect = 1.041e-10
Identity = 61/223 (27.35%), Postives = 97/223 (43.50%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDN--ITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIV---REKYPKLPKIVNKLTNVTAK 905
            S + GS +K+NC +  N K      I+W  NG  +  +S   R +   +N VL +     ED+G YTC+ V   G    +F + ++         +S+    Y+                V +++G SV F C A GNP+P+Y W    S+   I    + S     LRI+NI+ +  G Y+C   N +G +S    L V     +    P+I  +L    A+
Sbjct:  325 SFREGSEVKVNCEVMGNPKPT----INWYHNG--KRFISSRKR-QLGLSNNVLRIYPFLEEDSGRYTCEAVNSVGKVRHAFSLDLI---------SSVPPNIYE------------GPQSVSQNLGGSVVFVCKANGNPVPDYTWSFDGSTIGHIKGRFMVSDDGTELRISNIEKKDEGYYSCMAGNPVGAMSADAKLTVIGGETRKAAAPQIDEELLRAIAQ 519          
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 62.7734 bits (151), Expect = 1.136e-9
Identity = 67/283 (23.67%), Postives = 99/283 (34.98%), Query Frame = 3
Query:  174 CIWLNSGVQTLGNNII-----PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKV-----LDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ------PVIQWFK 974
            CI  N     + + +I     P    + +  ++  G + KI C +  + K      ISW   G   NM ++ L          L +   +  D G YTC     YG  E  F + V     +DE     P A                             G  +   C   GNP P   W +G  +       T +    L+IN++  E AGQY+C   N+ G ++  Y   V  K    P  V K  N+   ++       TI+ DC       P I WF+
Sbjct: 3279 CIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT----ISWLKGGRPFNMDNIIL----SPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAV---------------------------AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGK----PTFVRKGGNLYEVIEN-----DTITMDCGVTSRPLPSISWFR 3517          

HSP 2 Score: 60.077 bits (144), Expect = 6.249e-9
Identity = 64/292 (21.92%), Postives = 115/292 (39.38%), Query Frame = 3
Query:  246 NVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPI-LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKK----VTDLSKFTKA---IQLPNAEDKEKNEYFVIVETDSTDSRITTE 1097
            NV VQ G  L + CP+    ++  G  I+W+     +  L  D+R +  ++   L +     ED  +Y+C  V   G  EA F + V      + P                +  +  +  ++V D  ++++  C   G P PE  W         +  +T  +  + LRI+NIK    G+YTC   N+ G       + + E     P++V     +     +   I   +  + +PV+ W K      +DL +F+     + L      +   Y  I    + +S+ TT+
Sbjct: 2951 NVEVQAGDPLTLECPI----EDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTV------NTPP--------------KIFGDSFSTTEIVAD--TTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEP----PRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTD 3210          

HSP 3 Score: 53.1434 bits (126), Expect = 9.355e-7
Identity = 57/235 (24.26%), Postives = 97/235 (41.28%), Query Frame = 3
Query:  222 PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK-GK--SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKP 917
            P        V  ++G T+ + C     + E+     S   +  DE++ +  +  ++  N + L V +I+ +D G Y C  V   G+ +  F + V++  +       + +QK  P  L                 G  +  +C A G P P  L+MK GK  + +D +D I S     L I+N + E  G+YTC   N+ G       ++V    P  PK+  +  NV  +   P
Sbjct: 2761 PHFEKEREEVVARVGDTMLLTC-----NAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYF------LDQQKLYPIIL-----------------GKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGR--SEKDMMVEVLLP--PKLSKEWINVEVQAGDP 2959          

HSP 4 Score: 51.9878 bits (123), Expect = 2.127e-6
Identity = 58/238 (24.37%), Postives = 95/238 (39.92%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSA-DWIDNI-TSIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ----PVIQWFKKVTDLSKFTKAIQL 1016
            I W  NG +   ++ D         QVL++    S+  G ++C      GV+E    + V                 + P  ++    N       +K +G ++   C A+GNP P+  W KG S   D  D    S++   L I ++K    G YTC+  N  G  E S +  ++V       P+I     +++ +L  PA    T+ C  Q    P ++W    T L+  T  I +
Sbjct: 3799 IKWLKNGKE---VTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDV-----------------FTPPVVSVKSDNP------IKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVP------PEINRDGIDMSPRL--PAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITV 4002          

HSP 5 Score: 50.8322 bits (120), Expect = 4.153e-6
Identity = 49/177 (27.68%), Postives = 71/177 (40.11%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKG--VTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDN--ITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIV 845
            I W  NG D  ++  D  Y  K N   L +   K ED G Y+C G  + G  V+ A+  +  +                  P  + S        H V  ++   V   C A G P PE  W KG      ++N   T +    L I + ++E  GQ+TC   N  G+ S + TL+V
Sbjct:  734 IRWFKNGKD--LIKPD-DY-IKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV------------------PTIIES-------PHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMV 881          

HSP 6 Score: 50.8322 bits (120), Expect = 4.260e-6
Identity = 65/288 (22.57%), Postives = 112/288 (38.89%), Query Frame = 3
Query:  264 GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNIT-SIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNG 1118
            G  + + CP+  N        ++W      ++ +  D R+   NN   L++ S+ +ED G Y+C  V   G     +  +V+                 KP F+    +     ++V+++   ++  +C     PLP   W +G       D  + S     + IN  KL   G+Y C+  N+ G  +I     ++V    PK+ K  N + N  A + +  ++   IS   QP + W K   D++     + L      + NE F I     TD    T T     G
Sbjct: 3405 GGEIILKCPVLGNPTPT----VTWKRG---DDAVPNDSRHTIVNNYD-LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIG----------------KPTFV----RKGGNLYEVIEN--DTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVP---PKIDK-SNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVIL-----AQNNETFGIENVQVTDQGRYTCTATNRGG 3653          

HSP 7 Score: 50.447 bits (119), Expect = 5.446e-6
Identity = 54/207 (26.09%), Postives = 80/207 (38.65%), Query Frame = 3
Query:  222 PILHDYSSNVSVQI-GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSI------RQPILRINNIKLEYAGQYTCKVYNQLGEI 821
            P++     N+   I G  L   CP  I+  +N    I W  N    ++ + D R    +N++ L + ++   D G Y+C+     G     F   VL      +P   I   K K         N+           S+V  +C A G P P+  W K    A  I+NI  I          L+I  IK   AG+YTC+  N  G +
Sbjct: 2190 PMIQKGIKNIVTAIKGGALPFKCP--IDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL------VPPTIIMLDKDK---------NKTAVEH------STVTLSCPATGKPEPDITWFK-DGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSV 2372          

HSP 8 Score: 49.6766 bits (117), Expect = 9.524e-6
Identity = 41/188 (21.81%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  264 GSTLKINCPMSINSK-ENEGFFISWTVNGVDENMLSMDL--RYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQ-PILRINNIKLEYAGQYTCKVYNQLG 815
            G T+ + CP+ +     ++   +SWT    D   L  DL    +  ++ + L +     E+ G YTC  +   G     F +++L       P   I++   +P     +  N+ T  +            C   G+P P   W+K        +NI  + Q  +L+I     ++AG+++C   N  G
Sbjct: 3682 GDTITLTCPIKLAEDIADQVMDVSWTK---DSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSP-----PVIDISRNDVQP----QVAVNQPTIMR------------CAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAG 3845          
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 62.3882 bits (150), Expect = 1.186e-9
Identity = 67/283 (23.67%), Postives = 99/283 (34.98%), Query Frame = 3
Query:  174 CIWLNSGVQTLGNNII-----PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKV-----LDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ------PVIQWFK 974
            CI  N     + + +I     P    + +  ++  G + KI C +  + K      ISW   G   NM ++ L          L +   +  D G YTC     YG  E  F + V     +DE     P A                             G  +   C   GNP P   W +G  +       T +    L+IN++  E AGQY+C   N+ G ++  Y   V  K    P  V K  N+   ++       TI+ DC       P I WF+
Sbjct: 3279 CIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT----ISWLKGGRPFNMDNIIL----SPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAV---------------------------AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGK----PTFVRKGGNLYEVIEN-----DTITMDCGVTSRPLPSISWFR 3517          

HSP 2 Score: 60.077 bits (144), Expect = 6.357e-9
Identity = 64/292 (21.92%), Postives = 115/292 (39.38%), Query Frame = 3
Query:  246 NVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPI-LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKK----VTDLSKFTKA---IQLPNAEDKEKNEYFVIVETDSTDSRITTE 1097
            NV VQ G  L + CP+    ++  G  I+W+     +  L  D+R +  ++   L +     ED  +Y+C  V   G  EA F + V      + P                +  +  +  ++V D  ++++  C   G P PE  W         +  +T  +  + LRI+NIK    G+YTC   N+ G       + + E     P++V     +     +   I   +  + +PV+ W K      +DL +F+     + L      +   Y  I    + +S+ TT+
Sbjct: 2951 NVEVQAGDPLTLECPI----EDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTV------NTPP--------------KIFGDSFSTTEIVAD--TTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEP----PRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTD 3210          

HSP 3 Score: 52.7582 bits (125), Expect = 1.062e-6
Identity = 57/235 (24.26%), Postives = 97/235 (41.28%), Query Frame = 3
Query:  222 PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK-GK--SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKP 917
            P        V  ++G T+ + C     + E+     S   +  DE++ +  +  ++  N + L V +I+ +D G Y C  V   G+ +  F + V++  +       + +QK  P  L                 G  +  +C A G P P  L+MK GK  + +D +D I S     L I+N + E  G+YTC   N+ G       ++V    P  PK+  +  NV  +   P
Sbjct: 2761 PHFEKEREEVVARVGDTMLLTC-----NAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYF------LDQQKLYPIIL-----------------GKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGR--SEKDMMVEVLLP--PKLSKEWINVEVQAGDP 2959          

HSP 4 Score: 51.9878 bits (123), Expect = 2.220e-6
Identity = 58/238 (24.37%), Postives = 95/238 (39.92%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSA-DWIDNI-TSIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ----PVIQWFKKVTDLSKFTKAIQL 1016
            I W  NG +   ++ D         QVL++    S+  G ++C      GV+E    + V                 + P  ++    N       +K +G ++   C A+GNP P+  W KG S   D  D    S++   L I ++K    G YTC+  N  G  E S +  ++V       P+I     +++ +L  PA    T+ C  Q    P ++W    T L+  T  I +
Sbjct: 3799 IKWLKNGKE---VTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDV-----------------FTPPVVSVKSDNP------IKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVP------PEINRDGIDMSPRL--PAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITV 4002          

HSP 5 Score: 50.8322 bits (120), Expect = 4.334e-6
Identity = 65/288 (22.57%), Postives = 112/288 (38.89%), Query Frame = 3
Query:  264 GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNIT-SIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNG 1118
            G  + + CP+  N        ++W      ++ +  D R+   NN   L++ S+ +ED G Y+C  V   G     +  +V+                 KP F+    +     ++V+++   ++  +C     PLP   W +G       D  + S     + IN  KL   G+Y C+  N+ G  +I     ++V    PK+ K  N + N  A + +  ++   IS   QP + W K   D++     + L      + NE F I     TD    T T     G
Sbjct: 3405 GGEIILKCPVLGNPTPT----VTWKRG---DDAVPNDSRHTIVNNYD-LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIG----------------KPTFV----RKGGNLYEVIEN--DTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVP---PKIDK-SNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVIL-----AQNNETFGIENVQVTDQGRYTCTATNRGG 3653          

HSP 6 Score: 50.8322 bits (120), Expect = 4.521e-6
Identity = 49/177 (27.68%), Postives = 71/177 (40.11%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKG--VTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDN--ITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIV 845
            I W  NG D  ++  D  Y  K N   L +   K ED G Y+C G  + G  V+ A+  +  +                  P  + S        H V  ++   V   C A G P PE  W KG      ++N   T +    L I + ++E  GQ+TC   N  G+ S + TL+V
Sbjct:  734 IRWFKNGKD--LIKPD-DY-IKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV------------------PTIIES-------PHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMV 881          

HSP 7 Score: 50.447 bits (119), Expect = 5.780e-6
Identity = 54/207 (26.09%), Postives = 80/207 (38.65%), Query Frame = 3
Query:  222 PILHDYSSNVSVQI-GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSI------RQPILRINNIKLEYAGQYTCKVYNQLGEI 821
            P++     N+   I G  L   CP  I+  +N    I W  N    ++ + D R    +N++ L + ++   D G Y+C+     G     F   VL      +P   I   K K         N+           S+V  +C A G P P+  W K    A  I+NI  I          L+I  IK   AG+YTC+  N  G +
Sbjct: 2190 PMIQKGIKNIVTAIKGGALPFKCP--IDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL------VPPTIIMLDKDK---------NKTAVEH------STVTLSCPATGKPEPDITWFK-DGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSV 2372          

HSP 8 Score: 49.6766 bits (117), Expect = 9.770e-6
Identity = 41/188 (21.81%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  264 GSTLKINCPMSINSK-ENEGFFISWTVNGVDENMLSMDL--RYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQ-PILRINNIKLEYAGQYTCKVYNQLG 815
            G T+ + CP+ +     ++   +SWT    D   L  DL    +  ++ + L +     E+ G YTC  +   G     F +++L       P   I++   +P     +  N+ T  +            C   G+P P   W+K        +NI  + Q  +L+I     ++AG+++C   N  G
Sbjct: 3682 GDTITLTCPIKLAEDIADQVMDVSWTK---DSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILSP-----PVIDISRNDVQP----QVAVNQPTIMR------------CAVTGHPFPSIKWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAG 3845          
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 62.3882 bits (150), Expect = 1.248e-9
Identity = 67/283 (23.67%), Postives = 99/283 (34.98%), Query Frame = 3
Query:  174 CIWLNSGVQTLGNNII-----PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKV-----LDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ------PVIQWFK 974
            CI  N     + + +I     P    + +  ++  G + KI C +  + K      ISW   G   NM ++ L          L +   +  D G YTC     YG  E  F + V     +DE     P A                             G  +   C   GNP P   W +G  +       T +    L+IN++  E AGQY+C   N+ G ++  Y   V  K    P  V K  N+   ++       TI+ DC       P I WF+
Sbjct: 3279 CIASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPT----ISWLKGGRPFNMDNIIL----SPRGDTLMILKAQRFDGGLYTCVATNSYGDSEQDFKVNVYTKPYIDETIDQTPKAV---------------------------AGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGK----PTFVRKGGNLYEVIEN-----DTITMDCGVTSRPLPSISWFR 3517          

HSP 2 Score: 60.077 bits (144), Expect = 6.412e-9
Identity = 64/292 (21.92%), Postives = 115/292 (39.38%), Query Frame = 3
Query:  246 NVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPI-LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKK----VTDLSKFTKA---IQLPNAEDKEKNEYFVIVETDSTDSRITTE 1097
            NV VQ G  L + CP+    ++  G  I+W+     +  L  D+R +  ++   L +     ED  +Y+C  V   G  EA F + V      + P                +  +  +  ++V D  ++++  C   G P PE  W         +  +T  +  + LRI+NIK    G+YTC   N+ G       + + E     P++V     +     +   I   +  + +PV+ W K      +DL +F+     + L      +   Y  I    + +S+ TT+
Sbjct: 2951 NVEVQAGDPLTLECPI----EDTSGVHITWSRQFGKDGQL--DMRAQSSSDKSKLYIMQATPEDADSYSCIAVNDAGGAEAVFQVTV------NTPP--------------KIFGDSFSTTEIVAD--TTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYVEISEP----PRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGEPYTSDLLQFSTKLSYLHLRETTLADGGTYTCIATNKAGESQTTTD 3210          

HSP 3 Score: 53.1434 bits (126), Expect = 9.598e-7
Identity = 57/235 (24.26%), Postives = 97/235 (41.28%), Query Frame = 3
Query:  222 PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK-GK--SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKP 917
            P        V  ++G T+ + C     + E+     S   +  DE++ +  +  ++  N + L V +I+ +D G Y C  V   G+ +  F + V++  +       + +QK  P  L                 G  +  +C A G P P  L+MK GK  + +D +D I S     L I+N + E  G+YTC   N+ G       ++V    P  PK+  +  NV  +   P
Sbjct: 2761 PHFEKEREEVVARVGDTMLLTC-----NAESSVPLSSVYWHAHDESVQNGVITSKYAANEKTLNVTNIQLDDEGFYYCTAVNEAGITKKFFKLIVIETPYF------LDQQKLYPIIL-----------------GKRLTLDCSATGTPPPTILFMKDGKRLNESDEVDIIGS----TLVIDNPQKEVEGRYTCIAENKAGR--SEKDMMVEVLLP--PKLSKEWINVEVQAGDP 2959          

HSP 4 Score: 51.6026 bits (122), Expect = 2.297e-6
Identity = 58/238 (24.37%), Postives = 95/238 (39.92%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSA-DWIDNI-TSIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ----PVIQWFKKVTDLSKFTKAIQL 1016
            I W  NG +   ++ D         QVL++    S+  G ++C      GV+E    + V                 + P  ++    N       +K +G ++   C A+GNP P+  W KG S   D  D    S++   L I ++K    G YTC+  N  G  E S +  ++V       P+I     +++ +L  PA    T+ C  Q    P ++W    T L+  T  I +
Sbjct: 3837 IKWLKNGKE---VTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDV-----------------FTPPVVSVKSDNP------IKALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVP------PEINRDGIDMSPRL--PAQQSLTLQCLAQGKPVPQMRWTLNGTALTHSTPGITV 4040          

HSP 5 Score: 50.8322 bits (120), Expect = 4.484e-6
Identity = 65/288 (22.57%), Postives = 112/288 (38.89%), Query Frame = 3
Query:  264 GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNIT-SIRQPILRINNIKLEYAGQYTCKVYNQLG--EISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNG 1118
            G  + + CP+  N        ++W      ++ +  D R+   NN   L++ S+ +ED G Y+C  V   G     +  +V+                 KP F+    +     ++V+++   ++  +C     PLP   W +G       D  + S     + IN  KL   G+Y C+  N+ G  +I     ++V    PK+ K  N + N  A + +  ++   IS   QP + W K   D++     + L      + NE F I     TD    T T     G
Sbjct: 3405 GGEIILKCPVLGNPTPT----VTWKRG---DDAVPNDSRHTIVNNYD-LKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIG----------------KPTFV----RKGGNLYEVIEN--DTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVP---PKIDK-SNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVIL-----AQNNETFGIENVQVTDQGRYTCTATNRGG 3653          

HSP 6 Score: 50.8322 bits (120), Expect = 4.560e-6
Identity = 49/177 (27.68%), Postives = 71/177 (40.11%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKG--VTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDN--ITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIV 845
            I W  NG D  ++  D  Y  K N   L +   K ED G Y+C G  + G  V+ A+  +  +                  P  + S        H V  ++   V   C A G P PE  W KG      ++N   T +    L I + ++E  GQ+TC   N  G+ S + TL+V
Sbjct:  734 IRWFKNGKD--LIKPD-DY-IKINEGQLHIMGAKDEDAGAYSCVGENMAGKDVQVANLSVGRV------------------PTIIESP-------HTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLLITDAQIEDQGQFTCIARNTYGQQSQSTTLMV 881          

HSP 7 Score: 50.447 bits (119), Expect = 5.879e-6
Identity = 54/207 (26.09%), Postives = 80/207 (38.65%), Query Frame = 3
Query:  222 PILHDYSSNVSVQI-GSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSI------RQPILRINNIKLEYAGQYTCKVYNQLGEI 821
            P++     N+   I G  L   CP  I+  +N    I W  N    ++ + D R    +N++ L + ++   D G Y+C+     G     F   VL      +P   I   K K         N+           S+V  +C A G P P+  W K    A  I+NI  I          L+I  IK   AG+YTC+  N  G +
Sbjct: 2190 PMIQKGIKNIVTAIKGGALPFKCP--IDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTENDEGQYSCRVKNDAGENSFDFKATVL------VPPTIIMLDKDK---------NKTAVEH------STVTLSCPATGKPEPDITWFK-DGEAIHIENIADIIPNGELNGNQLKITRIKEGDAGKYTCEADNSAGSV 2372          
BLAST of Smed-NDK-4 vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0329985)

HSP 1 Score: 67.781 bits (164), Expect = 3.281e-11
Identity = 78/314 (24.84%), Postives = 124/314 (39.49%), Query Frame = 3
Query:  243 SNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVRE-ASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADW-IDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYV 1178
            +N  V  G    + C     S E +   ISW  NG   N++  + R    +    L ++  +  D G Y C      G RE A+ ++KV      H+          +P FL    QN+         VGSSV F C   G+PLP+ LW +  S  +  +  +  +    L+++++ LE  G+YTC+  N +G I+ T  L V       PK V +  N   ++          +   +P + W                      E N   ++      D R+   T+  +   ++SI RF    +EDSGK V
Sbjct:  196 ANTRVAQGEVALMECGAPRGSPEPQ---ISWRKNGQTLNLVG-NKRIRIVDGGN-LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKV------HV----------RP-FLIRGPQNQTAV------VGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAP----PKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYW--------------------SVEGNSSLLL--PGYRDGRMEV-TLTPEGRSVLSIARFA---REDSGKVV 451          
BLAST of Smed-NDK-4 vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0077941)

HSP 1 Score: 67.781 bits (164), Expect = 3.338e-11
Identity = 78/314 (24.84%), Postives = 124/314 (39.49%), Query Frame = 3
Query:  243 SNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVRE-ASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADW-IDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYV 1178
            +N  V  G    + C     S E +   ISW  NG   N++  + R    +    L ++  +  D G Y C      G RE A+ ++KV      H+          +P FL    QN+         VGSSV F C   G+PLP+ LW +  S  +  +  +  +    L+++++ LE  G+YTC+  N +G I+ T  L V       PK V +  N   ++          +   +P + W                      E N   ++      D R+   T+  +   ++SI RF    +EDSGK V
Sbjct:  196 ANTRVAQGEVALMECGAPRGSPEPQ---ISWRKNGQTLNLVG-NKRIRIVDGGN-LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKV------HV----------RP-FLIRGPQNQTAV------VGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRRVHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAP----PKFVIRPKNQLVEIGDEVLFECQANGHPRPTLYW--------------------SVEGNSSLLL--PGYRDGRMEV-TLTPEGRSVLSIARFA---REDSGKVV 451          
BLAST of Smed-NDK-4 vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0077921)

HSP 1 Score: 58.5362 bits (140), Expect = 2.072e-8
Identity = 40/168 (23.81%), Postives = 70/168 (41.67%), Query Frame = 3
Query:  408 LEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADW-IDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKL 908
            L ++  +  D G Y C      GVRE+S                +  K   KP  +          H      G+SV F C   G+P+P+ LW++  S  +  +D ++ +    LR+  + +   G+Y+C+  N +G I+   TL V       PK + +  + + +L
Sbjct:  178 LAIQDARQTDEGQYQCIAKNPVGVRESSL---------------ATLKVHVKPYIIRG-------PHDQTVLEGASVTFPCRVGGDPMPDVLWLRTASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAITAMGTLTVYAP----PKFIQRPASKSVEL 319          
BLAST of Smed-NDK-4 vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0335384)

HSP 1 Score: 58.5362 bits (140), Expect = 2.072e-8
Identity = 40/168 (23.81%), Postives = 70/168 (41.67%), Query Frame = 3
Query:  408 LEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADW-IDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKL 908
            L ++  +  D G Y C      GVRE+S                +  K   KP  +          H      G+SV F C   G+P+P+ LW++  S  +  +D ++ +    LR+  + +   G+Y+C+  N +G I+   TL V       PK + +  + + +L
Sbjct:  178 LAIQDARQTDEGQYQCIAKNPVGVRESSL---------------ATLKVHVKPYIIRG-------PHDQTVLEGASVTFPCRVGGDPMPDVLWLRTASGGNMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAITAMGTLTVYAP----PKFIQRPASKSVEL 319          
BLAST of Smed-NDK-4 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111058)

HSP 1 Score: 56.225 bits (134), Expect = 1.222e-7
Identity = 55/244 (22.54%), Postives = 103/244 (42.21%), Query Frame = 3
Query:  216 IIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK--GKSSADW-----IDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFI 926
            ++P +H +S +     G ++++ C ++   K +    I WT NG+        +  +      +L V+S+K+ ++G Y+C      G   +S       E   ++P   I +   K     +  Q            GS  +  C A G P P+  W K  G +  ++      DNI  + +  L ++NI+    G Y C+  N +G    +  +++  + P  P+   KL N TA+  +PA +
Sbjct:  617 VLPSIHPFSFDAEANEGDSVQLTCHVA---KGDLPLRIRWTHNGLPLFTHLGVMASKIGERISLLTVESVKAANSGNYSCVASNNAGNVSSSA------ELLVNVPPRWILEPTDK-----AFAQ------------GSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNI-RVEEGTLHVDNIQKTNEGYYLCEAINGIGS-GLSAVIMISVQAP--PEFTEKLRNQTARRGEPAVL 830          
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Match: fgfrl1a (fibroblast growth factor receptor like 1a [Source:ZFIN;Acc:ZDB-GENE-040128-2])

HSP 1 Score: 111.309 bits (277), Expect = 2.588e-25
Identity = 87/340 (25.59%), Postives = 156/340 (45.88%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQ-KYKPCFLNSLMQNELTY------HKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            +V+IG T+K+ CP+  +        I WT +G   N+ S  +R  F+   Q L +K ++++D GT+ CK   G+G    ++ + V+D+       A    + +Y       L++   T         + + VGSSV+  C A+GNP P+ +W+K  S     + +   R+    L + N+  E++G+YTC V N+ GEI+ TY + V ++    P +      N T            +  D +PVIQW K+V      K+   I++        + +FV++ T    SR         +G  ++ L      +ED+G Y+        G ++++ +L +
Sbjct:   35 TVRIGRTMKLQCPVEGDPPP----LIMWTKDG--RNIHSGWMR--FRVLQQALRIKEVEADDAGTFICKATNGFGSVNINYTLIVIDDSSAGREGARPAGETEYSTDLTGKLVRPRFTQPAKMRKRVIARPVGSSVRLKCTASGNPRPDIVWLK-DSRPLTPEEVGEGRKKKWTLSLKNLTPEHSGKYTCHVSNRAGEINATYKVEVIQRTNSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEPGGEGKYNSTIEV-------GDHHFVVLPTGDVWSR--------PDGSYLNKLLITRAKEEDAGMYICLGAN-TMGYSFRSAFLTV 349          
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 100.138 bits (248), Expect = 1.169e-21
Identity = 88/360 (24.44%), Postives = 157/360 (43.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKF---------CHIPTASITKQK--YKPCFLNSLMQNELTYHKVVKD-VGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKN------EYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNY--KTVYLDIQDSSDLKKN 1262
            + ++G T++I CP+  +        + W  +G + N         +K   + L++K ++ ED G Y C+   G+G    +F + V+D+              P A ++ Q+   +P       Q      +V++  VGSSV+  C A+GNP P   W K +S    +DN    ++P   L + N++ + + +YTC V N  G I+ TY + V E+    P +      N T +    A     +  D +PVIQW K+V            P +ED+  +      +++V++ T    SR         +G  ++ L       ED+G Y+     G + M Y  ++ YL +     ++K+
Sbjct:   37 TAKLGCTVRIPCPVEGDPPP----LVLWVKDGRNVN----PGWSRYKVLKRSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSL---LDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVD-----------PGSEDRYNSTLEVGGQHYVVLPTGDVWSR--------PDGSYLNKLAIVKARDEDAGMYICL---GANTMGYSVRSAYLTVLSDPKVEKD 363          
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 99.3673 bits (246), Expect = 1.645e-21
Identity = 88/360 (24.44%), Postives = 157/360 (43.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKF---------CHIPTASITKQK--YKPCFLNSLMQNELTYHKVVKD-VGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKN------EYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNY--KTVYLDIQDSSDLKKN 1262
            + ++G T++I CP+  +        + W  +G + N         +K   + L++K ++ ED G Y C+   G+G    +F + V+D+              P A ++ Q+   +P       Q      +V++  VGSSV+  C A+GNP P   W K +S    +DN    ++P   L + N++ + + +YTC V N  G I+ TY + V E+    P +      N T +    A     +  D +PVIQW K+V            P +ED+  +      +++V++ T    SR         +G  ++ L       ED+G Y+     G + M Y  ++ YL +     ++K+
Sbjct:   37 TAKLGCTVRIPCPVEGDPPP----LVLWVKDGRNVN----PGWSRYKVLKRSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSL---LDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVD-----------PGSEDRYNSTLEVGGQHYVVLPTGDVWSR--------PDGSYLNKLAIVKARDEDAGMYICL---GANTMGYSVRSAYLTVLSDPKVEKD 363          
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 99.3673 bits (246), Expect = 1.645e-21
Identity = 88/360 (24.44%), Postives = 157/360 (43.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKF---------CHIPTASITKQK--YKPCFLNSLMQNELTYHKVVKD-VGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKN------EYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNY--KTVYLDIQDSSDLKKN 1262
            + ++G T++I CP+  +        + W  +G + N         +K   + L++K ++ ED G Y C+   G+G    +F + V+D+              P A ++ Q+   +P       Q      +V++  VGSSV+  C A+GNP P   W K +S    +DN    ++P   L + N++ + + +YTC V N  G I+ TY + V E+    P +      N T +    A     +  D +PVIQW K+V            P +ED+  +      +++V++ T    SR         +G  ++ L       ED+G Y+     G + M Y  ++ YL +     ++K+
Sbjct:   37 TAKLGCTVRIPCPVEGDPPP----LVLWVKDGRNVN----PGWSRYKVLKRSLKIKEVELEDAGVYICRVTNGFGSLALNFTLIVIDDAAVPQNPPPPDAAEPNADLSLQEPTREPWVKPRFSQPTKMRRRVLEQPVGSSVRLKCLASGNPTPVITWWKDQSL---LDNPQQSKRPQWTLTLKNLQPQDSAKYTCHVSNAAGHINATYKVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVD-----------PGSEDRYNSTLEVGGQHYVVLPTGDVWSR--------PDGSYLNKLAIVKARDEDAGMYICL---GANTMGYSVRSAYLTVLSDPKVEKD 363          
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 85.1149 bits (209), Expect = 1.631e-16
Identity = 93/360 (25.83%), Postives = 145/360 (40.28%), Query Frame = 3
Query:  201 TLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLD--------EKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI----TSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQ 1238
            T   N +P+L       SV  G  LK+ CP+S          + WT    D + L  D R     +   L++     +D+G Y+C           SF + V D        +            ++ +  +     + E   H V     ++V+F C AAGNP P+  W+K        D +      ++   L + ++     G YTC V NQ G I++TYTL V E+ P  P +   L  NVT ++ + A  V  +  D QP IQW +  T          LP         Y  +++T   +      T  K+    I +L   +V  ED+G+Y      GNS G++Y T +L + 
Sbjct:   41 TKNQNCVPVL------FSVHPGELLKLKCPLSGADD------VVWTK---DSSSLRPDNRTLVTRD--WLQISDATPKDSGLYSCSATGSRDCDVFSFIVNVTDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAV--PAANTVKFRCAAAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSINHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSRYGPDGLP---------YVRVLKTAGVN------TTDKE----IEVLYLPNVTFEDAGEYTCLA--GNSIGISYHTAWLTVH 360          
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:Xenbase;Acc:XB-GENE-944987])

HSP 1 Score: 106.686 bits (265), Expect = 1.139e-23
Identity = 85/345 (24.64%), Postives = 161/345 (46.67%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE-------KFCHIPTASI----TKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGK---SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIV-NKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            +V++G  +K+ CP+  +        I W  +G    + S   R+    +   +++K ++SED G+Y CK   G+G    ++ + V+D+       +    P A +    +KQ  +P F       ++    + + VGSSV+  C A+GNP P+  W+K     +S +  DN    ++  L + ++K E +G+YTC+VYN++G+I+ TY + V ++    P +  N   N T            +  D +PVIQW K+V     +K+   I +         + F+++ T         E  ++ +G  ++ L      +ED+G Y+        G ++K+ +L +
Sbjct:   24 TVRLGRAIKLLCPVEADPPP----LIMWMKDG--RTIHSGWTRFRVYQHG--MKIKDVESEDAGSYICKATNGFGSINVNYTLIVIDDSSSGKTNQPPDGPNAEVEEFSSKQWARPRFTQPA---KMRKRVIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTSQEIGDN--KKKKWTLNLKSLKPEDSGKYTCQVYNRVGQINATYKVEVIQRTRSKPILTGNHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGTENKYNSTIDV-------GGQKFIVLPTG--------EVWSRPDGSYLNKLIITRAREEDAGMYICLGA-NTMGYSFKSAFLTV 339          
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:Xenbase;Acc:XB-GENE-944987])

HSP 1 Score: 106.301 bits (264), Expect = 1.314e-23
Identity = 85/345 (24.64%), Postives = 161/345 (46.67%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE-------KFCHIPTASI----TKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGK---SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIV-NKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            +V++G  +K+ CP+  +        I W  +G    + S   R+    +   +++K ++SED G+Y CK   G+G    ++ + V+D+       +    P A +    +KQ  +P F       ++    + + VGSSV+  C A+GNP P+  W+K     +S +  DN    ++  L + ++K E +G+YTC+VYN++G+I+ TY + V ++    P +  N   N T            +  D +PVIQW K+V     +K+   I +         + F+++ T         E  ++ +G  ++ L      +ED+G Y+        G ++K+ +L +
Sbjct:   34 TVRLGRAIKLLCPVEADPPP----LIMWMKDG--RTIHSGWTRFRVYQHG--MKIKDVESEDAGSYICKATNGFGSINVNYTLIVIDDSSSGKTNQPPDGPNAEVEEFSSKQWARPRFTQPA---KMRKRVIARPVGSSVRLKCIASGNPRPDITWLKDNKPLTSQEIGDN--KKKKWTLNLKSLKPEDSGKYTCQVYNRVGQINATYKVEVIQRTRSKPILTGNHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGTENKYNSTIDV-------GGQKFIVLPTG--------EVWSRPDGSYLNKLIITRAREEDAGMYICLGA-NTMGYSFKSAFLTV 349          
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 78.1814 bits (191), Expect = 2.956e-14
Identity = 74/282 (26.24%), Postives = 120/282 (42.55%), Query Frame = 3
Query:  405 VLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKV-TDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYL 1229
            VLEV  +  ED+G Y C  V G G     F I V+D     + +      +  P +     + +   H V    G++V+F C A G+PLP   W+K          I  I+       L + ++     G YTC V N++G ++YTY L V E+    P +   L  N TA++         +  D QP IQW K +  + S+F      P  +  +  +Y   +                    LI +L  +++  ED+G+Y      GNS G+++++ +L
Sbjct:  108 VLEVSDVTYEDSGLYICV-VRGTGKILRRFSISVVDS----LASGDEEDDEDGPPYWTQPHRMDKKLHAV--PAGNTVKFRCPAGGSPLPTIRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLERSSHRPILQAGLPANTTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRFGPD-DFPYVQVLKHLDYVCDLN-------------------LIEVLHLRNITMEDAGEYTCLA--GNSIGLSHQSAWL 360          

HSP 2 Score: 51.9878 bits (123), Expect = 4.049e-6
Identity = 54/252 (21.43%), Postives = 93/252 (36.90%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKG------------------KSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQ 953
            +V  G+T+K  CP   +        I W  NG +          + ++ +  L ++S+   D G YTC      G    ++++ VL+            +  ++P     L  N          VGS V+F C    +  P   W+K                       D++ ++  I   +L + NI +E AG+YTC   N +G    +  LIV    P   + ++ +   +  L     IV  + C  Q
Sbjct:  171 AVPAGNTVKFRCPAGGSPLPT----IRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLE------------RSSHRPILQAGLPAN------TTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRFGPDDFPYVQVLKHLDYVCDLNLIE--VLHLRNITMEDAGEYTCLAGNSIGLSHQSAWLIVLPTEPAESRYMDIIIYTSGFLAVAMAIVIVVLCRMQ 398          
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 78.1814 bits (191), Expect = 3.007e-14
Identity = 77/287 (26.83%), Postives = 124/287 (43.21%), Query Frame = 3
Query:  405 VLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKV-TDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQDS 1244
            VLEV  +  ED+G Y C  V G G     F I V+D     + +      +  P +     + +   H V    G++V+F C A G+PLP   W+K          I  I+       L + ++     G YTC V N++G ++YTY L V E+    P +   L  N TA++         +  D QP IQW K +  + S+F         +D      F  V+   T    T+E         + +L  +++  ED+G+Y      GNS G+++++ +L +  S
Sbjct:  102 VLEVSDVTYEDSGLYICV-VRGTGKILRRFSISVVDS----LASGDEEDDEDGPPYWTQPHRMDKKLHAV--PAGNTVKFRCPAGGSPLPTIRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLERSSHRPILQAGLPANTTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRF-------GPDD------FPYVQVLKTADINTSE---------VEVLHLRNITMEDAGEYTCLA--GNSIGLSHQSAWLIVLPS 357          
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Match: fgfr4 (fibroblast growth factor receptor 4 [Source:NCBI gene;Acc:549077])

HSP 1 Score: 76.2554 bits (186), Expect = 1.067e-13
Identity = 82/296 (27.70%), Postives = 129/296 (43.58%), Query Frame = 3
Query:  405 VLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKV-TDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQDSSD-LKKNQP 1268
            VLEV  +  ED+G Y C  V G G     F I V+         A    Q ++       M  +L  H V    G++V+F C A G+PLP   W+K          I  I+       L + ++     G YTC V N++G ++YTY L V E+    P +   L  N TA++         +  D QP IQW K +  + S+F         +D      F  V+   T    T+E         + +L  +++  ED+G+Y      GNS G+++++ +L +  S D L++ +P
Sbjct:  108 VLEVSDVTYEDSGLYICV-VRGTGKILRRFSISVV---------APYWTQPHR-------MDKKL--HAV--PAGNTVKFRCPAGGSPLPTIRWLKNGREFRGEHRIGGIQLRHQHWSLVMESVVPSDRGNYTCVVENRIGSLTYTYFLDVLERSSHRPILQAGLPANTTARVGSDVEFYCKVYSDAQPHIQWLKHIEVNGSRF-------GPDD------FPYVQVLKTADINTSE---------VEVLHLRNITMEDAGEYTCLA--GNSIGLSHQSAWLIVLPSEDFLEQAEP 358          
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Match: Fgfrl1 (fibroblast growth factor receptor-like 1 [Source:MGI Symbol;Acc:MGI:2150920])

HSP 1 Score: 101.293 bits (251), Expect = 5.711e-22
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE-----------KFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK +++ED G Y CK   G+G    ++ + ++D+                     ++Q  +P F      +++    + + VGSSV+  C A+G+P P+ +WMK   +   ++     ++   L + N+K E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   S+        N+      + FV++ T    SR     +   N  LIS  R     Q+D+G Y+        G ++++ +L +
Sbjct:   37 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRH-----NSTIDVGGQKFVVLPTGDVWSRPDGSYL---NKLLISRAR-----QDDAGMYICLGAN-TMGYSFRSAFLTV 351          
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Match: Fgfr4 (fibroblast growth factor receptor 4 [Source:MGI Symbol;Acc:MGI:95525])

HSP 1 Score: 81.2629 bits (199), Expect = 2.363e-15
Identity = 90/362 (24.86%), Postives = 143/362 (39.50%), Query Frame = 3
Query:  216 IIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIP--------TASITKQKY--KPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQDSSDL 1253
            + PIL      ++V +G  +++ C  +   +        W   G   + L+   R   +     LE+ S   ED G Y C       V        ++D+    I         ++S +   Y  +  +     + E   H V    G++V+F C AAGNP+P   W+K   +    + I  IR       L + ++     G YTC V N LG I Y+Y L V E+ P  P +   L  N TA +     ++  +  D QP IQW K V        A   P  +        V+  TD   S              + +L  ++V  ED+G+Y      GNS G++Y++ +L +    DL
Sbjct:   31 LAPILEQQEQVLTVALGQPVRLCCGRTERGRH-------WYKEG---SRLASAGR--VRGWRGRLEIASFLPEDAGRYLCLARGSMTV--VHNLTLLMDDSLTSISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAV--PAGNTVKFRCPAAGNPMPTIHWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQ--------VLKTTDINSSE-------------VEVLYLRNVSAEDAGEYTCLA--GNSIGLSYQSAWLTVLPEEDL 353          
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Match: Fgfrl1 (fibroblast growth factor receptor-like 1 [Source:MGI Symbol;Acc:MGI:2150920])

HSP 1 Score: 78.5666 bits (192), Expect = 7.389e-15
Identity = 60/232 (25.86%), Postives = 107/232 (46.12%), Query Frame = 3
Query:  546 TKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            ++Q  +P F      +++    + + VGSSV+  C A+G+P P+ +WMK   +   ++     ++   L + N+K E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   S+        N+      + FV++ T    SR     +   N  LIS  R     Q+D+G Y+        G ++++ +L +
Sbjct:   46 SQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRH-----NSTIDVGGQKFVVLPTGDVWSRPDGSYL---NKLLISRAR-----QDDAGMYICLGAN-TMGYSFRSAFLTV 260          
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 64.6994 bits (156), Expect = 2.585e-11
Identity = 44/123 (35.77%), Postives = 56/123 (45.53%), Query Frame = 3
Query:  627 GSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIR----QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKV 980
             ++V+F C AAGNP P   W+K          I  I+    Q  L + ++     G YTC V N+ G I  TYTL V E+ P  P +   L  N TA L         +  D QP IQW K V
Sbjct:    2 ANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHV 124          
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Match: Lrig1 (leucine-rich repeats and immunoglobulin-like domains 1 [Source:MGI Symbol;Acc:MGI:107935])

HSP 1 Score: 68.1662 bits (165), Expect = 2.953e-11
Identity = 45/203 (22.17%), Postives = 85/203 (41.87%), Query Frame = 3
Query:  213 NIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWID--NITSIRQPILRINNIKLEYAGQYTCKVYNQLG 815
            N++P       +++++ G+T ++ C  + +        I+W  +G  +   + + R     ++ V  +  +K +D G Y+C      G   A+  + VL+     +P                           V  VG +V F C A G+P P   W+KG       +  + T   Q +L + N+ ++ AG+YTC++ N LG
Sbjct:  598 NVLPSFTKIPHDIAIRTGTTARLECAATGHPNPQ----IAWQKDGGTDFPAARERRMHVMPDDDVFFITDVKIDDMGVYSCTAQNSAGSVSANATLTVLETPSLAVP-----------------------LEDRVVTVGETVAFQCKATGSPTPRITWLKGGRPLSLTERHHFTPGNQ-LLVVQNVMIDDAGRYTCEMSNPLG 772          
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Match: sp|Q7T2H2|FGRL1_CHICK (Fibroblast growth factor receptor-like 1 OS=Gallus gallus OX=9031 GN=FGFRL1 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 8.963e-24
Identity = 90/358 (25.14%), Postives = 155/358 (43.30%), Query Frame = 3
Query:  252 SVQIGSTLKINCP-------MSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPI---------LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            SV++G T+K+ CP       +++  K+       WT                F+   Q L++K ++SED GTY CK   G+G    ++ + V+D+    K    P  S         KQ  +P F       ++    + + VGSS++  C A+GNP P+  W+K        DN   +   I         L + N+K E +G+YTC+V+N++GEI+ TY + V ++    P +      N T            +  D +PVIQW K+V     SK+   I +         + FV++ T         E  ++ +G  ++ L      +ED+G Y+        G ++++ +L +
Sbjct:   34 SVRLGRTIKLLCPVEGDPPPLTMWMKDGRTIHSGWT---------------RFRILQQGLKIKEVESEDAGTYICKATNGFGSTNVNYTLIVIDDTSSGKNSQTPEGSNGEYEDHSGKQWAQPRFTQPA---KMRRRVIARPVGSSIRLKCVASGNPRPDITWLK--------DNKPLMPHEIGENKKKKWTLNLKNLKPEDSGKYTCRVFNKVGEINATYKVEVIQRTRSKPILTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRVEYGTESKYNSTIDV-------GGQKFVVLPTG--------EVWSRPDGSYLNKLMITRAKEEDAGMYICLGAN-TMGYSFRSAFLTV 349          
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Match: sp|Q7TQM3|FGRL1_RAT (Fibroblast growth factor receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Fgfrl1 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.088e-22
Identity = 83/340 (24.41%), Postives = 152/340 (44.71%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE-----------KFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK +++ED G Y CK   G+G    ++ + ++D+                    +++Q  +P F      +++    + + VGSSV+  C A+G+P P+ +WMK   +   ++     ++   L + N+K E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   S+        N+      + FV++ T    SR     +   N  LIS  R     Q+D+G Y+        G ++++ +L +
Sbjct:   37 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKENPGPGGSSGGQEDPVSQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTRLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRH-----NSTIDVGGQKFVVLPTGDVWSRPDGSYL---NKLLISRAR-----QDDAGMYICLGAN-TMGYSFRSAFLTV 351          
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Match: sp|Q91V87|FGRL1_MOUSE (Fibroblast growth factor receptor-like 1 OS=Mus musculus OX=10090 GN=Fgfrl1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 3.994e-21
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE-----------KFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK +++ED G Y CK   G+G    ++ + ++D+                     ++Q  +P F      +++    + + VGSSV+  C A+G+P P+ +WMK   +   ++     ++   L + N+K E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   S+        N+      + FV++ T    SR     +   N  LIS  R     Q+D+G Y+        G ++++ +L +
Sbjct:   37 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKEVEAEDAGVYVCKATNGFGSLSVNYTLIIMDDISPGKESPGPGGSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRH-----NSTIDVGGQKFVVLPTGDVWSRPDGSYL---NKLLISRAR-----QDDAGMYICLGAN-TMGYSFRSAFLTV 351          
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Match: sp|Q8N441|FGRL1_HUMAN (Fibroblast growth factor receptor-like 1 OS=Homo sapiens OX=9606 GN=FGFRL1 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.529e-21
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----KFCHIPTAS-------ITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
             ++G T+++ CP+  +          WT +G    + S   R  F+   Q L+VK ++ ED G Y CK   G+G    ++ + VLD+    K    P +S        ++Q  +P F      +++    + + VGSSV+  C A+G+P P+  WMK   +    +     ++   L + N++ E +G+YTC+V N+ G I+ TY + V ++    P +      N T            +  D +PVIQW K+V   ++        N+      + FV++ T    SR         +G  ++ L      Q+D+G Y+        G ++++ +L +
Sbjct:   41 ARLGRTVRLQCPVEGDPPP----LTMWTKDG--RTIHSGWSR--FRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPASQQWARPRFTQP---SKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRH-----NSTIDVGGQKFVVLPTGDVWSR--------PDGSYLNKLLITRARQDDAGMYICLGAN-TMGYSFRSAFLTV 355          
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Match: sp|Q8JG38|FGFR2_DANRE (Fibroblast growth factor receptor 2 OS=Danio rerio OX=7955 GN=fgfr2 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.213e-15
Identity = 95/363 (26.17%), Postives = 149/363 (41.05%), Query Frame = 3
Query:  201 TLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREA---SFYIKVLD--------EKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI----TSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQ 1238
            T   N +P+L       SV  G  LK+ CP+S          + WT    D + L  D R     +   L++     +D+G Y+C   +  G+R+    SF + V D        +            ++ +  +     + E   H V     ++V+F C AAGNP P+  W+K        D +      ++   L + ++     G YTC V NQ G I +TYTL V E+ P  P +   L  NVT ++ + A  V  +  D QP IQW +  T          LP         Y  +++T   +      T  K+    I +L   +V  ED+G+Y      GNS G++Y T +L + 
Sbjct:   41 TKNQNCVPVL------FSVHPGELLKLKCPLSGADD------VVWTK---DSSSLRPDNRTLVARD--WLQISDATPKDSGLYSC---SATGLRDCDVFSFIVNVTDAISSGDDEDDTERSDDVGADGEQMRLPYWTFPEKMEKKLHAV--PAANTVKFRCAAAGNPKPKMRWLKNAKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCLVENQYGSIDHTYTLDVVERSPHRPILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSCCGPDGLP---------YVRVLKTAGVN------TTDKE----IEVLYLPNVTFEDAGEYTCLA--GNSIGISYHTAWLTVH 360          
BLAST of Smed-NDK-4 vs. TrEMBL
Match: D4P938 (Smed-NDK-4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1216.06 bits (3145), Expect = 0.000e+0
Identity = 629/632 (99.53%), Postives = 630/632 (99.68%), Query Frame = 3
Query:  219 IPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNHGVPRAECXXXXXXXXXXXXXXXXXXXFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQIIFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN 2114
            IPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSED GTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAF VGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWSRNHGVPRAECSKSLCVGSSSASSSTNIKSFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQ+IFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN
Sbjct:    1 IPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDAGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFFVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWSRNHGVPRAECSKSLCVGSSSASSSTNIKSFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQVIFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN 632          
BLAST of Smed-NDK-4 vs. TrEMBL
Match: T1DF76 (NDL-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 330/577 (57.19%), Postives = 431/577 (74.70%), Query Frame = 3
Query:  159 ILLIVCIWLNSGVQTLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI-QDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNHGVPRAECXXXXXXXXXXXXXXXXXXXFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQIIFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQ 1886
            +L+I  +W+ S  Q +  NIIP+++ Y SN++ +IG T+ + CP+S+N++++ GF+I+W+VNG+DENMLS+D+RY+FK +N++LEV +++S+D+G Y CKGV GYGV++A FY+ V DEKFC IP  +  K K+KPCFLNSLMQNE++Y K+++DVGSSV+F+C AAG+P P+YLW KGKSSADWIDNIT IRQPILRIN + LEY+G YTCKV N +GEISYTYTLIVREK+ K+PKI N L N+TA +   A +VG+I+C+C+PV+QW K++ + S   K + LPN    EKNE++VI+E D++D  I  ET+ K+N  L+S+L+FKSV+  DSGKY+LF T GN GM+Y   YL+I +D    KKN PRL+++IAIPI ILILCFGVIFYCWSR H   R EC K  C+GSSS SSSTNIKS RSHYP ST T SA TGK SN SS   GKK S S  D         IPLL QQ+ +R FSP   GN + Q+    +++IN +  PHF +  D   +SYSK P+QQ+IFPHSNSRVSNSS PNT S  SNCSDHTN S+SN+ QP +  S++Q
Sbjct:    1 MLIIFILWI-SFQQYVYGNIIPVVYPYKSNLTSRIGGTIMLTCPISVNNEQSTGFYINWSVNGIDENMLSVDMRYQFKESNKILEVSNLRSDDSGIYICKGVNGYGVKKAVFYLVVKDEKFCRIPVNATPKTKFKPCFLNSLMQNEVSYQKIIRDVGSSVEFDCSAAGSPAPKYLWTKGKSSADWIDNITGIRQPILRINRVLLEYSGYYTCKVSNSVGEISYTYTLIVREKHSKIPKIENNLGNITANIGAQAMLVGSITCNCKPVLQWLKRIDNRSMLQKEVPLPNPRASEKNEFYVIIEPDNSD--IPIETIEKNNEVLVSVLKFKSVVPSDSGKYILFATNGNYGMSYGVTYLEIREDPESAKKNHPRLVLYIAIPIIILILCFGVIFYCWSRRHSPQRVECPKRFCIGSSSVSSSTNIKSIRSHYPGSTTTASATTGKCSNNSSI-FGKKTSMSPNDGGVQHHGNVIPLLSQQNCNRPFSPIANGNEINQD-NTINTNINTNYPPHFTNNKDVSPYSYSKMPAQQVIFPHSNSRVSNSSQPNTQSGSSNCSDHTNKSYSNN-QPQNIPSQTQ 571          
BLAST of Smed-NDK-4 vs. TrEMBL
Match: A0A0B6VN59 (Uncharacterized protein OS=Dugesia japonica OX=6161 GN=ndl-1 PE=2 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 9.289e-75
Identity = 152/414 (36.71%), Postives = 242/414 (58.45%), Query Frame = 3
Query:  165 LIVCIWLNSGVQTLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKEN--EGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVV-KDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDC-QPVIQWFKKV------TDLSKFTKA-IQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTT-----KGNSGMNYKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNHGV 1358
            + + I+    +  + N+++P L+ Y SN++ +IGS LKI CP+S  S +       ISW+V  +DEN+++ D RY F N  +  +V  +   D+G Y C+GVTG+G +EA FY+ +L+   C    ++  K+K +PCF++  M +     K + K V SS++F C A GNP P Y W  GKSSADWI  +  +R+P  +I+ ++ E+ G YTCKV N +GEIS+T+ L+V++    LPKIV++L + +        +VG I+C C  P IQW ++V      ++ +K  +  I LP+A   E  E FV+++ D ++  I  ET+   N ++ + L+F SV Q   GKYVL T      +    M+YK VYL++    +  +  P++I +I+IP+ +LILC  V+ YC+ R   V
Sbjct:    5 IFLFIFSTVKIIEMSNDLVPKLNPYQSNITREIGSNLKIECPISSASSDGGTSSLMISWSVRDIDENLVAADSRYSFTNGGRTAQVTKVTPADSGVYKCRGVTGFGSQEAIFYVNILEHNSCTAYDSNQRKRKQRPCFIDRDMMSSTNKIKTIHKKVNSSIEFRCDAEGNPKPNYKWFNGKSSADWI--MADVRKPYFKIDVLRKEHTGHYTCKVSNDIGEISFTFALVVKDSPSPLPKIVDELQSKSVPFGSSVELVGLITCKCTNPFIQWLQRVQPNEGSSNPNKNRRTYISLPHAAASETGEIFVVLDPDLSEG-IEIETIKHSNDYIETKLKFNSVRQSHDGKYVLLTMNKLDKEPLQEMSYKIVYLNVTSKPNTSEKPPKIIFYISIPLGVLILCVLVVLYCFIRRRNV 415          
BLAST of Smed-NDK-4 vs. TrEMBL
Match: Q8I0V7 (NOU-DARAKE OS=Dugesia japonica OX=6161 GN=nou-darake PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 3.383e-60
Identity = 136/396 (34.34%), Postives = 219/396 (55.30%), Query Frame = 3
Query:  219 IPILHDYSSNVSVQIGSTLKINCPMSINSKENEG-----FFISWTVNGVDENMLSMDLRYEFKNNNQVLEV-KSIKSEDTGTYTCKGVTGYGVREASFYIKVLD---EKFCHIPTASITKQKYKPCFLNSLMQN-ELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDC-QPVIQWFKKVTDLSKFTK----AIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGM---NYKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNH 1352
            IP++  Y  ++++  G  LKI CP+ ++ +  +          W + G+ E  + M+ +Y F  NN++L++ K + SED+G Y CKGVTG+G RE  F ++++D   E+ C       +K    PCF++  M++ ++T   + K+VGS+V+  C A G+P  +YLW+ GK+ A+WI N+   R P++ I N+K  Y GQYTC+V N+ G ++YTY LIV +     PKI+  L+N T +  +   I   I C+C +P+I+W K+V +     K     + LPNA+D EK E +V ++T  +  RI             ++L  +SV  + SGKYV+        +    YK VY+ I+   D    +  L+++IA+P+ IL    GVI YC  R H
Sbjct:   21 IPVVKPYKPDITLNSGEELKIECPIVLSREGTDANYPSNLMYEWNIKGLTEVSVQMNPKYSFIENNRILKLMKPVTSEDSGKYVCKGVTGFGSREVVFNVEIIDSLQERLCAEKNPKDSKLD-PPCFVDPQMRSGKIT---IRKEVGSTVKLPCDAIGSPQLKYLWLTGKTIANWIQNVEGTRGPVITIRNLKSHYTGQYTCQVRNKAGSLNYTYQLIVTDPSNNSPKILTDLSNYTFRSKENISISVEIECECKEPIIKWLKRVDNFDSSNKEQSNGLVLPNAKDSEKGELYVTLDTGVSTKRIQP-------NLFKTLLNMESVETQQSGKYVVMAINKIVNLKNFEYKVVYITIEPDKDAIGIKNNLVVYIAVPMVILASSLGVIIYCCFRRH 405          
BLAST of Smed-NDK-4 vs. TrEMBL
Match: D4P937 (Smed-NDK (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 4.517e-58
Identity = 135/398 (33.92%), Postives = 223/398 (56.03%), Query Frame = 3
Query:  219 IPILHDYSSNVSVQIGSTLKINCPMSINSKENE-----GFFISWTVNGVDENMLSMDLRYEFKNNNQVLEV-KSIKSEDTGTYTCKGVTGYGVREASFYIKVLD---EKFCHIPTASITKQKYKPCFLNSLMQ-NELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQP-VIQWFKKVTDLSKFTK----AIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMN-----YKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNH 1352
            IPI+  ++ ++++  G  LK+ CP+ ++ +  +          W + G  E  + M+ +Y F  NN++L++ K + SED+G Y CKGVTG+G RE +F ++V+D   EK C + T   +K +  PCF++ +M+  ++T   + ++VGS+V+ +C   G+   +Y W+ GK+ A+WI N   IR P L I N+K  Y G YTC+V+NQ G +++TY LIV +     PKI+  ++N T +  +   I+  I C+C+  +I+W K+V  L    K     + LPNA + EK EY++ ++T  T  R+             ++L  +SV    SGKYV+  T  N  +N     YK V++ ++   DL   +  L+++IA+P+ IL    GVI YC  R H
Sbjct:    2 IPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYE-PPCFVDPIMRTGKIT---IRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRV-------QPNLFKTVLNMESVGTHHSGKYVV--TAINKIVNLKSFEYKVVFITVELDKDLIGVKANLVVYIAVPMVILASSLGVIIYCCFRRH 386          
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 96.6709 bits (239), Expect = 1.296e-20
Identity = 86/351 (24.50%), Postives = 153/351 (43.59%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREA---SFYIKVLDEKFCHI-PTASITKQK------YKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTD--LSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKN 1262
            + ++G T+++ CP+  +          W  +G   N      R+     +  L++K +++ED G Y C+ + G+G R A   S    V + K   + PTA    Q        KP F       ++      + VGSSV+  C A G+P P   W K +      D I   RQ   L + N++ + +G+YTC+V N  G I+YTY + V E+    P +      N T +    A     +  D +PVIQW K+V     S++   +++         ++F+++ T         E  ++ +G  ++ L       ED+G Y+        G ++++ YL +     ++K+
Sbjct:   37 TARLGRTVRLPCPVEGDPPP----LWHWLKDGRTVN--PGWSRFRILRGSHSLKIKEVEAEDAGLYICRAINGFGNRSALCVSDDATVPEHKPPSLEPTAEPALQDPTGQPWAKPRFSRP---EKMRRRFREQPVGSSVRLKCSANGSPDPGITWWKDQVQMS--DPIRGKRQQWTLTLKNLQPQDSGRYTCRVSNTAGFINYTYRVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVEPGTESRYNSTLEV-------GGQHFMVLPTG--------EVWSRPDGSYLNKLAIVKARDEDAGMYICLGAN-TMGYSFRSAYLSVLPDPQVEKS 360          
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Match: fgfrl1b (fibroblast growth factor receptor like 1b [Source:ZFIN;Acc:ZDB-GENE-050201-3])

HSP 1 Score: 95.5153 bits (236), Expect = 2.781e-20
Identity = 86/351 (24.50%), Postives = 153/351 (43.59%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREA---SFYIKVLDEKFCHI-PTASITKQK------YKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP-ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTD--LSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKN 1262
            + ++G T+++ CP+  +          W  +G   N      R+     +  L++K +++ED G Y C+ + G+G R A   S    V + K   + PTA    Q        KP F       ++      + VGSSV+  C A G+P P   W K +      D I   RQ   L + N++ + +G+YTC+V N  G I+YTY + V E+    P +      N T +    A     +  D +PVIQW K+V     S++   +++         ++F+++ T         E  ++ +G  ++ L       ED+G Y+        G ++++ YL +     ++K+
Sbjct:   36 TARLGRTVRLPCPVEGDPPP----LWHWLKDGRTVN--PGWSRFRILRGSHSLKIKEVEAEDAGLYICRAINGFGNRSALCVSDDATVPEHKPPSLEPTAEPALQDPTGQPWAKPRFSRP---EKMRRRFREQPVGSSVRLKCSANGSPDPGITWWKDQVQMS--DPIRGKRQQWTLTLKNLQPQDSGRYTCRVSNTAGFINYTYRVDVIERTNSKPILTGTHPVNTTVEFGGTASFQCKVHSDVKPVIQWLKRVEPGTESRYNSTLEV-------GGQHFMVLPTG--------EVWSRPDGSYLNKLAIVKARDEDAGMYICLGAN-TMGYSFRSAYLSVLPDPQVEKS 359          
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 90.8929 bits (224), Expect = 1.879e-18
Identity = 105/397 (26.45%), Postives = 162/397 (40.81%), Query Frame = 3
Query:   72 LLNRRNLLGFICSVQSF*WNSFN*MDSVVILLIVCIWLNSGVQTLGNNIIPILHDYS--SNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCF-LNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI----TSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDI 1235
            +L    +L F CS   F             LL+V    NS    L N   P  ++ S  +  SV  G  L+++CP+       E   I WT +G   + L  D R   +  +  L+++     D+G YTC            F + V  E     P  +       P + +   M+ +L  H V     ++V+F C AAG+P P   W+K        D +      ++   L + ++     G YTC V N+ G IS+TYTL V E+ P  P +   L  N TA + + A  V  +  D QP IQW   +T          LP         Y  +++T   +      T  K+    I +L   +V  ED+G+Y      GNS G++Y + +L +
Sbjct:   39 ILKSSRILAFRCSYLGF------------CLLVVSKAGNSDESILCNREPPTKYEISKPTVCSVHPGDLLRLSCPLP------EAAAIVWTKDG---SSLGPDNRTLIERES--LQIRDATPRDSGLYTCSAEGAKHGDTLCFIVNVTGEMR---PGETGEDGAEAPRWTMPDKMEKKL--HAV--PAANTVKFRCAAAGDPTPSMHWLKNGKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCVVENKHGSISHTYTLDVVERSPHRPILQAGLPANATAHVGEDAKFVCKVYSDAQPHIQWLHHITRNGSRYGPDGLP---------YVRVLKTAGVN------TTDKE----IEVLHLPNVTFEDAGEYTCLA--GNSIGISYHSAWLTV 384          
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 87.8113 bits (216), Expect = 1.871e-17
Identity = 90/335 (26.87%), Postives = 141/335 (42.09%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCF-LNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI----TSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDI 1235
            SV  G  L+++CP+       E   I WT +G   + L  D R   +  +  L+++     D+G YTC            F + V  E     P  +       P + +   M+ +L  H V     ++V+F C AAG+P P   W+K        D +      ++   L + ++     G YTC V N+ G IS+TYTL V E+ P  P +   L  N TA + + A  V  +  D QP IQW   +T          LP         Y  +++T   +      T  K+    I +L   +V  ED+G+Y      GNS G++Y + +L +
Sbjct:   29 SVHPGDLLRLSCPLP------EAAAIVWTKDG---SSLGPDNRTLIERES--LQIRDATPRDSGLYTCSAEGAKHGDTLCFIVNVTGEMR---PGETGEDGAEAPRWTMPDKMEKKL--HAV--PAANTVKFRCAAAGDPTPSMHWLKNGKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCVVENKHGSISHTYTLDVVERSPHRPILQAGLPANATAHVGEDAKFVCKVYSDAQPHIQWLHHITRNGSRYGPDGLP---------YVRVLKTAGVN------TTDKE----IEVLHLPNVTFEDAGEYTCLA--GNSIGISYHSAWLTV 324          
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 84.3445 bits (207), Expect = 2.197e-16
Identity = 90/344 (26.16%), Postives = 142/344 (41.28%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDE----------KFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI----TSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDI 1235
            SV  G  L+++CP+       E   I WT +G   + L  D R   +  +  L+++     D+G YTC            F + V D           +     TA   + +     +   M+ +L  H V     ++V+F C AAG+P P   W+K        D +      ++   L + ++     G YTC V N+ G IS+TYTL V E+ P  P +   L  N TA + + A  V  +  D QP IQW   +T          LP         Y  +++T   +      T  K+    I +L   +V  ED+G+Y      GNS G++Y + +L +
Sbjct:   39 SVHPGDLLRLSCPLP------EAAAIVWTKDG---SSLGPDNRTLIERES--LQIRDATPRDSGLYTCSAEGAKHGDTLCFIVNVTDAISSGDDEDDSERSDDVTADGGQMQAPRWTMPDKMEKKL--HAV--PAANTVKFRCAAAGDPTPSMHWLKNGKPFRQEDRMGGYKVRLQHWTLIMESVVPSDKGNYTCVVENKHGSISHTYTLDVVERSPHRPILQAGLPANATAHVGEDAKFVCKVYSDAQPHIQWLHHITRNGSRYGPDGLP---------YVRVLKTAGVN------TTDKE----IEVLHLPNVTFEDAGEYTCLA--GNSIGISYHSAWLTV 346          
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006750.1 (pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 gene:ENSPMAG00000006079.1 transcript:ENSPMAT00000006750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 1.059e-26
Identity = 92/364 (25.27%), Postives = 161/364 (44.23%), Query Frame = 3
Query:  240 SSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKV---------LDEKFCHIPTASITKQK-------YKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFL--ISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQ----DSSDLKKN 1262
            S  V  ++G TLK++CP+  +        I W+ +G   N+ S  +RY    +   L V  ++ +D G +TC+   G+G    ++ + V         L       P AS+  QK        KP F       ++    + + VGSSV+  C A G+P P+ +W K +      D     ++  L + +++ E AG+YTC+V N+ GEIS TY + V E+    P +      N T        +   +  D +PVIQW K+V         +   N+    + + F ++ T    SR        D  +L  + I+R ++   ED+G Y+      + G ++++ +L +Q    D + +K+ 
Sbjct:   34 SERVLARVGRTLKLSCPVEGDPPP----LIMWSKDG--RNIHSGWMRYRVLRDG--LRVTELEPDDAGVFTCQATNGFGSVTINYSLAVIANITIPPYLPAPCLREPNASMQIQKPGGQPRWMKPRFTQP---AKMRRRVIARPVGSSVRLKCNAGGSPRPDVVWFKDEHVFG--DAAQGKKRWTLILRSLRPEDAGRYTCRVSNRFGEISATYKIDVIERMRSKPVLTGTHPVNTTVDFGGSTSLQCKVRSDVKPVIQWLKRVEP-----GGVHGLNSTIDVRGQRFAVLPTGEVWSR-------PDGSYLNKLVIVRARA---EDAGMYICLGAN-SMGYSFRSAFLTVQSAQSDPTKMKRE 368          
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 4.503e-13
Identity = 60/245 (24.49%), Postives = 109/245 (44.49%), Query Frame = 3
Query:  255 VQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMD-LRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK-GKSSADWIDNITSIRQPI--LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPV-IQWFK 974
            + +GST+ + C ++   +      +SW      + + S D  +  FKNN   LE++S+   DTG Y+CK    +G                 + + S++++K  P F   L   +          G++  F+C   G P   ++W K G   +   D + S  + +  L I+N+KL +AG+YTC+V+N +   S +  L  ++K  K+P    K  +        +F +  +    +P+ I W K
Sbjct: 5509 IVVGSTVHLECQVAGTPQ----IRVSWYKGS--QKLKSGDKCKMAFKNNLATLELRSLTKADTGDYSCKAENDFG-------------SATSLASLSVSERKNPPYFTRKLKDWQAVE-------GTAATFDCRVTGTPPFSFIWYKHGVELSSGEDYVISAEENVATLDIHNVKLTHAGEYTCRVFNDVDSASCSAKLEAKDK--KVPPSFEKKPDPVEVTAGESFELECLIAGSRPIRISWLK 5725          

HSP 2 Score: 68.5514 bits (166), Expect = 4.730e-12
Identity = 61/262 (23.28%), Postives = 108/262 (41.22%), Query Frame = 3
Query:  249 VSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK--------GKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPV--IQWFKKVTDLSKFTK 1004
            V   +G+ L++ C +     +++G  ++WT +G  E   S  L + FKN   VLE+   +  DTG Y C   +  G                   TAS  + K  P  L +L          VK+    V  +C   G+P+ +  W K        G+    +++N+      +L I + + E +  YTC+  N++G +S T  + V+E    +P     L ++  + +    +   +  D  P   ++W K   +L K  K
Sbjct: 4259 VKAAVGTPLRLECEVD----DDKGVTVAWTKSG-KEIRPSRKLSFTFKNKLAVLEILKSELADTGDYVCTASSEAGSES----------------TASSVEVKADPAGLRALQPE-------VKEAKGLVHLDCSLKGSPVIKVTWFKNDNEVKADGRVQLSFVNNVA-----VLEIRDSETEDSADYTCEAQNEVGTVSCTCAVSVKE----IPSFKKPLESMEVRGNSDVTL--EVELDGSPPFDVKWVKNARELPKIDK 4481          

HSP 3 Score: 65.855 bits (159), Expect = 3.008e-11
Identity = 57/205 (27.80%), Postives = 92/205 (44.88%), Query Frame = 3
Query:  387 FKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASIT-KQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWID-NITSIRQPI--LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDL 989
            F++N  VLEVK+ +  D GTY+C+     G  + S               AS+  K++  P   + +++N      + + +G   +F+    G P     W  G S   + D ++ S    +  L I ++K+  AG+YTCKV N+ G IS +  L V E+  K P    KL  V A +  PA +   ++      I W K   D+
Sbjct: 6673 FQHNTAVLEVKNFEKADVGTYSCEAENSLGSAKTS---------------ASLAGKERKHPPSFSRMLKN------MQQVIGDCAKFDARVTGTPPFHVSWFLGDSELSYSDKHVISFEDNVASLSIFSLKVSDAGEYTCKVSNEDGSISCSAKLDVTERKTK-PTFDQKLEPVEAVVGDPAELECHLTGSLPIKIFWMKDKKDI 6855          

HSP 4 Score: 59.6918 bits (143), Expect = 2.536e-9
Identity = 52/223 (23.32%), Postives = 91/223 (40.81%), Query Frame = 3
Query:  321 FFISWTVNGVDENMLSMD-LRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADW-IDNITSIRQPI--LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKK 977
              ++W+ NGV+  ++  D  R  F+ N   LE+  +   D G+YTC      G    S  + +++                 P FL  +   E+         GS   F C  +G       W KG       I +  S R  +  L +  +KL +AG+Y+C+V N  G+ S + +L V+E      K  +K +++  K    A  + +     +  + W+K+
Sbjct: 6374 ILVAWSKNGVE--IVDGDKYRCLFEENTASLEILKVDKSDDGSYTCTATNVAGRDSCSTTLSIIE----------------PPSFLMKMEPQEVLS-------GSRATFQCAVSGTEPLLVKWYKGNQELRTDISHSISFRDSVALLIVEKVKLAFAGEYSCQVSNSAGKTSCSASLFVKEP----AKFFSKPSDLDVKAGDSASFICSFVGTPKIAVNWYKE 6567          

HSP 5 Score: 53.1434 bits (126), Expect = 2.937e-7
Identity = 52/202 (25.74%), Postives = 82/202 (40.59%), Query Frame = 3
Query:  408 LEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKG--KSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREK-----YPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLS 992
            L++ + +  D+G YTCK     G    +  +KVLD                 P F+ SL   E T+       G+SV F C  AG P     W KG  K S      +      +L + N +    G Y+C+  N LG    + +L  +E+     + ++ K + ++    AK D  A + GT        + WF   ++LS
Sbjct: 6588 LDILATEISDSGNYTCKIQNDSGQDNCTALLKVLD----------------PPYFVKSLEPMEGTF-------GTSVYFECQVAGAPEIRVTWYKGSQKLSGAKYKTMFQHNTAVLEVKNFEKADVGTYSCEAENSLGSAKTSASLAGKERKHPPSFSRMLKNMQQVIGDCAKFD--ARVTGTPPFH----VSWFLGDSELS 6760          

HSP 6 Score: 50.0618 bits (118), Expect = 2.397e-6
Identity = 45/167 (26.95%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLR-YEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNIT---SIRQPILRINNIKLEYAGQYTCKVYNQLG 815
            I+WT +  D+++ +   R   FKNN  ++ +KS K  D+G Y CK     G   A+F +           T +I ++K+ P F   +    LT   VV+  G ++  +C  +G+   + +W+K +        ++   S     L I+ +    AG+YTCK  N+ G
Sbjct: 6944 ITWTKD--DKDLHAHPGRELSFKNNIALMSLKSTKVSDSGLYVCKAENEAGT--ATFKV-----------TLNIKERKHAPNFDKKVQS--LT---VVE--GDTLSASCRVSGSEPLQIMWLKDRKEVQPFGKVSIAYSEGDCTLEISQVTKADAGEYTCKAVNEAG 7088          

HSP 7 Score: 49.6766 bits (117), Expect = 3.038e-6
Identity = 51/228 (22.37%), Postives = 89/228 (39.04%), Query Frame = 3
Query:  327 ISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMK-------GKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDL 989
            +SW   GV+E   S   +  F++N   +E+ +    D GTYTCK     G       +KV++                 P F   +   E          G+ V F    +G       W K        ++S     N+++    ++ ++ +    AG+Y+C+V N +G  + + TL V+E      K   KL +    L   A    T +   +  ++WF+K  +L
Sbjct: 4749 VSW-FKGVEEISDSDKFKISFEDNTAKVEILNASQVDEGTYTCKADNAAGTDSCWAKVKVME----------------PPSFKEVIKPQEAL-------PGAVVSFTSVVSGTDPLSVKWFKDGTELLPSRNSRISFKNLSA----VIELDKVDSTAAGEYSCQVSNAVGTETCSATLFVKEP----AKFETKLQSTNVNLGDTASFNCTFTGTPEITVRWFRKDEEL 4944          

HSP 8 Score: 48.521 bits (114), Expect = 7.265e-6
Identity = 40/139 (28.78%), Postives = 60/139 (43.17%), Query Frame = 3
Query:  426 KSEDTGTYTC--KGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYK---PCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP---ILRINNIKLEYAGQYTCKVYNQLGE 818
            ++ D G Y+C  K V G         ++     F  +P  S    K     P FL  L     T  KV ++   ++ F C   G P PE LWMK +     + N+   ++    IL+I ++K   AG Y C+  N +GE
Sbjct: 2707 RASDAGDYSCVAKNVVGE--------VECCSALFVEMPAESSVDNKVSETPPAFLKPL-----TGKKVYEN--GTLIFVCEVVGKPPPEVLWMKDRRLIQPLSNVVMEQEGCHYILQIKDVKPTDAGVYVCEATNFIGE 2830          
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001917.1 (pep scaffold:Pmarinus_7.0:GL476868:2429:11074:1 gene:ENSPMAG00000001743.1 transcript:ENSPMAT00000001917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.204e-10
Identity = 43/167 (25.75%), Postives = 78/167 (46.71%), Query Frame = 3
Query:  747 LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFL--ISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQ 1238
            L + +++ E +G+YTC+V+N  GEI+ TY + V ++    P +      N T ++     +   +  D +PV+QW K+V   S+        NA      + FV++      SR        D  FL  + I R ++   ED+G Y+        G ++++ +L +Q
Sbjct:   16 LTLKSLRAEDSGRYTCRVFNTAGEINATYRVDVVQRLRSKPVLTGTHPVNTTVEMGGTTSLQCKVRSDVRPVVQWLKRVEPGSERHH-----NATLDVGGQRFVVLPAGDVWSR-------PDGSFLNKLVIARARA---EDAGMYICLGAN-TMGYSFRSAFLTVQ 166          
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 62.7734 bits (151), Expect = 1.713e-10
Identity = 65/218 (29.82%), Postives = 99/218 (45.41%), Query Frame = 3
Query:  627 GSSVQFNCFAAGNPLPEYLWMK-GKS--SADWIDNITSIRQPI-LRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL-TNVTAKLDKPAFIVGTISCDCQPVIQWFKKV-TDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQDSSDLKK 1259
             ++V+F C AAGNP P   W+K G+   S   +  I   +Q   L + ++     G YTC V N+ G I++TY L V E+ P  P +   L  N TA           +  D QP IQW K V  + SKF            + + Y  +++  S+       T  K+    I +L   +V  ED+G+Y      GNS G  Y T +L++   + +K+
Sbjct:   26 ANTVKFRCPAAGNPPPVIRWLKNGREFRSEHRMGGIKLRQQHWSLIMESVVPSDRGNYTCMVENRYGSINHTYQLDVVERSPHRPILQAGLPANKTAVQGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKF----------GPDGSPYVQVLKVRSSS------TTDKE----IEVLYLWNVTFEDAGEYTCLA--GNSIGFAYHTAWLNVVPEATVKE 221          
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004023.1 (pep scaffold:Pmarinus_7.0:GL478897:537:36338:-1 gene:ENSPMAG00000003678.1 transcript:ENSPMAT00000004023.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 2.552e-8
Identity = 41/154 (26.62%), Postives = 62/154 (40.26%), Query Frame = 3
Query:  387 FKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVR 848
               +N VLE+ +++ EDTG+Y CK     G   A   I V      + P          P +L  +   E       + +G ++Q+ C A G P P Y WMK          +  +    L + N+K    G + C   N+ G I  +  L VR
Sbjct:  213 LSKSNAVLELPNVQPEDTGSYECKAANSAGRNTAQGKITV------YAP----------PQWLEPISDVE-------QGLGDTLQWECKATGKPQPAYKWMKDGVLVGAEGRVRVLESGDLIVGNVKPSDRGMFQCVAENKHGRIYSSAELRVR 343          
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 65.855 bits (159), Expect = 4.163e-11
Identity = 63/294 (21.43%), Postives = 117/294 (39.80%), Query Frame = 3
Query:  222 PILHDYSSNVSVQIGSTLKINCPMSINSKENEGF---FISWTV-NGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRIT 1091
            P+L     +VSV +G  +K+ C  +       G+    ISW + +G  +   + + R E   +  +  +++ +  DTG YTC    G G   A+ Y+ VL+                 P F+ S++   +         G S    C A+G+P+P + W K          + +  Q ++ +  ++ +  G YTC+V N LG       L V E   +L    +K +    K      ++  ++C     + W   +    + +          K +   F    TD+T+S++T
Sbjct:  640 PVLTRKPHDVSVHVGGLIKLPCAAT-------GYPVPVISWRMGDGKSKFPAAEEKRIEHLPSEHLFIIRNARGVDTGAYTCTATNGAGSINATAYVTVLE----------------VPRFMQSMVSKRVR-------TGESAVLECKASGSPMPRFTWYKDDKKVTLSARVVAHGQLLVFVTVLR-DDEGTYTCQVSNSLGTARQNTRLTVVEG-SELQTCQDKESRYDKKTFLGIIVISVVTCVVGTSLVWLLVIYCARRGSH-----RRRHKLRARPFQADGTDTTNSKLT 896          
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Match: EDO49191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA4])

HSP 1 Score: 64.3142 bits (155), Expect = 1.047e-10
Identity = 60/209 (28.71%), Postives = 91/209 (43.54%), Query Frame = 3
Query:  624 VGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNI-TSIR--QPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNS-GMNYKTVYLDIQ 1238
            VG+S++ +C A G P P  +W+K        D +  S+R  Q +L + +      G+YTC V N LG I++TYT+ VRE+    P ++  + NVT    + A +      D  P  QW +       FT  +   N    E    F +V+       I          F    L   +V +ED GKY      GN+ G N +  YL ++
Sbjct:   11 VGNSLKLDCSADGKPRPTVVWLKNGKPFLKRDGVELSLRPYQYVLSMRDAVPSDDGRYTCNVSNALGWINHTYTVDVRERVRAKP-VLQPIANVTVLSGENATLECKAMSDSMPHFQWIR------WFTARV---NGSSNETTLRFEVVKQTPHSDHILRPKSEHRFAFHGVKLTLFNVSKEDEGKYTCLV--GNAVGYNAENGYLIVK 207          
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Match: EDO32002 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB1])

HSP 1 Score: 56.9954 bits (136), Expect = 9.269e-10
Identity = 41/116 (35.34%), Postives = 55/116 (47.41%), Query Frame = 3
Query:  627 GSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFK 974
            G S+  NC A G P P   W K   SA    NIT+  + I +I +++   AG+YTC   N++G +S T ++ V   YP  P IV    N TA L     +    S    P I W K
Sbjct:    4 GESLTLNCTATGCPTPNITWTKQGVSAALRSNITT--EIIHQIASVQKSDAGRYTCAANNEIGAVSRTLSVTVH--YP--PTIVTTPKNTTAYLGGNVTLYCNASSHPAPQIYWAK 113          
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Match: EDO49558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM2])

HSP 1 Score: 57.7658 bits (138), Expect = 1.128e-8
Identity = 64/291 (21.99%), Postives = 111/291 (38.14%), Query Frame = 3
Query:  180 WLNSGVQTLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSK---------ENEGFFISWTVNG--------------VDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKS---SADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFK 974
            W ++G      + + I+HD   +      S + ++CP+ ++ K         EN+   +   V G              ++EN     +R     +  VL +++ + +D   YTCK +   G  E S  +   DE                P FL  L   E+         GS        +G P P   W+K       +  +   T  +   L I N  L+  G+YTC   N++GE+S T  L+V E   + P+ + K +++     K A     +S    P ++W +
Sbjct:  136 WYHNGKLVQPRDHVDIVHDDEHS------SLILMHCPLDLSGKYTCVAENEVENDAVRLEVEVTGEPKPVVLWFCEGKPIEENRRVYTMR---DGSTSVLVIENAELDDEAMYTCKAINDLGEVECSSEMLPTDEA--------------GPKFLQRLELKEVVE-------GSRTDLEVEVSGKPKPVVEWLKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVGEVSCTAELLVEEGM-RPPQFIVKPSSLQIMEGKMAKFEARVSGLPGPEVEWLR 395          
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Match: EDO30350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T115])

HSP 1 Score: 54.6842 bits (130), Expect = 2.081e-8
Identity = 30/88 (34.09%), Postives = 46/88 (52.27%), Query Frame = 3
Query:  627 GSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLT 890
            G S+  NC A G P P   W K   SA    NIT+  + I +I +++  +AG+YTC   N++G +S T ++ V    P +  I   +T
Sbjct:   81 GESLTLNCTATGCPTPNITWTKHGVSAALRSNITT--EIIHQIASVQKSHAGRYTCAANNEIGTVSRTLSVTVHSA-PSITFITANMT 165          
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 106.686 bits (265), Expect = 7.415e-24
Identity = 85/342 (24.85%), Postives = 156/342 (45.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFC------HIPTASITKQKY-KPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITT----ETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            + ++GS +K+ CP+  +        I WT +  D N+ S  +R  F+     L++K ++++D GTY CK   G+G    ++ + V+D+             + ++ +K+ +P F       ++    + + VGSSV+  C A+GNP P+ +W+K          +   RQ    L + N+  +++G+YTC+V NQ GEI+ TY + V ++    P +      N T            +  D +PVIQW K+V               E  E+N Y   +E +  D R       E  ++ +G  ++ L      +ED+G Y+        G ++++ +L +
Sbjct:   34 TARLGSAIKMPCPVEGDPPP----LIMWTKD--DRNIHSGWIR--FRILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQP---TKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLT-EQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRV---------------EPHEENRYNSTIEVE--DHRFAVLPAGEVWSRPDGSYLNKLLITRAKEEDAGMYICLGA-NTMGYSFRSAFLTV 345          
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 105.531 bits (262), Expect = 2.547e-23
Identity = 85/342 (24.85%), Postives = 156/342 (45.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFC------HIPTASITKQKY-KPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITT----ETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            + ++GS +K+ CP+  +        I WT +  D N+ S  +R  F+     L++K ++++D GTY CK   G+G    ++ + V+D+             + ++ +K+ +P F       ++    + + VGSSV+  C A+GNP P+ +W+K          +   RQ    L + N+  +++G+YTC+V NQ GEI+ TY + V ++    P +      N T            +  D +PVIQW K+V               E  E+N Y   +E +  D R       E  ++ +G  ++ L      +ED+G Y+        G ++++ +L +
Sbjct:   82 TARLGSAIKMPCPVEGDPPP----LIMWTKD--DRNIHSGWIR--FRILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQP---TKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLT-EQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRV---------------EPHEENRYNSTIEVE--DHRFAVLPAGEVWSRPDGSYLNKLLITRAKEEDAGMYICLGA-NTMGYSFRSAFLTV 393          
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Match: fgfrl1a (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101165069])

HSP 1 Score: 104.76 bits (260), Expect = 2.734e-23
Identity = 84/347 (24.21%), Postives = 159/347 (45.82%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCH-----IP-----TASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSI------RQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            S ++G T+K++CP+  +        I WT +G   N+ S   R  FK     L +K ++++D GTY CK   G+G    ++ + V+D+         +P     T  +  +  +P F       ++    + +  GSSV+  C A+GNP P+ +W+  K S   +D  +        ++  L + N+  E++G+YTC+V N+ GEI+ TY + V ++    P +      N T            +  D +PVIQW K++   D +KF   +++        ++ FV++           E  ++ +G  ++ L      ++D+G Y+        G N+++ +L +
Sbjct:   34 SARLGRTVKLSCPVESDPPP----LIMWTKDG--RNIHSGWTR--FKVLQAALRIKEVETDDAGTYICKATNGFGSVNVNYTLIVIDDSSSRNGAGPVPADGEDTLELAGKLVRPRFTEP---AKMRKRVIARPEGSSVRLKCTASGNPRPDIVWL--KDSRPLVDEDSGAGGEGRKKKWTLILKNLLPEHSGKYTCQVSNRAGEINATYKVEVIQRTNCKPILTGTHPVNTTVDYGGSTSFQCKVRSDVKPVIQWLKRLDPGDENKFNSTLEV-------GDDRFVVLPAG--------EVWSRPDGSYLNKLLITRAKEDDAGMYICLGAN-TMGYNFRSAFLTV 351          
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Match: FGFRL1 (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101156129])

HSP 1 Score: 104.76 bits (260), Expect = 3.202e-23
Identity = 85/342 (24.85%), Postives = 156/342 (45.61%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFC------HIPTASITKQKY-KPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP--ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITT----ETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            + ++GS +K+ CP+  +        I WT +  D N+ S  +R  F+     L++K ++++D GTY CK   G+G    ++ + V+D+             + ++ +K+ +P F       ++    + + VGSSV+  C A+GNP P+ +W+K          +   RQ    L + N+  +++G+YTC+V NQ GEI+ TY + V ++    P +      N T            +  D +PVIQW K+V               E  E+N Y   +E +  D R       E  ++ +G  ++ L      +ED+G Y+        G ++++ +L +
Sbjct:   53 TARLGSAIKMPCPVEGDPPP----LIMWTKD--DRNIHSGWIR--FRILRMGLKIKEVEADDAGTYICKATNGFGSVNINYTLIVIDDPGSDKTGKPEGAKSELSIEKFVRPRFSQP---TKMRKRVIARPVGSSVRLKCAASGNPRPDIIWLKDDRPLT-EQEVGEGRQKKWTLSLRNLMPQHSGRYTCRVSNQAGEINATYKVEVIQRTNSKPVLTGTHPVNTTVDYGGTTSFQCKVRSDVKPVIQWLKRV---------------EPHEENRYNSTIEVE--DHRFAVLPAGEVWSRPDGSYLNKLLITRAKEEDAGMYICLGA-NTMGYSFRSAFLTV 364          
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Match: fgfrl1a (fibroblast growth factor receptor-like 1 [Source:NCBI gene;Acc:101165069])

HSP 1 Score: 103.99 bits (258), Expect = 4.729e-23
Identity = 84/339 (24.78%), Postives = 153/339 (45.13%), Query Frame = 3
Query:  252 SVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHK--VVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSI------RQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVN-KLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVT--DLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDI 1235
            S ++G T+K++CP+  +        I WT +G   N+ S   R  FK     L +K ++++D GTY CK   G+G    ++ + V+            TK   K  F+           K  + +  GSSV+  C A+GNP P+ +W+K   S   +D  +        ++  L + N+  E++G+YTC+V N+ GEI+ TY + V ++    P +      N T            +  D +PVIQW K++   D +KF   +++        ++ FV++           E  ++ +G  ++ L      ++D+G Y+        G N+++ +L +
Sbjct:   35 SARLGRTVKLSCPVESDPPP----LIMWTKDG--RNIHSGWTR--FKVLQAALRIKEVETDDAGTYICKATNGFGSVNVNYTLIVI---------GRCTKNYLKSIFVRPRFTEPAKMRKRVIARPEGSSVRLKCTASGNPRPDIVWLK--DSRPLVDEDSGAGGEGRKKKWTLILKNLLPEHSGKYTCQVSNRAGEINATYKVEVIQRTNCKPILTGTHPVNTTVDYGGSTSFQCKVRSDVKPVIQWLKRLDPGDENKFNSTLEV-------GDDRFVVLPAG--------EVWSRPDGSYLNKLLITRAKEDDAGMYICLGAN-TMGYNFRSAFLTV 338          
BLAST of Smed-NDK-4 vs. Planmine SMEST
Match: SMESG000009032.1 (SMESG000009032.1)

HSP 1 Score: 1263.06 bits (3267), Expect = 0.000e+0
Identity = 653/657 (99.39%), Postives = 654/657 (99.54%), Query Frame = 3
Query:  144 MDSVVILLIVCIWLNSGVQTLGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNHGVPRAECXXXXXXXXXXXXXXXXXXXFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQIIFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN 2114
            MDSVVILLIVCIWLNSGVQT GNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSED GTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAF VGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWSRNHGVPRAECSKSLCVGSSSASSSTNIKSFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQ+IFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN
Sbjct:    1 MDSVVILLIVCIWLNSGVQTHGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDAGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFFVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMNYKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWSRNHGVPRAECSKSLCVGSSSASSSTNIKSFRSHYPPSTGTGSAATGKYSNGSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQEPLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQVIFPHSNSRVSNSSHPNTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSPSSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGPDYFPGQN 657          
BLAST of Smed-NDK-4 vs. Planmine SMEST
Match: SMESG000077310.1 (SMESG000077310.1)

HSP 1 Score: 254.988 bits (650), Expect = 2.348e-74
Identity = 151/418 (36.12%), Postives = 245/418 (58.61%), Query Frame = 3
Query:  171 VCIWLNSGVQT--LGNNIIPILHDYSSNVSVQIGSTLKINCPMSINSKENEG----FFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVV---KDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQPVIQWFKKV------TDLSKFTKA-IQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTT-----KGNSGMNYKTVYLDI-----QDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSR 1346
            + ++L S +Q   + ++ +P+++ Y  N++ + GS L++ CP+S  S+  +G       SW++  + EN+++ D RY F +  +   V  +K  D+G Y C+GVTG+G +EA F + +L+   C +  +S  + K +PCFL+  M+  L+ +KV    K+V SSV+F C A GNP P Y W  GK+SADW+  +  +R+P  RI  +  E+ G YTCKVYN +GEIS+T+ L+V++     PK V++L N T  +   A +  +I C C P +QW ++V      T+ +K  K  I LP+A   E  E F  ++ D  +  I TE + + NG +IS L+F+SV   ++GKYVL T      +    M YKTVYL++        ++   N P++I++I++P+ +LILC  V+FYC+ R
Sbjct:    5 IILFLLSTIQIAEMSSDSVPVINPYEMNITKETGSNLELVCPIS--SQNTDGGPSNLMFSWSIKDIHENLVAADSRYSFPDGGRRALVTKVKPADSGVYKCRGVTGFGNQEAIFNVNILEHNSCSVDESSENQVKQRPCFLDQHMK--LSMNKVTTIHKNVNSSVEFRCDAGGNPKPSYKWFNGKASADWL--MEDVRRPYFRIKVLNKEHTGHYTCKVYNAIGEISFTFGLVVKDSPSPQPKFVDELHNKTVLIGSSAELSASIICKCTPFVQWLRRVPLNYRQTNSNKHKKTFIYLPHAAASESGENFETLDQDPVEG-IETENITQPNGLVISKLKFRSVKPWNAGKYVLLTVSMLNKQDVHEMTYKTVYLNVISDRTTSMNNKANNPPKIIVYISVPLGVLILCVLVVFYCFIR 415          
BLAST of Smed-NDK-4 vs. Planmine SMEST
Match: SMESG000062038.1 (SMESG000062038.1)

HSP 1 Score: 214.542 bits (545), Expect = 3.767e-61
Identity = 134/398 (33.67%), Postives = 223/398 (56.03%), Query Frame = 3
Query:  219 IPILHDYSSNVSVQIGSTLKINCPMSINSKENE-----GFFISWTVNGVDENMLSMDLRYEFKNNNQVLEV-KSIKSEDTGTYTCKGVTGYGVREASFYIKVLD---EKFCHIPTASITKQKYKPCFLNSLMQ-NELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQP-VIQWFKKVTDLSKFTK----AIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMN-----YKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNH 1352
            IPI+  ++ ++++  G  LK+ CP+ ++ +  +          W + G  E  + M+ +Y F  NN++L++ K + SED+G Y CKGVTG+G RE +F ++V+D   EK C + T   +K +  PCF++ +M+  ++T   + ++VGS+V+ +C   G+   +Y W+ GK+ A+WI N   IR P L I N+K  Y G YTC+V+NQ G +++TY LIV +     PKI+  ++N T +  +   I+  I C+C+  +I+W K+V  L    K     + LPNA + EK EY++ ++T  T  R+             ++L  +SV    SGKYV+  T  N  +N     YK V++ ++   D+   +  L+++IA+P+ IL    GVI YC  R H
Sbjct:   13 IPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYE-PPCFVDPIMRTGKIT---IRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRV-------QPNLFKTVLNMESVGTHHSGKYVV--TAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRH 397          
BLAST of Smed-NDK-4 vs. Planmine SMEST
Match: SMESG000062038.1 (SMESG000062038.1)

HSP 1 Score: 213.772 bits (543), Expect = 7.298e-61
Identity = 134/398 (33.67%), Postives = 223/398 (56.03%), Query Frame = 3
Query:  219 IPILHDYSSNVSVQIGSTLKINCPMSINSKENE-----GFFISWTVNGVDENMLSMDLRYEFKNNNQVLEV-KSIKSEDTGTYTCKGVTGYGVREASFYIKVLD---EKFCHIPTASITKQKYKPCFLNSLMQ-NELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTNVTAKLDKPAFIVGTISCDCQP-VIQWFKKVTDLSKFTK----AIQLPNAEDKEKNEYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTKGNSGMN-----YKTVYLDIQDSSDLKKNQPRXXXXXXXXXXXXXXXXGVIFYCWSRNH 1352
            IPI+  ++ ++++  G  LK+ CP+ ++ +  +          W + G  E  + M+ +Y F  NN++L++ K + SED+G Y CKGVTG+G RE +F ++V+D   EK C + T   +K +  PCF++ +M+  ++T   + ++VGS+V+ +C   G+   +Y W+ GK+ A+WI N   IR P L I N+K  Y G YTC+V+NQ G +++TY LIV +     PKI+  ++N T +  +   I+  I C+C+  +I+W K+V  L    K     + LPNA + EK EY++ ++T  T  R+             ++L  +SV    SGKYV+  T  N  +N     YK V++ ++   D+   +  L+++IA+P+ IL    GVI YC  R H
Sbjct:   21 IPIVKPFNPDITLNSGEELKLECPIVMSREGTDVNYPSNLMYEWNIKGQTEVSVQMNTKYSFIENNRILKLTKPVTSEDSGKYFCKGVTGFGSREVAFNVEVIDSSQEKLCAVKTPKDSKYE-PPCFVDPIMRTGKIT---IRREVGSTVKLSCEVRGSQPMKYTWLSGKTLANWILNTEGIRGPHLTIPNLKTHYTGHYTCQVHNQAGGLNFTYHLIVTDPPNNSPKILTDISNYTFRSKENISIIVEIECECKDLIIKWLKRVDRLDPSNKEHSYGLSLPNAMESEKGEYYLTIDTGVTTVRV-------QPNLFKTVLNMESVGTHHSGKYVV--TAINKIVNLKSFEYKVVFITVELDKDIIGVKANLVVYIAVPMVILASSLGVIIYCCFRRH 405          
BLAST of Smed-NDK-4 vs. Planmine SMEST
Match: SMESG000064665.1 (SMESG000064665.1)

HSP 1 Score: 53.5286 bits (127), Expect = 5.966e-7
Identity = 52/226 (23.01%), Postives = 89/226 (39.38%), Query Frame = 3
Query:  222 PILHDYSSNVSVQIGSTLKINCPMSINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTGTYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQNELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGK----SSADWIDNITSIRQPILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKL 887
            PI H    ++ V + S +   C +  +S      FI W   G  +N +S+  R    NN  ++ + ++K ED+G Y C+     G+ E  + + V+                  P F+        T   +   VG  V   C A+G P P+  W        S  D  + I       L I++++ + +G+Y C   + +G      TL V       P I++K+
Sbjct:  186 PIFHILPKHLQVMVSSHILFPCLVIGDSP----MFIQWYKLGSGKNDISLS-RTALSNNCSMI-INNVKLEDSGAYVCRARNSGGITEIIYKLSVISF----------------PSFIE-------TPENIRTTVGEKVALRCSASGVPAPKVFWWHTNQYFLSDIDNNNRIIVFENGTLSISSVRSKDSGKYYCYASSFVGVSRSEATLFVDAPKGMFPPIISKV 382          
The following BLAST results are available for this feature:
BLAST of Smed-NDK-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFRL19.430e-2224.41fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL19.430e-2224.41fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL19.430e-2224.41fibroblast growth factor receptor like 1 [Source:H... [more]
FGFRL19.430e-2224.41fibroblast growth factor receptor like 1 [Source:H... [more]
FGFR41.328e-1328.37fibroblast growth factor receptor 4 [Source:HGNC S... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igcm-41.382e-1621.16ImmunoGlobulin-like Cell adhesion Molecule family ... [more]
pxn-11.041e-1027.35Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
him-41.136e-923.67High Incidence of Males (Increased X chromosome lo... [more]
him-41.186e-923.67High Incidence of Males (Increased X chromosome lo... [more]
him-41.248e-923.67High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
robo23.281e-1124.84gene:FBgn0002543 transcript:FBtr0329985[more]
robo23.338e-1124.84gene:FBgn0002543 transcript:FBtr0077941[more]
robo32.072e-823.81gene:FBgn0041097 transcript:FBtr0077921[more]
robo32.072e-823.81gene:FBgn0041097 transcript:FBtr0335384[more]
Dscam11.222e-722.54gene:FBgn0033159 transcript:FBtr0111058[more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfrl1a2.588e-2525.59fibroblast growth factor receptor like 1a [Source:... [more]
fgfrl1b1.169e-2124.44fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b1.645e-2124.44fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b1.645e-2124.44fibroblast growth factor receptor like 1b [Source:... [more]
fgfr21.631e-1625.83fibroblast growth factor receptor 2 [Source:NCBI g... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca1.139e-2324.64propionyl-CoA carboxylase subunit alpha [Source:Xe... [more]
pcca1.314e-2324.64propionyl-CoA carboxylase subunit alpha [Source:Xe... [more]
fgfr42.956e-1426.24fibroblast growth factor receptor 4 [Source:NCBI g... [more]
fgfr43.007e-1426.83fibroblast growth factor receptor 4 [Source:NCBI g... [more]
fgfr41.067e-1327.70fibroblast growth factor receptor 4 [Source:NCBI g... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgfrl15.711e-2224.41fibroblast growth factor receptor-like 1 [Source:M... [more]
Fgfr42.363e-1524.86fibroblast growth factor receptor 4 [Source:MGI Sy... [more]
Fgfrl17.389e-1525.86fibroblast growth factor receptor-like 1 [Source:M... [more]
Fgfr32.585e-1135.77fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Lrig12.953e-1122.17leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Smed-NDK-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T2H2|FGRL1_CHICK8.963e-2425.14Fibroblast growth factor receptor-like 1 OS=Gallus... [more]
sp|Q7TQM3|FGRL1_RAT9.088e-2224.41Fibroblast growth factor receptor-like 1 OS=Rattus... [more]
sp|Q91V87|FGRL1_MOUSE3.994e-2124.41Fibroblast growth factor receptor-like 1 OS=Mus mu... [more]
sp|Q8N441|FGRL1_HUMAN4.529e-2124.41Fibroblast growth factor receptor-like 1 OS=Homo s... [more]
sp|Q8JG38|FGFR2_DANRE1.213e-1526.17Fibroblast growth factor receptor 2 OS=Danio rerio... [more]
back to top
BLAST of Smed-NDK-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D4P9380.000e+099.53Smed-NDK-4 (Fragment) OS=Schmidtea mediterranea OX... [more]
T1DF760.000e+057.19NDL-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0B6VN599.289e-7536.71Uncharacterized protein OS=Dugesia japonica OX=616... [more]
Q8I0V73.383e-6034.34NOU-DARAKE OS=Dugesia japonica OX=6161 GN=nou-dara... [more]
D4P9374.517e-5833.92Smed-NDK (Fragment) OS=Schmidtea mediterranea OX=7... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfrl1b1.296e-2024.50fibroblast growth factor receptor like 1b [Source:... [more]
fgfrl1b2.781e-2024.50fibroblast growth factor receptor like 1b [Source:... [more]
fgfr21.879e-1826.45fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fgfr21.871e-1726.87fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fgfr22.197e-1626.16fibroblast growth factor receptor 2 [Source:NCBI g... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006750.11.059e-2625.27pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 g... [more]
ENSPMAT00000002502.14.503e-1324.49pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000001917.11.204e-1025.75pep scaffold:Pmarinus_7.0:GL476868:2429:11074:1 ge... [more]
fgfr21.713e-1029.82fibroblast growth factor receptor 2 [Source:NCBI g... [more]
ENSPMAT00000004023.12.552e-826.62pep scaffold:Pmarinus_7.0:GL478897:537:36338:-1 ge... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Smed-NDK-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481794.163e-1121.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491911.047e-1028.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320029.269e-1035.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495581.128e-821.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303502.081e-834.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Smed-NDK-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFRL17.415e-2424.85fibroblast growth factor receptor-like 1 [Source:N... [more]
FGFRL12.547e-2324.85fibroblast growth factor receptor-like 1 [Source:N... [more]
fgfrl1a2.734e-2324.21fibroblast growth factor receptor-like 1 [Source:N... [more]
FGFRL13.202e-2324.85fibroblast growth factor receptor-like 1 [Source:N... [more]
fgfrl1a4.729e-2324.78fibroblast growth factor receptor-like 1 [Source:N... [more]
back to top
BLAST of Smed-NDK-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009032.10.000e+099.39SMESG000009032.1[more]
SMESG000077310.12.348e-7436.12SMESG000077310.1[more]
SMESG000062038.13.767e-6133.67SMESG000062038.1[more]
SMESG000062038.17.298e-6133.67SMESG000062038.1[more]
SMESG000064665.15.966e-723.01SMESG000064665.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034720
GenBankADD84675.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034720 ID=SMED30034720|Name=Smed-NDK-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2178bp
AATCGAAATAATAATTTTCTGCTCAATGATTATTTTATTAATTTCACATT
CATTTCTCAACGTTTATAACATTATTGAATCGACGAAATTTGCTAGGATT
TATTTGTTCTGTTCAATCATTCTAATGGAATTCCTTTAACTAGATGGATT
CGGTTGTCATTCTGCTCATCGTATGCATTTGGTTGAATAGTGGAGTTCAA
ACACTTGGAAACAATATCATACCGATTCTGCATGATTACTCCAGCAATGT
GTCGGTGCAAATCGGTTCCACGTTAAAAATCAACTGTCCAATGTCAATAA
ACTCAAAAGAGAATGAAGGATTCTTCATTAGCTGGACAGTGAATGGAGTA
GATGAGAATATGCTGTCCATGGATTTAAGATATGAATTTAAGAACAATAA
TCAAGTGTTAGAGGTCAAAAGTATAAAATCAGAAGATACAGGAACTTACA
CATGCAAAGGAGTTACAGGGTATGGAGTTCGTGAGGCATCATTCTATATT
AAGGTTCTTGATGAAAAATTTTGCCATATACCAACGGCGTCAATCACCAA
ACAAAAATATAAGCCGTGCTTCCTTAATTCACTGATGCAAAATGAATTAA
CCTACCATAAAGTAGTTAAAGATGTCGGATCATCAGTTCAGTTCAACTGT
TTTGCAGCAGGGAACCCTCTTCCAGAATACTTGTGGATGAAAGGCAAATC
GTCCGCAGATTGGATTGATAATATTACCAGTATTCGTCAGCCTATTTTGC
GAATAAATAACATCAAATTGGAATATGCCGGCCAATACACCTGTAAAGTG
TACAATCAGTTGGGAGAAATTTCCTATACTTACACTTTAATTGTACGAGA
AAAATATCCTAAACTTCCGAAAATTGTTAATAAGTTGACAAATGTTACAG
CAAAACTTGATAAACCGGCATTTATTGTTGGAACTATATCCTGTGATTGT
CAACCAGTAATTCAATGGTTCAAAAAAGTCACTGACCTATCAAAATTTAC
CAAAGCAATCCAACTGCCTAATGCTGAAGATAAAGAAAAAAATGAATATT
TTGTCATAGTTGAAACTGACTCGACTGATTCTCGGATCACGACAGAGACT
GTTGCCAAAGACAATGGATTTCTGATCTCTATTTTACGGTTTAAGTCTGT
TATTCAAGAGGATTCTGGAAAATATGTTCTGTTTACCACAAAAGGCAATT
CCGGAATGAACTATAAAACTGTTTATTTAGATATTCAAGATTCATCCGAT
TTGAAAAAAAATCAACCTAGATTAATTATTTTTATTGCAATACCGATATT
TATACTTATTCTCTGCTTCGGTGTGATATTTTACTGTTGGTCGAGAAATC
ATGGAGTTCCAAGAGCCGAATGCTCTAAATCATTATGCGTTGGATCTAGC
TCAGCTTCCAGTTCAACTAATATTAAATCATTCAGAAGTCATTATCCACC
AAGTACTGGAACCGGTTCGGCTGCTACTGGTAAATATTCAAATGGATCCT
CTTTTACAATGGGGAAGAAAAATTCTTCGAGTACAACAGATAACACTCAA
CCCCAATCTATGGGTGGAATACCATTATTACCTCAACAAAGTAGCAGTAG
ATCATTCTCTCCCGCAGTTACTGGAAACGTTCTTATTCAAGAACCATTAA
TGTTTGATTCGAGTATCAATGCTTCAACTGCACCGCATTTTAATTCAGCA
GCTGATTCATTACATTTTTCCTATTCAAAAACACCATCCCAACAAATAAT
TTTCCCTCATAGTAACTCCAGAGTTTCAAATTCTTCTCATCCCAACACAA
ACAGCAGTGGCAGCAATTGCAGTGACCACACAAATATGTCGTTTTCAAAT
TCTTTACAACCGAATTCTAAGACATCAAAATCCCAAGGAATACCTTCAAG
TAATATTCAAATATGCCCTTCAACCGTTGCCTTCAGTAGTCCCTCTAGTC
ACCCTGCAAACAATTCAATGTCCCCCTATTTTATCCAGGCAAACTACGAA
CCAAATTTAGCAAACCCTTCAGCCAATACTCATTGTTATCCAATTTATTC
TGCCACCACAACATTATCAAACAACAATCAGCTTTGTGGACCAGATTATT
TTCCAGGACAAAATTCGTCGTCGCCTTCAAATACTTATTCTTTTTCATGA
TCAACTGGTCGCATGCGAAAGCAATTTT
back to top

protein sequence of SMED30034720-orf-1

>SMED30034720-orf-1 ID=SMED30034720-orf-1|Name=SMED30034720-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=669bp
MDSVVILLIVCIWLNSGVQTLGNNIIPILHDYSSNVSVQIGSTLKINCPM
SINSKENEGFFISWTVNGVDENMLSMDLRYEFKNNNQVLEVKSIKSEDTG
TYTCKGVTGYGVREASFYIKVLDEKFCHIPTASITKQKYKPCFLNSLMQN
ELTYHKVVKDVGSSVQFNCFAAGNPLPEYLWMKGKSSADWIDNITSIRQP
ILRINNIKLEYAGQYTCKVYNQLGEISYTYTLIVREKYPKLPKIVNKLTN
VTAKLDKPAFIVGTISCDCQPVIQWFKKVTDLSKFTKAIQLPNAEDKEKN
EYFVIVETDSTDSRITTETVAKDNGFLISILRFKSVIQEDSGKYVLFTTK
GNSGMNYKTVYLDIQDSSDLKKNQPRLIIFIAIPIFILILCFGVIFYCWS
RNHGVPRAECSKSLCVGSSSASSSTNIKSFRSHYPPSTGTGSAATGKYSN
GSSFTMGKKNSSSTTDNTQPQSMGGIPLLPQQSSSRSFSPAVTGNVLIQE
PLMFDSSINASTAPHFNSAADSLHFSYSKTPSQQIIFPHSNSRVSNSSHP
NTNSSGSNCSDHTNMSFSNSLQPNSKTSKSQGIPSSNIQICPSTVAFSSP
SSHPANNSMSPYFIQANYEPNLANPSANTHCYPIYSATTTLSNNNQLCGP
DYFPGQNSSSPSNTYSFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003109anterior pole cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 39..111
e-value: 5.8E-4
score: 29.2
coord: 160..224
e-value: 5.2E-7
score: 39.3
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 154..235
e-value: 7.5E-9
score: 45.4
coord: 248..365
e-value: 0.69
score: 19.0
coord: 33..122
e-value: 3.4E-9
score: 46.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 22..131
e-value: 6.5E-13
score: 50.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 143..237
e-value: 3.6E-14
score: 54.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 238..370
e-value: 6.4E-7
score: 31.5
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 155..234
e-value: 6.6E-11
score: 42.1
coord: 33..121
e-value: 6.7E-8
score: 32.5
NoneNo IPR availablePANTHERPTHR19890FIBROBLAST GROWTH FACTOR RECEPTORcoord: 41..472
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.737
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 27..104
score: 10.716
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 130..233
score: 9.355
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 156..237
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 242..366
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 30..123