DNA polymerase eta

Overview
NameDNA polymerase eta
Smed IDSMED30034709
Length (bp)2011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA polymerase eta (SMED30034709) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA polymerase eta (SMED30034709) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA polymerase eta (SMED30034709) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA polymerase eta (SMED30034709) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034709

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034709SMESG000010350.1 SMESG000010346.1 Contig3168newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034709SMESG000010350.1 SMESG000010346.1 Contig3168uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034709SMESG000052369.1 Contig3168newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034709SMESG000052369.1 Contig3168uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 SmedASXL_014950SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 SmedASXL_014950SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 dd_Smed_v4_6500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 dd_Smed_v4_6500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 dd_Smed_v4_6500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034709SMESG000019761.1 SMESG000010350.1 SMESG000010346.1 dd_Smed_v4_6500_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30034709SMESG000010350.1 SMESG000010346.1 Contig10354newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034709SMESG000010350.1 SMESG000010346.1 Contig10354uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA polymerase eta vs. Ensembl Human
Match: POLH (DNA polymerase eta [Source:HGNC Symbol;Acc:HGNC:9181])

HSP 1 Score: 331.643 bits (849), Expect = 3.349e-103
Identity = 200/495 (40.40%), Postives = 275/495 (55.56%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSL------------TDLGELAMLKDRRDRSI--EGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQM-AAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNS 1510
            ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV RSM  D+AK+ CPD+ L  V E+RGKA+LTKYR A  EV++ +S+ A  +ERASIDEA++D+T  V   L  L            T +  L       + ++  EG    G      WLD L     T     D++L +GA +V++MR  +    G++CSAGI+H+K  AK ACG++KPN+QTLV    +  L +   I KIR+LGGK+G  V + L +  MG+L+ F+  QL   FG+K G WLY +CRG + + V  RQL ++IGCSK FPG   L T ++V++WL Q+AQE+ ER+++D + N R+ T + VS   +R   D R S S  R   L    A  +S  AF V+   NT+G        W PPL  L L A KF     ++  DI+ FL   P       +S   VP+  S  +   S
Sbjct:    8 VVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFA-VIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLF---QWLDSLQIDNLTS---PDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVS---IRVQGDKRLS-SLRRCCALTRYDAHKMSHDAFTVIKNCNTSG----IQTEWSPPLTMLFLCATKFSASAPSSSTDITSFLSSDP-------SSLPKVPVTSSEAKTQGS 466          
BLAST of DNA polymerase eta vs. Ensembl Human
Match: POLH (DNA polymerase eta [Source:HGNC Symbol;Acc:HGNC:9181])

HSP 1 Score: 313.923 bits (803), Expect = 4.748e-100
Identity = 180/428 (42.06%), Postives = 251/428 (58.64%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSL------------TDLGELAMLKDRRDRSI--EGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAG 1312
            ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV RSM  D+AK+ CPD+ L  V E+RGKA+LTKYR A  EV++ +S+ A  +ERASIDEA++D+T  V   L  L            T +  L       + ++  EG    G      WLD    L+  +    D++L +GA +V++MR  +    G++CSAGI+H+K  AK ACG++KPN+QTLV    +  L +   I KIR+LGGK+G  V + L +  MG+L+ F+  QL   FG+K G WLY +CRG + + V  RQL ++IGCSK FPG   L T ++V++WL Q+AQE+ ER+++D + N R+ T + VS   +R   D R S S  R   L    A  +S  AF V+   NT+G
Sbjct:    8 VVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFA-VIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLF---QWLD---SLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVS---IRVQGDKRLS-SLRRCCALTRYDAHKMSHDAFTVIKNCNTSG 410          
BLAST of DNA polymerase eta vs. Ensembl Human
Match: POLI (DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9182])

HSP 1 Score: 120.168 bits (300), Expect = 1.743e-27
Identity = 92/329 (27.96%), Postives = 155/329 (47.11%), Query Frame = 2
Query:   62 SNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF 1045
            S+ +IV +D+DCFY QVE+ + P+   K   V Q              +++     ++  +YEAR  GV + M   +AK+KCP + L +        DLT+YR    +V + L + +  VER   DE F+D+T+ V+  L  L            +   +      G+V Y++   +L+++         +RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  FS   L    G      +  L  G+D+  V+     QS      F
Sbjct:   51 SSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQ--------------KYL-----VVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVN------GEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQL------------QSDELSAVTVSGHV-YNNQSINLLDVL-------HIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCL-EALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVILSGPPQSFSEEDSF 333          
BLAST of DNA polymerase eta vs. Ensembl Human
Match: POLI (DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9182])

HSP 1 Score: 97.4413 bits (241), Expect = 2.367e-22
Identity = 69/236 (29.24%), Postives = 119/236 (50.42%), Query Frame = 2
Query:  212 IQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFS 916
            +Q    ++  +YEAR  GV + M   +AK+KCP + L +        DLT+YR    +V + L + +  VER   DE F+D+T+ V+  L  L            +   +      G+V Y++   +L+++         +RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  FS
Sbjct:   14 VQQKYLVVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVN------GEDLTRYREMSYKVTELLEEFSPVVERLGFDENFVDLTEMVEKRLQQL------------QSDELSAVTVSGHV-YNNQSINLLDVL-------HIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCL-EALGINSVRDLQTFS 222          
BLAST of DNA polymerase eta vs. Ensembl Human
Match: POLI (DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9182])

HSP 1 Score: 94.7449 bits (234), Expect = 1.654e-19
Identity = 82/315 (26.03%), Postives = 143/315 (45.40%), Query Frame = 2
Query:   62 SNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVL 1003
            S+ +IV +D+DCFY QVE+ + P+   K   V Q              +++     ++  +YEAR  GV + M   +AK+KCP + L +        DLT+YR    +V + + K    ++           +DE+  + VS                        G+V Y++   +L+++         +RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  FS   L    G      +  L  G+D+  V+
Sbjct:   12 SSRVIVHVDLDCFYAQVEMISNPELKDKPLGVQQ--------------KYL-----VVTCNYEARKLGVKKLMNVRDAKEKCPQLVLVN------GEDLTRYREMSYKVTEMVEKRLQQLQ-----------SDELSAVTVS------------------------GHV-YNNQSINLLDVL-------HIRLLVGSQIAAEMREAMYNQLGLTGCAGVASNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKCL-EALGINSVRDLQTFSPKILEKELGISVAQRIQKLSFGEDNSPVI 257          
BLAST of DNA polymerase eta vs. Ensembl Celegans
Match: polh-1 (DNA polymerase eta; POLH (DNA polymerase eta) homolog [Source:UniProtKB/TrEMBL;Acc:G5EFY1])

HSP 1 Score: 237.654 bits (605), Expect = 1.476e-69
Identity = 157/472 (33.26%), Postives = 246/472 (52.12%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTW--RGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVP--ENRGKADLTKYRNAGAEVIKCLSKHAS--CVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCH-AVGY-VSYSDWL--DHLMELRATDEQC-DDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLAD-GSWFPPLLSLGLSAGKFKPQMAAKN-DISRFLVDCPINKS 1447
            +I LIDMDCFY QVE +  P   G+   VVQ++     GG               I+AVSYEAR  GV R M   EAK KCP I +  VP  E   KAD+ KYR+A AEV + L+ + S   +E+AS+DEAF+D++   +  L  L +   L          +   H A G  V  ++ L  D L+E       C +++ L + A  V+Q+R+ ++    + CSAG+ ++K  AK  C  HKP QQTL+P   + +++    I  +R  GGKMG  +Q+ LN++ MG+L    + QL +TF ++   +L  +  G  DE V  R+ + SI  SK FPG   + ++ +++ WLD + +E+A+R++ D + N R   ++   Y  L +    +K+L  +   P        + +  +  + G+N        D G W PP+L++ LSA +F+P + A+N  I  +L +    KS
Sbjct:    4 VISLIDMDCFYAQVEQRDNPSLWGQPVIVVQHSRQGIEGG---------------ILAVSYEARPFGVKRGMTVAEAKLKCPQISICHVPIGEYVDKADIQKYRDASAEVFRVLNNYDSQIIIEKASVDEAFLDLSAYTNQKLQELRENEGLEEFLQAAITYLPTTHLATGEDVKENEHLREDVLLEYIENARNCTENLLLLIAAVTVEQIRQQIHEETQFFCSAGVGNNKMMAKLVCARHKPRQQTLIPWFYVREILRLTPIGDVRGFGGKMGNRIQEMLNITLMGELLEVDISQLIETFPNQHE-YLRSVAEGHCDEPVRPRKESSSIAVSKNFPGKLSIRSVLELKKWLDGLTKELAKRLATDQAENKRTAENLV--YSLLTEDGKPQKTLKITSYHP------DTLFEQIWAAMKGLNKTNATKNEDSGPWTPPILNISLSATRFQPGIPAQNRSIHEWLYEKKTRKS 451          
BLAST of DNA polymerase eta vs. Ensembl Fly
Match: DNApol-eta (gene:FBgn0037141 transcript:FBtr0078489)

HSP 1 Score: 305.449 bits (781), Expect = 3.947e-92
Identity = 171/475 (36.00%), Postives = 261/475 (54.95%), Query Frame = 2
Query:   59 KSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRAT----DEQCD--------------DVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVD 1429
            K + +++L+DMDCF+ QVE K  P+Y  +  AVVQYN WRGGG              IIAV+Y ARAKGV R MRGDEAK  CP+I L  VP  R KAD +KYR+AG EV   L +    +ERAS+DEA++DIT+ V++ +  +   G  A+    + + +    AVGY S  D+++ +    A     DE+                D+RL +GA +  ++R  V    GY CSAGIAH+K  AK A G++KPN+QT++P    + L ++  + KI+ LGGK G  V + L +  MGQ+  FS   L   F +K G WL+++ RG D E+V  R  ++SIGC K+FPG N++  +  +++WL +++ E+ +R+ +D   N R   HM V Y Q  DG +    ++ SR   L++     I + +  ++           ++ +    +  LG+S GKF+   + +N +     +
Sbjct:   13 KYDRVVLLVDMDCFFCQVEEKQHPEYRNRPLAVVQYNPWRGGG--------------IIAVNYAARAKGVTRHMRGDEAKDLCPEIVLCQVPNIREKADTSKYRDAGKEVANVLQRFTQLLERASVDEAYLDITETVNHRMQQMQS-GAFAL----QPQELVNTFAVGYPSIGDYVNKITNRFANPYMDDERYQMSYDQNDLPAVRQSDIRLLIGASVAGEVRAAVKKETGYECSAGIAHNKILAKLAAGMNKPNKQTILPLTETASLFDSLPVGKIKGLGGKFGEVVCETLGIKFMGQVVKFSEVDLQRKFDEKNGTWLFNISRGIDLEAVTPRFYSKSIGCCKKFPGRNNITGLKTLQHWLGELSSEINDRLEKDFIENNRRAKHMVVQYVQDIDGEE----VASSRSTALRDYDQESIVRLSLDLIKANTKTFLRPGSESALNNAIKFLGISVGKFETVSSGQNKLQEMFAN 464          
BLAST of DNA polymerase eta vs. Ensembl Fly
Match: DNApol-iota (gene:FBgn0037554 transcript:FBtr0081797)

HSP 1 Score: 110.923 bits (276), Expect = 5.759e-25
Identity = 135/533 (25.33%), Postives = 216/533 (40.53%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNN-ASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF-PGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAF--VVLSGVNTAGHCDLADGS----------WFPPLLS---------LGLSAGKFKPQMAAKNDISRFLV---DCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQ 1594
            I+ +DMD FY QVE    P    K   + Q N                    ++  +Y ARAKGV + M   EA++ CPD+ L +        DL  YR     +   L  +   VE+   DE F+D+T  V+     + +    A+L+            VG+   +D       L   D  C   RLA+G  + Q++RE++   LG  C AGIA++K  AK     H+PNQQT++ S      M     + ++  +G K    + +   +S++ QL    +  +   FG +T   L  L  G+D   V      ++IG      P S   +  ++ R  L ++ ++VAE        + R+P  + V   +     DS+K  S       +E   A I  + F   +  G        LADG+           F  ++          LGL+  KF+ +    + I+ FL+   D  + +S+ S +N S+           S T +S  SD    CA   S ++  P  Q
Sbjct:   17 IIHLDMDYFYAQVEEIRDPTLRSKALGIQQKNI-------------------VVTCNYVARAKGVTKLMLIAEAQRICPDLVLVN------GEDLAPYRQMSQRIFDLLLNYTPLVEKLGFDENFMDVTALVELRQAHVAE----ALLR----------PPVGHTYPADG----TPLSNCDCGCAQ-RLAIGTRIAQEIREELKLRLGITCCAGIAYNKLLAKLVGSSHEPNQQTVLVSTYAEQFMRELGDLKRVTGIGQKTQCLLLEA-GMSSVEQLQQCDMDVMRKKFGFETATRLRDLAFGRDTSLVRPSGKPKTIGMEDACKPISVRTDVEERFRMLLKRLVEQVAE--------DGRVPIAIKVVLRKF----DSQKKSSH------RETKQANILPSLFKTSMCPGETGVSKVQLADGAQDKLLKIVMRLFERIVDMSKPFNITLLGLAFSKFQERKVGSSSIANFLIKKADLEV-QSITSLTNTSL----------TSPTAESPTSD---ECAFRSSPTTFKPSDQ 472          
BLAST of DNA polymerase eta vs. Ensembl Fly
Match: DNApol-iota (gene:FBgn0037554 transcript:FBtr0081798)

HSP 1 Score: 110.923 bits (276), Expect = 5.759e-25
Identity = 135/533 (25.33%), Postives = 216/533 (40.53%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNN-ASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF-PGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAF--VVLSGVNTAGHCDLADGS----------WFPPLLS---------LGLSAGKFKPQMAAKNDISRFLV---DCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQ 1594
            I+ +DMD FY QVE    P    K   + Q N                    ++  +Y ARAKGV + M   EA++ CPD+ L +        DL  YR     +   L  +   VE+   DE F+D+T  V+     + +    A+L+            VG+   +D       L   D  C   RLA+G  + Q++RE++   LG  C AGIA++K  AK     H+PNQQT++ S      M     + ++  +G K    + +   +S++ QL    +  +   FG +T   L  L  G+D   V      ++IG      P S   +  ++ R  L ++ ++VAE        + R+P  + V   +     DS+K  S       +E   A I  + F   +  G        LADG+           F  ++          LGL+  KF+ +    + I+ FL+   D  + +S+ S +N S+           S T +S  SD    CA   S ++  P  Q
Sbjct:   17 IIHLDMDYFYAQVEEIRDPTLRSKALGIQQKNI-------------------VVTCNYVARAKGVTKLMLIAEAQRICPDLVLVN------GEDLAPYRQMSQRIFDLLLNYTPLVEKLGFDENFMDVTALVELRQAHVAE----ALLR----------PPVGHTYPADG----TPLSNCDCGCAQ-RLAIGTRIAQEIREELKLRLGITCCAGIAYNKLLAKLVGSSHEPNQQTVLVSTYAEQFMRELGDLKRVTGIGQKTQCLLLEA-GMSSVEQLQQCDMDVMRKKFGFETATRLRDLAFGRDTSLVRPSGKPKTIGMEDACKPISVRTDVEERFRMLLKRLVEQVAE--------DGRVPIAIKVVLRKF----DSQKKSSH------RETKQANILPSLFKTSMCPGETGVSKVQLADGAQDKLLKIVMRLFERIVDMSKPFNITLLGLAFSKFQERKVGSSSIANFLIKKADLEV-QSITSLTNTSL----------TSPTAESPTSD---ECAFRSSPTTFKPSDQ 472          
BLAST of DNA polymerase eta vs. Ensembl Fly
Match: DNApol-iota (gene:FBgn0037554 transcript:FBtr0339606)

HSP 1 Score: 110.923 bits (276), Expect = 5.759e-25
Identity = 135/533 (25.33%), Postives = 216/533 (40.53%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNN-ASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF-PGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAF--VVLSGVNTAGHCDLADGS----------WFPPLLS---------LGLSAGKFKPQMAAKNDISRFLV---DCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQ 1594
            I+ +DMD FY QVE    P    K   + Q N                    ++  +Y ARAKGV + M   EA++ CPD+ L +        DL  YR     +   L  +   VE+   DE F+D+T  V+     + +    A+L+            VG+   +D       L   D  C   RLA+G  + Q++RE++   LG  C AGIA++K  AK     H+PNQQT++ S      M     + ++  +G K    + +   +S++ QL    +  +   FG +T   L  L  G+D   V      ++IG      P S   +  ++ R  L ++ ++VAE        + R+P  + V   +     DS+K  S       +E   A I  + F   +  G        LADG+           F  ++          LGL+  KF+ +    + I+ FL+   D  + +S+ S +N S+           S T +S  SD    CA   S ++  P  Q
Sbjct:   17 IIHLDMDYFYAQVEEIRDPTLRSKALGIQQKNI-------------------VVTCNYVARAKGVTKLMLIAEAQRICPDLVLVN------GEDLAPYRQMSQRIFDLLLNYTPLVEKLGFDENFMDVTALVELRQAHVAE----ALLR----------PPVGHTYPADG----TPLSNCDCGCAQ-RLAIGTRIAQEIREELKLRLGITCCAGIAYNKLLAKLVGSSHEPNQQTVLVSTYAEQFMRELGDLKRVTGIGQKTQCLLLEA-GMSSVEQLQQCDMDVMRKKFGFETATRLRDLAFGRDTSLVRPSGKPKTIGMEDACKPISVRTDVEERFRMLLKRLVEQVAE--------DGRVPIAIKVVLRKF----DSQKKSSH------RETKQANILPSLFKTSMCPGETGVSKVQLADGAQDKLLKIVMRLFERIVDMSKPFNITLLGLAFSKFQERKVGSSSIANFLIKKADLEV-QSITSLTNTSL----------TSPTAESPTSD---ECAFRSSPTTFKPSDQ 472          
BLAST of DNA polymerase eta vs. Ensembl Fly
Match: Rev1 (gene:FBgn0035150 transcript:FBtr0072557)

HSP 1 Score: 86.2705 bits (212), Expect = 4.035e-17
Identity = 91/386 (23.58%), Postives = 154/386 (39.90%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAV-------------VQYNTWRGGGYTICELRFIQ-------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLV-PSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSE 1132
            ++ IDMDCF+V V L+  P+  G   AV             V     R     +   RF                     S+  I + SYEAR KG+   M   +A + CP+  L ++P      D   Y+     +   ++++   +E  S DE F++           LTDL                                           ++ + + AF V  +R++VY+  G  CSAG+A +K  A+ A    KPN Q L+  S+ I   M   S+D +  +G  +   ++Q   ++  G +   +L ++    G K G  L+  CRG DD  +   Q+ +++     F G    N+++    +L Q+++EV +R+ E
Sbjct:  275 VMHIDMDCFFVSVGLRTRPELRGLPIAVTHSKGGNAATDVPVHPQADRKAELELFAQRFEHHFHDGDKAEKVRSGFDKKMSLSEIASCSYEAREKGIRNGMFVGQALKLCPE--LKTIP-----YDFEGYKEVAFTLYDTVAQYTLNIEAVSCDEMFVE-----------LTDLAH-----------------------------------------ELNVDVMAF-VSHLRQEVYSKTGCPCSAGVAGNKLLARMATKEAKPNGQFLLDSSNDILAYMAPMSLDLLPGVGSSISHKLKQA-GLNNCGDVQNTTLEKMEKVLGKKLGQNLFQNCRGIDDRPLAYEQIRKTVSAEMNF-GIRFTNSVE-CEQFLCQLSEEVTKRLVE 597          
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Match: polh (polymerase (DNA directed), eta [Source:ZFIN;Acc:ZDB-GENE-060421-4949])

HSP 1 Score: 344.739 bits (883), Expect = 3.962e-108
Identity = 191/453 (42.16%), Postives = 261/453 (57.62%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSD----------------WLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF 1381
            ++ L+DMDCFYVQVE +  P+   K   V QY TW+GGG              IIAVSYEARA GV R+M  D+A++ CPD+ +  VPE  GKADLT YR A  EVI+ +S+ A  +ERASIDEA++D+T  V   L + +       ++D   + ++  H  G+ +  +                WLD L    +T+    D+RLA+GA +V+QMR  V    G+RCSAGI+H+K  AK ACG++KPN+QT++P   +  L +   I KIRNLGGK+G+ + + L+V  MG L+ FS  QL   FGDKTGPWLY LCRG + E V  RQL +SIGCSK F G   L T  +V+YWL Q+A E+ ER+++D   N R+   + V   Q       ++S S SR   L    A  ++  +  ++  +NTAG    A   W P L  L LSA KF
Sbjct:    8 VVALVDMDCFYVQVEQRLKPELKNKPCVVAQYKTWKGGG--------------IIAVSYEARAHGVGRNMFADDARKLCPDLQVARVPEAHGKADLTHYREASVEVIEVMSRFA-VIERASIDEAYMDLTASVQERLKNTS-------VQDITAQQLKNTHIQGFPTQQENTHLDRDAQRAAGLQQWLDLLSS--STESSPADLRLAVGALIVEQMRAAVEEHTGFRCSAGISHNKVLAKLACGLNKPNRQTVLPLSSVPQLFSTLPISKIRNLGGKLGSSITETLSVENMGDLTRFSRAQLEQHFGDKTGPWLYDLCRGIEFEPVKPRQLPKSIGCSKNFAGKTCLRTKQQVQYWLHQLALELEERLNKDRDVNGRVARQLTVGVRQA----GGQRSGSFSRCCALVRYDAMKMTNDSLTIIKSLNTAGAHQEA---WSPALTLLHLSASKF 429          
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Match: polh (polymerase (DNA directed), eta [Source:ZFIN;Acc:ZDB-GENE-060421-4949])

HSP 1 Score: 344.739 bits (883), Expect = 5.150e-108
Identity = 191/453 (42.16%), Postives = 261/453 (57.62%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSD----------------WLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF 1381
            ++ L+DMDCFYVQVE +  P+   K   V QY TW+GGG              IIAVSYEARA GV R+M  D+A++ CPD+ +  VPE  GKADLT YR A  EVI+ +S+ A  +ERASIDEA++D+T  V   L + +       ++D   + ++  H  G+ +  +                WLD L    +T+    D+RLA+GA +V+QMR  V    G+RCSAGI+H+K  AK ACG++KPN+QT++P   +  L +   I KIRNLGGK+G+ + + L+V  MG L+ FS  QL   FGDKTGPWLY LCRG + E V  RQL +SIGCSK F G   L T  +V+YWL Q+A E+ ER+++D   N R+   + V   Q       ++S S SR   L    A  ++  +  ++  +NTAG    A   W P L  L LSA KF
Sbjct:    8 VVALVDMDCFYVQVEQRLKPELKNKPCVVAQYKTWKGGG--------------IIAVSYEARAHGVGRNMFADDARKLCPDLQVARVPEAHGKADLTHYREASVEVIEVMSRFA-VIERASIDEAYMDLTASVQERLKNTS-------VQDITAQQLKNTHIQGFPTQQENTHLDRDAQRAAGLQQWLDLLSS--STESSPADLRLAVGALIVEQMRAAVEEHTGFRCSAGISHNKVLAKLACGLNKPNRQTVLPLSSVPQLFSTLPISKIRNLGGKLGSSITETLSVENMGDLTRFSRAQLEQHFGDKTGPWLYDLCRGIEFEPVKPRQLPKSIGCSKNFAGKTCLRTKQQVQYWLHQLALELEERLNKDRDVNGRVARQLTVGVRQA----GGQRSGSFSRCCALVRYDAMKMTNDSLTIIKSLNTAGAHQEA---WSPALTLLHLSASKF 429          
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Match: polh (polymerase (DNA directed), eta [Source:ZFIN;Acc:ZDB-GENE-060421-4949])

HSP 1 Score: 344.739 bits (883), Expect = 5.150e-108
Identity = 191/453 (42.16%), Postives = 261/453 (57.62%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSD----------------WLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF 1381
            ++ L+DMDCFYVQVE +  P+   K   V QY TW+GGG              IIAVSYEARA GV R+M  D+A++ CPD+ +  VPE  GKADLT YR A  EVI+ +S+ A  +ERASIDEA++D+T  V   L + +       ++D   + ++  H  G+ +  +                WLD L    +T+    D+RLA+GA +V+QMR  V    G+RCSAGI+H+K  AK ACG++KPN+QT++P   +  L +   I KIRNLGGK+G+ + + L+V  MG L+ FS  QL   FGDKTGPWLY LCRG + E V  RQL +SIGCSK F G   L T  +V+YWL Q+A E+ ER+++D   N R+   + V   Q       ++S S SR   L    A  ++  +  ++  +NTAG    A   W P L  L LSA KF
Sbjct:    8 VVALVDMDCFYVQVEQRLKPELKNKPCVVAQYKTWKGGG--------------IIAVSYEARAHGVGRNMFADDARKLCPDLQVARVPEAHGKADLTHYREASVEVIEVMSRFA-VIERASIDEAYMDLTASVQERLKNTS-------VQDITAQQLKNTHIQGFPTQQENTHLDRDAQRAAGLQQWLDLLSS--STESSPADLRLAVGALIVEQMRAAVEEHTGFRCSAGISHNKVLAKLACGLNKPNRQTVLPLSSVPQLFSTLPISKIRNLGGKLGSSITETLSVENMGDLTRFSRAQLEQHFGDKTGPWLYDLCRGIEFEPVKPRQLPKSIGCSKNFAGKTCLRTKQQVQYWLHQLALELEERLNKDRDVNGRVARQLTVGVRQA----GGQRSGSFSRCCALVRYDAMKMTNDSLTIIKSLNTAGAHQEA---WSPALTLLHLSASKF 429          
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Match: poli (polymerase (DNA directed) iota [Source:ZFIN;Acc:ZDB-GENE-050417-376])

HSP 1 Score: 117.857 bits (294), Expect = 4.469e-27
Identity = 99/367 (26.98%), Postives = 169/367 (46.05%), Query Frame = 2
Query:   44 DH*KMKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRR--DRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSED 1135
            D   + S  +I+  D+DCFY QVE+   P    K   + Q              ++I     I+  +Y AR  GVN+ M   +A +KCP + L      +G+ DLT YR    +V + L  +   VER   DE F+D+T+ V+              +K+ R  D S  G H   + S              DE+  ++RLA+G+ +  +MR+ ++++LG    AG+A +K  AK   G  KPNQQT +     ++LM++ + + K+  +G K    + + L +  +  L  + L  L   FG+     + +L  G DD  V      QS+     F     ++T+++V   ++++   + ER+ +D
Sbjct:   29 DRVSLTSQRVILHFDLDCFYAQVEMIRNPALRTKPLGIQQ--------------KYI-----IVTSNYVARELGVNKLMSVTDAVEKCPQLVLV-----KGE-DLTHYREMSYKVTELLMSYCPLVERLGFDENFMDVTEMVEK------------RIKETRISDLSFNG-HVYNHESV-----------VVDEE--NIRLAVGSVIAAEMRQAIFSTLGLTGCAGVASNKLLAKLVSGSFKPNQQTTLLPHSTAELMSSLTGLIKVPGIGYKTREKL-KALGLVNVRDLQLYPLSDLVKEFGEMNAKRIQNLACGIDDSPVTPAGPPQSLSDEDSF---KKMSTLEEVLKKIEELLINLTERMHKD 340          
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Match: rev1 (REV1 DNA directed polymerase [Source:ZFIN;Acc:ZDB-GENE-081105-180])

HSP 1 Score: 90.5077 bits (223), Expect = 3.376e-18
Identity = 97/394 (24.62%), Postives = 148/394 (37.56%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYN-----TWRGGGYTICELRFIQ--------------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERV 1126
            ++ +DMDCF+V V ++  P  +GK  AV           R G     E ++ Q                                      S+  I + SYEAR  GV   M    AKQ CPD+   SVP      D   Y+     + + L+ +   +E  S DEA +D T     LLV      EL +  D   RSI                                           RED+    G   S G++ +   A+ A    KP  Q L+ S+ + D + +  +  +  +G  M + +   L VST G L   SL QL   FG +TG  L+  CRG DD  V S +  +S+     +  +     +++   +L+ ++ EV +R+
Sbjct:  452 VLHVDMDCFFVSVGIRHRPDLIGKPVAVTSNRGPGRVAQRPGANPQLEFQYYQNKQKHYRKEKTDGDLEMTPSPQDGEVPSNGVHEDLAALSMAEIASCSYEARQAGVRNGMFFGRAKQLCPDLQ--SVP-----YDFHAYKEVALAMYEILASYTHNIEALSCDEALVDAT----ALLV------ELGVSPDELARSI-------------------------------------------REDIKEKTGCCASVGMSSNILLARMATRKAKPKGQYLLRSEEVDDFIRDQPVSSLPGVGRSMSSKLTS-LGVSTCGDLQQLSLSQLQREFGPRTGQTLFRFCRGLDDRPVRSEKERKSVSAEMNY--NIRFTQVEEAESFLNNLSMEVQKRL 782          
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Match: ngef (neuronal guanine nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-950834])

HSP 1 Score: 132.494 bits (332), Expect = 1.668e-31
Identity = 110/380 (28.95%), Postives = 172/380 (45.26%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLN---VSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGN 1201
            +IV IDMDCFY QVE+   P+   K   + Q              ++I     ++  +YEAR  GV + M   +A++KCP + L S        DLT YR       + L + +  VER   DE +ID+T+ VD  L      G          R+   C   G+V YSD        +        VR+A G+ +  ++R  +YN LG    AG A +K  AK   G HKPNQQT +  +  S L+N  S+D ++ + G +G    ++L    +S +  L A  +  L   FG      +  L RG+DD +V+     QSI     F      +T+ +V+  +++  + +  R+S+D     R+P  + ++  Q    N
Sbjct:   51 VIVHIDMDCFYAQVEMIRNPELRNKPLGIQQ--------------KYI-----VVTCNYEARKFGVTKLMLIKDAREKCPQLVLVS------GEDLTPYREMSYRATELLEEFSPQVERLGFDENYIDVTELVDKKLQEERGNG----------RNPGVC---GHV-YSDQ-------KMNVNNWAHVRIAAGSHIASEIRAALYNRLGLTGCAGTASNKLLAKLVSGTHKPNQQTALLHESHSHLIN--SLDHVKQIPG-IGYKTSKRLESLGLSRISDLQACPITLLEKEFGSSVAHRIQMLSRGEDDSAVVPSGPPQSISDEDSF---KKCSTVSEVKIKMEERLRNLLVRISKD----GRIPHTLRLTIRQFSPSN 374          
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Match: ngef (neuronal guanine nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-950834])

HSP 1 Score: 115.161 bits (287), Expect = 6.011e-26
Identity = 96/333 (28.83%), Postives = 152/333 (45.65%), Query Frame = 2
Query:  212 IQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLN---VSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGN 1201
            IQ    ++  +YEAR  GV + M   +A++KCP + L S        DLT YR       + L + +  VER   DE +ID+T+ VD  L      G          R+   C   G+V YSD        +        VR+A G+ +  ++R  +YN LG    AG A +K  AK   G HKPNQQT +  +  S L+N  S+D ++ + G +G    ++L    +S +  L A  +  L   FG      +  L RG+DD +V+     QSI     F      +T+ +V+  +++  + +  R+S+D     R+P  + ++  Q    N
Sbjct:   54 IQQKYIVVTCNYEARKFGVTKLMLIKDAREKCPQLVLVS------GEDLTPYREMSYRATELLEEFSPQVERLGFDENYIDVTELVDKKLQEERGNG----------RNPGVC---GHV-YSDQ-------KMNVNNWAHVRIAAGSHIASEIRAALYNRLGLTGCAGTASNKLLAKLVSGTHKPNQQTALLHESHSHLIN--SLDHVKQIPG-IGYKTSKRLESLGLSRISDLQACPITLLEKEFGSSVAHRIQMLSRGEDDSAVVPSGPPQSISDEDSF---KKCSTVSEVKIKMEERLRNLLVRISKD----GRIPHTLRLTIRQFSPSN 349          
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Match: ngef (neuronal guanine nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-950834])

HSP 1 Score: 87.0409 bits (214), Expect = 3.554e-17
Identity = 72/263 (27.38%), Postives = 126/263 (47.91%), Query Frame = 2
Query:  434 IDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHL-MELRATDEQCDD---VRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLN---VSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGN 1201
            I + +I +T   +     +T   +L ++KD R++    C  +  VS  D   +  M  RAT+   ++   VR+A G+ +  ++R  +YN LG    AG A +K  AK   G HKPNQQT +  +  S L+N  S+D ++ + G +G    ++L    +S +  L A  +  L   FG      +  L RG+DD +V+     QSI     F      +T+ +V+  +++  + +  R+S+D     R+P  + ++  Q    N
Sbjct:   79 IQQKYIVVTCNYEARKFGVT---KLMLIKDAREK----CPQLVLVSGEDLTPYREMSYRATEMNVNNWAHVRIAAGSHIASEIRAALYNRLGLTGCAGTASNKLLAKLVSGTHKPNQQTALLHESHSHLIN--SLDHVKQIPG-IGYKTSKRLESLGLSRISDLQACPITLLEKEFGSSVAHRIQMLSRGEDDSAVVPSGPPQSISDEDSF---KKCSTVSEVKIKMEERLRNLLVRISKD----GRIPHTLRLTIRQFSPSN 324          

HSP 2 Score: 54.299 bits (129), Expect = 6.645e-7
Identity = 34/100 (34.00%), Postives = 48/100 (48.00%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYR 370
            +IV IDMDCFY QVE+   P+   K   + Q              ++I     ++  +YEAR  GV + M   +A++KCP + L S        DLT YR
Sbjct:   51 VIVHIDMDCFYAQVEMIRNPELRNKPLGIQQ--------------KYI-----VVTCNYEARKFGVTKLMLIKDAREKCPQLVLVS------GEDLTPYR 125          
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Match: trmo (tRNA methyltransferase O [Source:Xenbase;Acc:XB-GENE-1004391])

HSP 1 Score: 85.5001 bits (210), Expect = 1.514e-16
Identity = 85/387 (21.96%), Postives = 137/387 (35.40%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQ-----YNTWRGGGYTICELRFIQ-------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERV 1126
            I+ +DMDCF+V V ++  P   GK  AV         T R G     E ++ Q                               S+  I + SYEAR  GV   M   +AKQ CP++   +VP      D   Y+     + + L+ +   +E  S DEA  DIT                                            L E R T ++  +            +R +V    G   S GI  +   A+ A    KP+ Q  +  + + D +    ++ +  +G  +  +    L V T G L   ++ +L   FG KTG  LY  CRG DD  +   +  +S+     +          +   +L  +++E+  R+
Sbjct:  414 IIHVDMDCFFVSVAIRNRPDLKGKPVAVTSNRGAGTTTTREGANPQLEFQYYQNRILKGKADQPTSISSDSAQQNGLDLDISHLSMAEIASCSYEARQAGVKNGMFFGKAKQLCPELQ--AVP-----YDFDAYKEVAMTMYRILASYTHDIEAVSCDEALADITG------------------------------------------ILTETRLTPDEASNA-----------IRTEVKEKTGCAASVGIGSNILLARMATRRAKPDGQYHLKPEEVDDFIRGQLVNNLPGVGRTI-EYKLSCLGVKTCGDLQNITMAKLQKEFGPKTGQMLYRFCRGLDDRPIRKEKERKSVSAEINY--GIRFTQTSEAEAFLINLSEEIQRRL 737          
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Match: trmo (tRNA methyltransferase O [Source:Xenbase;Acc:XB-GENE-1004391])

HSP 1 Score: 85.5001 bits (210), Expect = 1.805e-16
Identity = 85/387 (21.96%), Postives = 137/387 (35.40%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQ-----YNTWRGGGYTICELRFIQ-------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERV 1126
            I+ +DMDCF+V V ++  P   GK  AV         T R G     E ++ Q                               S+  I + SYEAR  GV   M   +AKQ CP++   +VP      D   Y+     + + L+ +   +E  S DEA  DIT                                            L E R T ++  +            +R +V    G   S GI  +   A+ A    KP+ Q  +  + + D +    ++ +  +G  +  +    L V T G L   ++ +L   FG KTG  LY  CRG DD  +   +  +S+     +          +   +L  +++E+  R+
Sbjct:  412 IIHVDMDCFFVSVAIRNRPDLKGKPVAVTSNRGAGTTTTREGANPQLEFQYYQNRILKGKADQPTSISSDSAQQNGLDLDISHLSMAEIASCSYEARQAGVKNGMFFGKAKQLCPELQ--AVP-----YDFDAYKEVAMTMYRILASYTHDIEAVSCDEALADITG------------------------------------------ILTETRLTPDEASNA-----------IRTEVKEKTGCAASVGIGSNILLARMATRRAKPDGQYHLKPEEVDDFIRGQLVNNLPGVGRTI-EYKLSCLGVKTCGDLQNITMAKLQKEFGPKTGQMLYRFCRGLDDRPIRKEKERKSVSAEINY--GIRFTQTSEAEAFLINLSEEIQRRL 735          
BLAST of DNA polymerase eta vs. Ensembl Mouse
Match: Polh (polymerase (DNA directed), eta (RAD 30 related) [Source:MGI Symbol;Acc:MGI:1891457])

HSP 1 Score: 317.39 bits (812), Expect = 4.013e-98
Identity = 202/486 (41.56%), Postives = 275/486 (56.58%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSL------TDLGELAMLKD-RRDRSIEGC---HAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQM-AAKNDISRFLVDCPINKSVASTSNKSVPIADS 1489
            N ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ L  V E+RGKA+LTKYR A  EV++ +S  A  +ERASIDEA+ID+T  V   L  L       DL     ++   R  ++E      A+       WLD    L++ D    D+RL +GA +V++MR  + +  G++CSAGI+H+K  AK ACG++KPN+QTLV    +  L +   I KIR+LGGK+G  V + L +  MG L+ F+  QL   FG+K G WLY +CRG + + V  RQL ++IGCSK FPG   L T ++V++WL Q+A E+ ER+++D + N R+ T + VS   +R   D R S S  R   L    A  +S+ AF  +   NT+G        W PPL  L L A KF      A  DI+ FL       S  S+    VPIA S
Sbjct:    6 NRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRNMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSYFA-VIERASIDEAYIDLTSAVQERLQKLQGQPISADLLPSTYIEGLPRGPTVEETVQKEAIRKQGLLQWLD---SLQSDDPTSPDLRLTVGAMIVEEMRAAIESKTGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEVLGIEYMGDLTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLALELEERLTKDRNDNDRVATQLVVS---IRFQGDRRLS-SLRRCCALPRYDAHKMSQDAFAAIRNCNTSG----IQTEWSPPLTMLFLCATKFSAAAPPACTDITAFL-------SSDSSCQPKVPIASS 458          
BLAST of DNA polymerase eta vs. Ensembl Mouse
Match: Poli (polymerase (DNA directed), iota [Source:MGI Symbol;Acc:MGI:1347081])

HSP 1 Score: 115.931 bits (289), Expect = 2.374e-26
Identity = 89/332 (26.81%), Postives = 151/332 (45.48%), Query Frame = 2
Query:   53 KMKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF 1045
            ++ S+ +IV +D+DCFY QVE+ + P+   +   V Q              +++     ++  +YEAR  GV + M   +AK+KCP + L +        DL++YR    +V + L + +  VER   DE F+D+T+ V+  L  L                +      G+V Y++   +L  +          RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  F +  L    G      +  L  G+D   V      QS      F
Sbjct:   43 QISSSRVIVHVDLDCFYAQVEMISNPELKDRPLGVQQ--------------KYL-----VVTCNYEARKLGVRKLMNVRDAKEKCPQLVLVN------GEDLSRYREMSYKVTELLEEFSPAVERLGFDENFVDLTEMVEKRLQQLPS------------EEVPSVTVFGHV-YNNQSVNLHNIMHR-------RLVVGSQIAAEMREAMYNQLGLTGCAGVAPNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKRL-EVLGINSVHDLQTFPIKTLEKELGIAIAQRIQQLSFGEDKSPVTPSGPPQSFSEEDTF 328          
BLAST of DNA polymerase eta vs. Ensembl Mouse
Match: Polh (polymerase (DNA directed), eta (RAD 30 related) [Source:MGI Symbol;Acc:MGI:1891457])

HSP 1 Score: 102.449 bits (254), Expect = 1.482e-25
Identity = 52/100 (52.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTK 364
            N ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ L  V E+RGKA+LTK
Sbjct:    6 NRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRNMWADDAKKLCPDLLLAQVRESRGKANLTK 91          
BLAST of DNA polymerase eta vs. Ensembl Mouse
Match: Poli (polymerase (DNA directed), iota [Source:MGI Symbol;Acc:MGI:1347081])

HSP 1 Score: 100.523 bits (249), Expect = 1.661e-21
Identity = 76/279 (27.24%), Postives = 126/279 (45.16%), Query Frame = 2
Query:  212 IQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF 1045
            +Q    ++  +YEAR  GV + M   +AK+KCP + L +        DL++YR    +V + L + +  VER   DE F+D+T+ V+  L  L                +      G+V Y++   +L  +          RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  F +  L    G      +  L  G+D   V      QS      F
Sbjct:   14 VQQKYLVVTCNYEARKLGVRKLMNVRDAKEKCPQLVLVN------GEDLSRYREMSYKVTELLEEFSPAVERLGFDENFVDLTEMVEKRLQQLPS------------EEVPSVTVFGHV-YNNQSVNLHNIMHR-------RLVVGSQIAAEMREAMYNQLGLTGCAGVAPNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKRL-EVLGINSVHDLQTFPIKTLEKELGIAIAQRIQQLSFGEDKSPVTPSGPPQSFSEEDTF 265          
BLAST of DNA polymerase eta vs. Ensembl Mouse
Match: Poli (polymerase (DNA directed), iota [Source:MGI Symbol;Acc:MGI:1347081])

HSP 1 Score: 100.523 bits (249), Expect = 1.661e-21
Identity = 76/279 (27.24%), Postives = 126/279 (45.16%), Query Frame = 2
Query:  212 IQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNAS-IDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRF 1045
            +Q    ++  +YEAR  GV + M   +AK+KCP + L +        DL++YR    +V + L + +  VER   DE F+D+T+ V+  L  L                +      G+V Y++   +L  +          RL +G+ +  +MRE +YN LG    AG+A +K  AK   GV KPNQQT++  +    L+++ + I +I  +G K    + + L ++++  L  F +  L    G      +  L  G+D   V      QS      F
Sbjct:   14 VQQKYLVVTCNYEARKLGVRKLMNVRDAKEKCPQLVLVN------GEDLSRYREMSYKVTELLEEFSPAVERLGFDENFVDLTEMVEKRLQQLPS------------EEVPSVTVFGHV-YNNQSVNLHNIMHR-------RLVVGSQIAAEMREAMYNQLGLTGCAGVAPNKLLAKLVSGVFKPNQQTVLLPESCQHLIHSLNHIKEIPGIGYKTAKRL-EVLGINSVHDLQTFPIKTLEKELGIAIAQRIQQLSFGEDKSPVTPSGPPQSFSEEDTF 265          
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Match: sp|Q9Y253|POLH_HUMAN (DNA polymerase eta OS=Homo sapiens OX=9606 GN=POLH PE=1 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.608e-102
Identity = 200/495 (40.40%), Postives = 275/495 (55.56%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSL------------TDLGELAMLKDRRDRSI--EGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQM-AAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNS 1510
            ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV RSM  D+AK+ CPD+ L  V E+RGKA+LTKYR A  EV++ +S+ A  +ERASIDEA++D+T  V   L  L            T +  L       + ++  EG    G      WLD L     T     D++L +GA +V++MR  +    G++CSAGI+H+K  AK ACG++KPN+QTLV    +  L +   I KIR+LGGK+G  V + L +  MG+L+ F+  QL   FG+K G WLY +CRG + + V  RQL ++IGCSK FPG   L T ++V++WL Q+AQE+ ER+++D + N R+ T + VS   +R   D R S S  R   L    A  +S  AF V+   NT+G        W PPL  L L A KF     ++  DI+ FL   P       +S   VP+  S  +   S
Sbjct:    8 VVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFA-VIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLF---QWLDSLQIDNLTS---PDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVS---IRVQGDKRLS-SLRRCCALTRYDAHKMSHDAFTVIKNCNTSG----IQTEWSPPLTMLFLCATKFSASAPSSSTDITSFLSSDP-------SSLPKVPVTSSEAKTQGS 466          
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Match: sp|Q9JJN0|POLH_MOUSE (DNA polymerase eta OS=Mus musculus OX=10090 GN=Polh PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 2.807e-97
Identity = 202/486 (41.56%), Postives = 275/486 (56.58%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSL------TDLGELAMLKD-RRDRSIEGC---HAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQM-AAKNDISRFLVDCPINKSVASTSNKSVPIADS 1489
            N ++ L+DMDCF+VQVE +  P    K  AVVQY +W+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ L  V E+RGKA+LTKYR A  EV++ +S  A  +ERASIDEA+ID+T  V   L  L       DL     ++   R  ++E      A+       WLD    L++ D    D+RL +GA +V++MR  + +  G++CSAGI+H+K  AK ACG++KPN+QTLV    +  L +   I KIR+LGGK+G  V + L +  MG L+ F+  QL   FG+K G WLY +CRG + + V  RQL ++IGCSK FPG   L T ++V++WL Q+A E+ ER+++D + N R+ T + VS   +R   D R S S  R   L    A  +S+ AF  +   NT+G        W PPL  L L A KF      A  DI+ FL       S  S+    VPIA S
Sbjct:    6 NRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGG--------------IIAVSYEARAFGVTRNMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSYFA-VIERASIDEAYIDLTSAVQERLQKLQGQPISADLLPSTYIEGLPRGPTVEETVQKEAIRKQGLLQWLD---SLQSDDPTSPDLRLTVGAMIVEEMRAAIESKTGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEVLGIEYMGDLTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLALELEERLTKDRNDNDRVATQLVVS---IRFQGDRRLS-SLRRCCALPRYDAHKMSQDAFAAIRNCNTSG----IQTEWSPPLTMLFLCATKFSAAAPPACTDITAFL-------SSDSSCQPKVPIASS 458          
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Match: sp|Q9VNX1|POLH_DROME (DNApol-eta OS=Drosophila melanogaster OX=7227 GN=DNApol-eta PE=1 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 3.956e-91
Identity = 171/475 (36.00%), Postives = 261/475 (54.95%), Query Frame = 2
Query:   59 KSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRAT----DEQCD--------------DVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVD 1429
            K + +++L+DMDCF+ QVE K  P+Y  +  AVVQYN WRGGG              IIAV+Y ARAKGV R MRGDEAK  CP+I L  VP  R KAD +KYR+AG EV   L +    +ERAS+DEA++DIT+ V++ +  +   G  A+    + + +    AVGY S  D+++ +    A     DE+                D+RL +GA +  ++R  V    GY CSAGIAH+K  AK A G++KPN+QT++P    + L ++  + KI+ LGGK G  V + L +  MGQ+  FS   L   F +K G WL+++ RG D E+V  R  ++SIGC K+FPG N++  +  +++WL +++ E+ +R+ +D   N R   HM V Y Q  DG +    ++ SR   L++     I + +  ++           ++ +    +  LG+S GKF+   + +N +     +
Sbjct:   13 KYDRVVLLVDMDCFFCQVEEKQHPEYRNRPLAVVQYNPWRGGG--------------IIAVNYAARAKGVTRHMRGDEAKDLCPEIVLCQVPNIREKADTSKYRDAGKEVANVLQRFTQLLERASVDEAYLDITETVNHRMQQMQS-GAFAL----QPQELVNTFAVGYPSIGDYVNKITNRFANPYMDDERYQMSYDQNDLPAVRQSDIRLLIGASVAGEVRAAVKKETGYECSAGIAHNKILAKLAAGMNKPNKQTILPLTETASLFDSLPVGKIKGLGGKFGEVVCETLGIKFMGQVVKFSEVDLQRKFDEKNGTWLFNISRGIDLEAVTPRFYSKSIGCCKKFPGRNNITGLKTLQHWLGELSSEINDRLEKDFIENNRRAKHMVVQYVQDIDGEE----VASSRSTALRDYDQESIVRLSLDLIKANTKTFLRPGSESALNNAIKFLGISVGKFETVSSGQNKLQEMFAN 464          
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Match: sp|Q8H2D5|POLH_ARATH (DNA polymerase eta OS=Arabidopsis thaliana OX=3702 GN=POLH PE=1 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 8.837e-85
Identity = 160/397 (40.30%), Postives = 229/397 (57.68%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELR----ATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGN-DSRKSLSGSRVVPLK 1246
            +I  +DMDCFYVQVE +  P+  G  SAVVQYN W+GGG              +IAVSYEAR  GV RSMRGDEAK  CP I L  VP  RGKADL  YR+AG+EV+  L+K   C ERASIDE ++D+TD  +++L        L ++    D  +   H +G ++  D  D    +R      D    D  L+ G  +V ++R+ V     + CSAGIAH+K  AK A G++KP QQT+VP   + +L+++  I K++ LGGK+GT +Q  L V T+G L  FS  +L + +G  TG WL+++ RG   E V  R L +S G  K FPG   L ++  V++WL+Q+++E++ER+  D   N R+ + + +     R  + DS K    S+  P++
Sbjct:   13 VIAHVDMDCFYVQVEQRKQPELRGLPSAVVQYNEWQGGG--------------LIAVSYEARKCGVKRSMRGDEAKAACPQIQLVQVPVARGKADLNLYRSAGSEVVSILAKSGKC-ERASIDEVYLDLTDAAESMLADAPPES-LELI----DEEVLKSHILG-MNREDGDDFKESVRNWICREDADRRDKLLSCGIIIVAELRKQVLKETEFTCSAGIAHNKMLAKLASGMNKPAQQTVVPYAAVQELLSSLPIKKMKQLGGKLGTSLQTDLGVDTVGDLLQFSETKLQEHYGVNTGTWLWNIARGISGEEVQGRLLPKSHGSGKTFPGPRALKSLSTVQHWLNQLSEELSERLGSDLEQNKRIASTLTLHASAFRSKDSDSHKKFP-SKSCPMR 387          
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Match: sp|O42917|ESO1_SCHPO (N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eso1 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.214e-33
Identity = 114/411 (27.74%), Postives = 188/411 (45.74%), Query Frame = 2
Query:   32 LRFWDH*KMKSNPIIVL--IDMDCFYVQVELKAAPQYVGKESAV-VQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDI-----------------HLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLK-DRRDRSIEGCHA--------VGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVS 1177
            L++ D    +++P+ V+  ID D FY QVE       +G + +V +    W+G                +IAV+Y ARA  ++R     EAK+KCP++                 H    P N  K  L  YR+   +++  + KHA  V++ASIDE FI++T +V  ++     L E   LK    D ++    A         G V   + +D   E    D   DDV L   A +V+++R+D+Y  L Y CSAG++ +   +K     +KPN+QT++  + I D + +  I  IR LGGK G  +   L   ++  +   S+  L D  G   GP +++LC G D+  + ++   +S+  +K F      +  D +  W    A ++  R  E      R P  +C++
Sbjct:   13 LQYCDKAGTQNSPLRVVAHIDQDAFYAQVE----SVRLGLDHSVPLAVQQWQG----------------LIAVNYAARAANISRHETVTEAKKKCPELCTAHVKTWKAGESEAKYHENPNP-NYYKTCLDPYRHESVKILNIIKKHAPVVKKASIDECFIELTSDVKRIV-----LEEYPYLKIPSEDSNVALPQAPVLLWPAEFGMVIEEEVVDRTKEDYERD--WDDVFLFYAAKIVKEIRDDIYLQLKYTCSAGVSFNPMLSKLVSSRNKPNKQTILTKNAIQDYLVSLKITDIRMLGGKFGEEIINLLGTDSIKDVWNMSMDFLIDKLGQTNGPLVWNLCHGIDNTEITTQVQIKSMLSAKNFSQQKVKSEEDAIN-WFQVFASDLRSRFLE--LEGMRRPKTICLT 392          
BLAST of DNA polymerase eta vs. TrEMBL
Match: A0A1S3KD68 (DNA polymerase eta OS=Lingula unguis OX=7574 GN=LOC106180842 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.800e-120
Identity = 211/469 (44.99%), Postives = 277/469 (59.06%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGY----------------VSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKN-DISRFLV 1426
            +I L+DMDCFYVQVE +  P   GK  AVVQYN W+GGG              IIAV YEARA GV R MRGDEAK+KCPDI L  VPE RGKADLTK+R AGAEVI  LSK   CVERASIDEA++D+T EV+     L ++G   +L  +    ++  + VG+                    DWL    +  A  +Q  DVRLA+GA + ++MR  VY   G+RCSAGIAH+K  AKF+CGVHKPN+QT++P   +  +     + K+R  GGK G  V Q+L V  +  +  +S  QL + FG+K G WL+ +CRG++ E+V +RQL +SIGCSK F G N L+T +KVRYWLDQ++ E+ ER+ +D   N R+  H+ VS   L + N     +S SR   + +     I   AF +L   NTAG       +W P ++ LG+SAGKF       N  I +FLV
Sbjct:    4 VIALVDMDCFYVQVEQRLNPALKGKPCAVVQYNAWKGGG--------------IIAVGYEARACGVTRQMRGDEAKKKCPDIVLCRVPEVRGKADLTKFREAGAEVIATLSKFCKCVERASIDEAYLDLTAEVEE---RLNEIGNTRILASQ----LQNTYVVGWEGEDSQKTQDGLDLREQGVKDWLSTCYD--AVSDQ--DVRLAVGAVIAEEMRAAVYKETGFRCSAGIAHNKMLAKFSCGVHKPNKQTVLPHSSVHKMFTTLKVTKLRGFGGKFGEEVIQKLGVENVADICKYSEQQLQNYFGEKAGSWLFAVCRGEEHEAVSARQLAKSIGCSKNFTGKNCLDTREKVRYWLDQLSGELEERLIKDKEVNNRVAKHLNVSVRYLSNPN----PVSSSRSCAIVKYERKKICDDAFSLLQKFNTAGP---HQSAWVPAIICLGMSAGKFDEMSNTANPTIKQFLV 440          
BLAST of DNA polymerase eta vs. TrEMBL
Match: A0A2R5LBP5 (Putative dna polymerase iota/dna damage inducible protein (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 5.169e-119
Identity = 222/507 (43.79%), Postives = 295/507 (58.19%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEV--DNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMA-AKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDP 1585
            IVL+DMDCFYVQVE K APQY GK  AV QYN ++GGG              +IAV+YEARA G+ R MRGD A + C D+HLF VPE RGKADLT+YRNAG EV++ +S+ +  +ERASIDEA++D++D +  D  +V+ TDL    ++        +G   V     S+WL  +    A D    D  LA  A LV+++R  V    GYRCSAGIAH+K  AK ACG+HKPNQQT++    +  L     ++K+RNLGGK+G  +++ L V T+G+++ FS   L  TFG+KTG WLYHL RG D E V  R+L +SIGC K F G   LNT DKV+YW+ Q+A+E+AER+  D   N+R    + V   Q   G       + SR  PL    +  I   A  VLS +NTA     ADGSWFPPL ++ L+A KFK  +     DIS+FL   P    +   S+ ++P   S          DS  S  +LR    +S  ++ P
Sbjct:    8 IVLVDMDCFYVQVEEKLAPQYKGKPCAVSQYNQFQGGG--------------LIAVNYEARAAGIKRGMRGDAAMKLCRDLHLFRVPEVRGKADLTRYRNAGGEVLQVMSQFSGVIERASIDEAYLDLSDVLRDDAEIVAPTDLPNTHVVGSSGTADSDG--DVRAEGVSNWLSSI----AVDSP--DYLLARAAKLVEEIRLAVLRETGYRCSAGIAHNKVLAKLACGLHKPNQQTVLTQGAVPSLFATLPVNKVRNLGGKLGEDIKETLQVETLGEVTRFSQESLITTFGEKTGSWLYHLSRGIDHEPVTLRKLAKSIGCGKNFNGKLALNTRDKVKYWVQQLAEELAERLQRDREQNSRTAQLLVVGVRQNHPGT------AVSRSCPLTCYDSGRIMNDALSVLSKLNTASP---ADGSWFPPLCNISLAASKFKDTIKEGTQDISKFLSAGPSATGMELKSSSTLPETLS----------DSHPSKDTLRDTASKSEETIKP 473          
BLAST of DNA polymerase eta vs. TrEMBL
Match: A0A2T7NW77 (UmuC domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13067 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.043e-115
Identity = 213/474 (44.94%), Postives = 275/474 (58.02%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAM--------------LKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDK-VRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF-KPQMAAKNDISRFLVDCPI 1438
            N  +VL+DMDCFYVQVE +  P   GK  AVVQY T++GGG              IIAV YEARA GV RSM GD+AK+ CPDI L  VPE RGKADLTKYR AGAEVI+ LS   +CVERASIDEA++D+T+E   LL S T  G L                +++  DR+     A  + +   WL      + T+    DV LA  A +V++MR  ++ + G++CSAGIAH+K  AK ACG+HKPN+QT+VP   +  +     + KIR+LGGK+G  + ++L V  MG L  FSL QL   +G KTG WL+  CRG D ESV +RQL +SIGCSKRF G   L+  +K V YW+ Q+A+EV+ER+ +D   N R    MCVSY           S++GSR   L       ++ AAF +L   NT G C     SW P +  LGLSA KF + Q A   DI+       +
Sbjct:    2 NRAVVLVDMDCFYVQVEQRLNPDLKGKPCAVVQYKTYKGGG--------------IIAVGYEARALGVTRSMMGDDAKKICPDIVLARVPEVRGKADLTKYREAGAEVIEVLSNFCNCVERASIDEAYLDLTEEAKKLLTSQTS-GSLTADQLSNTFVEGFGDDVEEDMDRAQLNEEAARHRNTDKWLKQAHASKETNS--GDVLLAATALIVEEMRATIFKNTGFQCSAGIAHNKMLAKLACGLHKPNKQTIVPQGSVEKIFMTLPVRKIRSLGGKLGASLTEELQVQNMGDLCQFSLQQLQTCYGSKTGLWLHQACRGFDYESVSARQLPKSIGCSKRFLGKERLDKKEKVVLYWIGQLAKEVSERLIKDQEINKRTAKSMCVSYQYCAKPT----SVTGSRACALVSYDHKKMTDAAFGLLQKFNTCGAC---KDSWSPSITVLGLSATKFEEEQSATHQDIATLFASAAV 451          
BLAST of DNA polymerase eta vs. TrEMBL
Match: A0A1Z5LFU5 (DNA polymerase eta (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.118e-115
Identity = 205/469 (43.71%), Postives = 287/469 (61.19%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVD-NLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMA-AKNDISRFLVDCPINKSVASTSNKSV 1474
            +VL+DMDCFYVQVE K APQY GK  AV QYN ++GGG              +IAV+YEARA GV R MRGD A + CPDIHLF VPE RGKADLT+YR+AGAEV++ +S++AS +ERAS+DEA++D+TD +  ++LV+  DL    ++    +   +GC  +G  + S+WL        T     +  LA  A LV+++R  +    GYRCSAGIAH+K  AK ACG+HKPNQQT++P   +  L     +  +RNLGGK+G  ++++L V T+G+++ FS   L +TFG+K G WLY L RG D E V  R+L +SIGC K F G   LNT +KV+YW+ Q+A+E+AER+  D   N R    + +   Q    N + +  + SR   L    +  I+  A  VL+ +NTA      + +W PPL ++ L+A KF+  +  +  DIS+FL   P   +   T +KSV
Sbjct:   51 VVLVDMDCFYVQVEEKLAPQYKGKPCAVSQYNQFKGGG--------------LIAVNYEARAAGVKRGMRGDAAMKLCPDIHLFRVPEVRGKADLTRYRDAGAEVLQVMSQYASIIERASVDEAYLDLTDVLGADMLVAPGDLPNTHVVST--ESHPDGC--IG--ALSEWL------LGTGVDSPEHLLARAAKLVEEIRAAILQKTGYRCSAGIAHNKVLAKLACGLHKPNQQTILPQSAVPGLFVTLPVQNLRNLGGKLGEDIKEKLQVETLGEVARFSQETLVNTFGEKVGSWLYQLVRGIDHEPVSLRKLAKSIGCGKNFNGKLALNTKEKVKYWVQQLAEELAERLQRDKEQNGRSAQLLVIGVRQ----NHASQGTAISRSCQLTTYDSGKIAHDALAVLTRLNTA-----TNENWTPPLCNISLAASKFRDSLGESTQDISKFLSARPAMSTATLTESKSV 484          
BLAST of DNA polymerase eta vs. TrEMBL
Match: W4Y5M1 (UmuC domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 3.268e-114
Identity = 208/504 (41.27%), Postives = 286/504 (56.75%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGY--VSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSL--SGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKN-DISRFLVDCPINKSVA--STSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANE 1561
            +++LIDMDCFYVQVE +  P   GK +AVVQYN+W+GG               IIAVSYEARA GV R MRG EA+ KCP I L +VPENRGKADLT+YR AGAEVI  L K++  VERAS+DEA++D+TD+V   L  + D G++   +      I G H V    V   D     +E   T       RL +GA + ++MR  V+   G+RCSAGI+H+K  AK ACG HKPN+Q+++P + +  +     I K RNLGGK+G  + + L V  MG L  ++  QL   + +KTG WLY +CRG DDE V  RQL +S GCSK FPG N L+T DKV++W   +A+EV  R+  +  TN R   H+ VS  Q      + K L  + SR   + ++++  I+K  F V+  +N AG+   A   W P +  LG+SA KF    ++K+  I  FL   P   +        + VP  +   + ++  TLD   + S+     E
Sbjct:    4 VVILIDMDCFYVQVEQRRDPTLKGKPAAVVQYNSWKGGA--------------IIAVSYEARAFGVTRQMRGAEARGKCPAIQLVTVPENRGKADLTRYREAGAEVITVLCKYSDSVERASVDEAYVDVTDQVQTRLAQMEDQGQVLDPEQLHQTFIAG-HDVAEEGVDIEDVRKRGLETWLTSADLATKRLGVGALIAEEMRAAVFKDTGFRCSAGISHNKMLAKIACGFHKPNRQSVLPPEGLDKVYKTIPIRKFRNLGGKLGHSISEDLGVEYMGDLLRYTEKQLQKRYSEKTGTWLYSICRGIDDEPVRPRQLAKSTGCSKTFPGKNALDTRDKVKHWFRSLAEEVEHRLLREEETNNRTAKHLTVSVGQ------AGKPLMTTASRSCAIHQISSEKIAKDCFSVIQNLNHAGNHQAA---WSPAITYLGISASKFVEGGSSKSGSIQSFLSSGPSKPATTLLKEDQQEVPSPERAQDQTSRRTLDRFLTQSTKEPKQE 483          
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Match: poli (DNA polymerase iota [Source:NCBI gene;Acc:103044286])

HSP 1 Score: 122.094 bits (305), Expect = 1.883e-28
Identity = 125/456 (27.41%), Postives = 200/456 (43.86%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASID-KIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTA----AGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFL 1423
            +I+  D+DCFY QVE+   P    K   V Q              ++I     I+  +Y AR + V + M   EA +KCPD+ L      +G+ DLT YR+   +V + L      VER   DE F+D+++ V+  +               +D SI     VG+V   +         ++ E  D  RLA+G+ +  ++RE + + LG    AG+A SK  AK   G  KPNQQT +     ++LMN+ S   K+  +G +    + + L V ++  L  F L  L   FG+  G  + +L  G D   V      QS+     F     ++T+ +V+  + ++   + ER+ +D     RLP  + ++    R    SR     SR  P+ + TA     G  +A   +LS V    H  +  G  F  L  L +     + + + +N IS F 
Sbjct:   45 VILHFDLDCFYAQVEMIRNPALRSKPLGVQQ--------------KYI-----IVTCNYVARERSVTKLMGVKEALEKCPDLVLV-----KGE-DLTHYRDISYKVTELLMSFCPLVERLGFDENFVDVSEMVETRM---------------KDTSISDLSFVGHVYGHEA--------SSVEVGDHSRLAVGSAIAAELREALRSRLGLTSCAGVATSKLLAKLVSGAFKPNQQTTLLPQSSAELMNSLSGPCKVPGIGYRTVEKL-KVLGVVSVRDLQLFPLRDLIREFGEVNGRRIQNLACGVDLSPVTPAGPPQSLSDEDSF---KKISTVREVQSKVTELLNSLCERMCKD----GRLPQTVRLTLR--RASAPSRWFSRESRQCPIPKHTAQKIITGCGEAVPQLLSIVMKLFHKLVNAGDPF-HLTLLNVCFSNLQTKNSGRNAISSFF 441          
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Match: poli (DNA polymerase iota [Source:NCBI gene;Acc:103044286])

HSP 1 Score: 121.709 bits (304), Expect = 2.431e-28
Identity = 125/456 (27.41%), Postives = 200/456 (43.86%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASID-KIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTA----AGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFL 1423
            +I+  D+DCFY QVE+   P    K   V Q              ++I     I+  +Y AR + V + M   EA +KCPD+ L      +G+ DLT YR+   +V + L      VER   DE F+D+++ V+  +               +D SI     VG+V   +         ++ E  D  RLA+G+ +  ++RE + + LG    AG+A SK  AK   G  KPNQQT +     ++LMN+ S   K+  +G +    + + L V ++  L  F L  L   FG+  G  + +L  G D   V      QS+     F     ++T+ +V+  + ++   + ER+ +D     RLP  + ++    R    SR     SR  P+ + TA     G  +A   +LS V    H  +  G  F  L  L +     + + + +N IS F 
Sbjct:   31 VILHFDLDCFYAQVEMIRNPALRSKPLGVQQ--------------KYI-----IVTCNYVARERSVTKLMGVKEALEKCPDLVLV-----KGE-DLTHYRDISYKVTELLMSFCPLVERLGFDENFVDVSEMVETRM---------------KDTSISDLSFVGHVYGHEA--------SSVEVGDHSRLAVGSAIAAELREALRSRLGLTSCAGVATSKLLAKLVSGAFKPNQQTTLLPQSSAELMNSLSGPCKVPGIGYRTVEKL-KVLGVVSVRDLQLFPLRDLIREFGEVNGRRIQNLACGVDLSPVTPAGPPQSLSDEDSF---KKISTVREVQSKVTELLNSLCERMCKD----GRLPQTVRLTLR--RASAPSRWFSRESRQCPIPKHTAQKIITGCGEAVPQLLSIVMKLFHKLVNAGDPF-HLTLLNVCFSNLQTKNSGRNAISSFF 427          
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Match: polh (polymerase (DNA directed), eta [Source:ZFIN;Acc:ZDB-GENE-060421-4949])

HSP 1 Score: 102.834 bits (255), Expect = 1.161e-22
Identity = 50/98 (51.02%), Postives = 62/98 (63.27%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTK 364
            ++ L+DMDCFYVQVE +  P+   K   V QY TW+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ +  V E+ GKADLTK
Sbjct:    8 VVALVDMDCFYVQVEQRMNPELRHKPCVVAQYKTWKGGG--------------IIAVSYEARAHGVTRNMFADDAKKLCPDLRVARVRESHGKADLTK 91          

HSP 2 Score: 93.9745 bits (232), Expect = 7.941e-20
Identity = 57/141 (40.43%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  959 WLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF 1381
            WLY LCRG + E V  RQL +SIGCSK F G   L T  +V++WL Q+A E+ ER+++D   N R+   + V    +R   D R S S SR   L    A+ ++  +  ++  +NTAG    A   W P L  L LSA KF
Sbjct:  144 WLYDLCRGIEFEPVKPRQLPKSIGCSKNFAGKTALATKKQVQHWLHQLALELEERLNKDREMNGRVAKLLTVG---VRQAGDKRLS-SFSRCCALARYEASKMTADSLAIIKSLNTAGSHQEA---WCPALTCLHLSASKF 277          
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Match: polh (polymerase (DNA directed), eta [Source:ZFIN;Acc:ZDB-GENE-060421-4949])

HSP 1 Score: 102.834 bits (255), Expect = 1.369e-22
Identity = 50/98 (51.02%), Postives = 62/98 (63.27%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTK 364
            ++ L+DMDCFYVQVE +  P+   K   V QY TW+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ +  V E+ GKADLTK
Sbjct:    8 VVALVDMDCFYVQVEQRMNPELRHKPCVVAQYKTWKGGG--------------IIAVSYEARAHGVTRNMFADDAKKLCPDLRVARVRESHGKADLTK 91          

HSP 2 Score: 93.9745 bits (232), Expect = 1.058e-19
Identity = 57/141 (40.43%), Postives = 77/141 (54.61%), Query Frame = 2
Query:  959 WLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKF 1381
            WLY LCRG + E V  RQL +SIGCSK F G   L T  +V++WL Q+A E+ ER+++D   N R+   + V    +R   D R S S SR   L    A+ ++  +  ++  +NTAG    A   W P L  L LSA KF
Sbjct:  144 WLYDLCRGIEFEPVKPRQLPKSIGCSKNFAGKTALATKKQVQHWLHQLALELEERLNKDREMNGRVAKLLTVG---VRQAGDKRLS-SFSRCCALARYEASKMTADSLAIIKSLNTAGSHQEA---WCPALTCLHLSASKF 277          
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Match: rev1 (REV1 DNA directed polymerase [Source:NCBI gene;Acc:103044976])

HSP 1 Score: 92.4337 bits (228), Expect = 7.748e-19
Identity = 92/396 (23.23%), Postives = 145/396 (36.62%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRG------GGYTICELRFIQ---------------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERV 1126
            I+ +DMDCF+V V ++  P+ +GK  AV   N  RG      G     E+++ Q                                       S+  I + SYEAR  GV   M   +AKQ CP +   SVP      D   Y+     + + L+ +   +E  S DEA +D T            L EL +  D                                            L   +R DV    G   S G+  +   A+ A    KPN Q  +  + + D + + S+  +  +G  M + +   L V+T G L   S+ +L   FG +TG  L+  CRG DD  V S +  +S+     +  +      ++   +L  ++ EV +R+
Sbjct:  474 ILHVDMDCFFVSVGIRHRPELIGKPVAVTS-NRGRGVVPQRAGANPQLEMQYYQKKRTQYRAGGADTDIEMTPSPENEETCSNGVEQNDLAALSMAEIASCSYEARKAGVRNGMFFGQAKQLCPGLQ--SVP-----YDFQAYKEVALAMYETLASYTYNIEALSCDEALVDAT----------ALLAELGITPDE-------------------------------------------LASAIRTDVREKTGCSASIGMGSNILLARMATRKAKPNGQYFLRPEEVDDFIRDQSVTSLPGVGRSMSSKLAS-LGVNTCGDLQQVSMVRLQKEFGPRTGQTLFRFCRGLDDRPVRSEKERKSVSAEMNY--NIRFTQDEEAETFLTNLSMEVQKRL 805          
BLAST of DNA polymerase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009425.1 (pep scaffold:Pmarinus_7.0:GL478442:69188:73716:-1 gene:ENSPMAG00000008525.1 transcript:ENSPMAT00000009425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.980e-18
Identity = 61/166 (36.75%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  959 WLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLV-DCPINKSVA 1453
            WL+ LCRG + E V  RQL +SIGCSK F G   L+T +KV++WL Q++ E+ ER+S+D   N R+   +      +R   D R     SR  PL    A  I+  A  +++  NTAG        W P +  L LSA KF    ++   I+ FL  D    +S+A
Sbjct:    2 WLHDLCRGVEFEPVRPRQLPKSIGCSKNFMGREALDTKEKVQHWLQQLSLELEERLSKDRDMNNRVAKLLTAG---VRLSGDQRY-WGLSRSCPLARYDARRIASDALALIAASNTAG---AQHAEWSPAVTCLYLSATKFSDSASSSGGIASFLTGDASATQSLA 160          
BLAST of DNA polymerase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005239.1 (pep scaffold:Pmarinus_7.0:GL477257:209381:216639:1 gene:ENSPMAG00000004738.1 transcript:ENSPMAT00000005239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.872e-9
Identity = 47/165 (28.48%), Postives = 68/165 (41.21%), Query Frame = 2
Query:   62 SNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYN-----TWRGGGYTICELRFIQ---------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDIT 460
            S+P+I+ +DMDCF+V V ++  P   GK  AV           R G     E+++ +                           S+  I + SYEAR  GV   M    AK  CPD+   +VP      D   YR     + + L+   + VE  S DEA +D+T
Sbjct:  416 SSPVIMHVDMDCFFVSVGIRDRPDLKGKPVAVTHTQGRGSQRPRPGADPHYEMQYYERKLDRGRTDGRGEGGGGGRVASDTAPMSMAEIASCSYEARRAGVKNGMFFGRAKLLCPDLQ--TVP-----YDFDGYREVAQALYETLASFTNEVEALSCDEAMLDVT 573          
BLAST of DNA polymerase eta vs. Ensembl Sea Lamprey
Match: polk (polymerase (DNA directed) kappa [Source:ZFIN;Acc:ZDB-GENE-060526-137])

HSP 1 Score: 53.5286 bits (127), Expect = 1.292e-7
Identity = 70/293 (23.89%), Postives = 110/293 (37.54%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIK-CLSKHASCVERASIDEAFIDITDEVDNLLV----SLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAF-------------------------LVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPN-QQTLVPS-DRISDLMNNASIDKIRNLG 847
            N  IV +DMD FY  VE++  P+   K  AV                    S+  +   +Y AR  GV  +M G  AK+ CPD+ +  +       +  KY     +V++  L+ +       S+DEA++DIT  +           T      + +    ++ E      + SYS  L       +T  Q      A   F                          V++MR  +    G   SAGIA +   AK    ++KPN Q  L P+ D I + ++   I K+  +G
Sbjct:   82 NRTIVHVDMDMFYAAVEMRDFPELKDKPMAV-------------------GSMSMLSTSNYHARRFGVRAAMPGFIAKKLCPDLVICPL-------NFNKYSAVSKQVVREVLADYDPNFLPMSLDEAYLDITAHLAERQAWPESRRTFAAHEGLCQTTDKQTDEANDGASFESYSPEL-----FDSTPPQVGGSENAASGFGASASRNGAPERSSTAVVFGLSVEEAVREMRFRIEQKTGLTASAGIAPNMLLAKVGSDMNKPNGQYRLEPTRDAIRNFVDELPIRKVSGIG 343          
BLAST of DNA polymerase eta vs. Ensembl Yeast
Match: RAD30 (DNA polymerase eta; involved in translesion synthesis during post-replication repair; catalyzes the synthesis of DNA opposite cyclobutane pyrimidine dimers and other lesions; involved in formation of post-replicative damage-induced genome-wide cohesion; may also have a role in protection against mitochondrial mutagenesis; mutations in human pol eta are responsible for XPV [Source:SGD;Acc:S000002827])

HSP 1 Score: 81.2629 bits (199), Expect = 1.775e-16
Identity = 108/428 (25.23%), Postives = 172/428 (40.19%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVV--QYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPD---IH--LFSVPEN----------------------RGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLV-----SLT-DLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLM------------ELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMN--NASIDKIRNLGGKMGTFVQQQLNV--------------STMGQLSAFSLGQLTDTFGDKT------------GPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSE 1132
            I  IDM+ F+ QVE       + KE  VV  Q+N+                   IIAVSY AR  G++R     EA +KC +   IH  +F   E+                        K  L  YR    + +K        VERASIDE F+D+     N+L+      LT DL     L + R+  I G + +   S+   +   +            E R      DDV LALG+ + + +R+ + + LGY  S G++ +K   K A    KP+ QT+V +D + D ++     I     LGG +G  +   L++                 GQL  F   ++  +  D++               L+ L RG+    + SR + +S+  +K   G +  + +D +  WL+    E+  R+ +
Sbjct:   26 IAHIDMNAFFAQVEQMRCG--LSKEDPVVCVQWNS-------------------IIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDIN--SHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCIS-WLEVFCAELTSRIQD 429          
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Match: EDO42211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S226])

HSP 1 Score: 303.908 bits (777), Expect = 7.297e-98
Identity = 162/359 (45.13%), Postives = 223/359 (62.12%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGY-VSYSD-----WLDHLMELRATDEQCDDVR-LALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERV 1126
            +I L+DMDCFYVQVE +  P+  GK  AVVQYN W+GGG              IIAVSYEARA GV R+MRGDEAKQKCPDI L  VP  RGKA+L  YR+AGAEV++ L+ +    ERAS+DEA++D+T+     L  +T + E+A  +  R  +IEG  + G   + SD     WL  L       E    +R LA GA +  +MR  V    G+ CSAG+A +K  AK  CG++KP++QTL+P   +++L     + K+R+LGGK+G+ +  +LNV  MG L  F +  L   FG K G  LY+LCRG D+E V +RQL +S+ C K FPG   L+T  +V++W++Q+ +E+ ER+
Sbjct:    7 VIALVDMDCFYVQVEQRRCPELKGKPCAVVQYNAWKGGG--------------IIAVSYEARACGVTRNMRGDEAKQKCPDIALVQVPVLRGKANLAHYRDAGAEVLEVLTTYCDNCERASVDEAYLDLTNSAQKKLSVMT-VPEIAE-EVWRTTAIEGLSSKGSDTTISDELQKEWLSQL-------EASPYLRNLAAGAVIAAEMRHAVLEKTGFTCSAGVATNKVLAKLCCGLNKPDKQTLLPHSAVTNLFKTMPLRKVRHLGGKLGSQLHSELNVEFMGDLLQFKINDLKAQFGSKNGELLYNLCRGIDNEPVRARQLPKSVSCGKNFPGKTKLSTCQQVKFWMEQLVEELHERL 342          
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Match: EDO38905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBP1])

HSP 1 Score: 127.487 bits (319), Expect = 9.080e-32
Identity = 97/365 (26.58%), Postives = 179/365 (49.04%), Query Frame = 2
Query:   65 NPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCH-AVGYVSYSDWLDHLMELRATDEQCD---DVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLG----GKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSED 1135
            N +IV ID+DCFY QVE+   P    +   V Q +                    ++  +Y ARA G+ + +   EAK+KCPD+ + +        DLTKYR   + V K L + A  VER  +DE ++D+++                ++++R   +  G + AVG +    + D++++  +++E C      RL +G+ +  ++R+ +++ +G    AGIAH+K  AK A   +KPN+QTL+ ++R+  LM    + K+  +G     ++G+     L ++T+ +L   S   L + F  +    L+ L  G DD  V +  + +SI     +   ++L +++ V+  L  +   +  R++ED
Sbjct:    2 NRVIVHIDIDCFYAQVEMIRNPCLRDRPVGVSQKHI-------------------LVTCNYVARAMGLKKLISLAEAKKKCPDLVIIN------GEDLTKYREFSSRVTKLLRRFALRVERLGLDENYVDVSE----------------LVQERMKHAPRGSYIAVGCI----YGDNILK-GSSNEVCPCGCHERLTVGSVIASELRKAIFDEIGLTTCAGIAHNKLLAKIAGEQNKPNKQTLLYTERVEGLMGLLPVRKVPGIGRSTCARLGS-----LGITTIAELQECSKKALLNEFNSQEVRILHALSHGADDSQVSTDSMPKSISEEDSY---SNLCSLESVKTNLRVLIGNLIPRITED 312          
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Match: EDO49981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV5])

HSP 1 Score: 80.4925 bits (197), Expect = 1.125e-15
Identity = 97/388 (25.00%), Postives = 153/388 (39.43%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELR---------------------------FIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDI----HLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLN---VSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSE 1132
            +I+ IDMDCF+V V ++  P+  GK  AV ++N   GGG   CEL+                           F  S+  I + SY AR  GV   M   +A++ CPDI    +LF            KYR     + + L  ++  +E  S DEAF+D+T  +D    + T+   LA       R+   C+A   +S +  L  +         C  +    G F +   RED                                         D++   +  K ++L G +G  + ++LN   V T   L   SL  L   FG KTG  L+  CRG DD  +   +  +S+     + G       + V++ ++++A EV +R+ E
Sbjct:  285 VIMHIDMDCFFVSVYVRDHPELDGKPVAVSRFNG--GGG---CELKSSHIVNYEMSFPTGFVADLTSPDKSSAFFNSMSEIASCSYAARECGVRNGMFLGQARKLCPDITCVPYLFD-----------KYRQVSQRLYEILVSYSHDIEAVSCDEAFLDVTHSLD----AGTEPMALAQQIRAEIRAATRCNASAGISSNVLLARM---------CTRIAKPDGQFYLS--RED-----------------------------------------DVIQFMASQKAKDLPG-VGWALSKKLNDMGVETCADLQKLSLQALQKEFGPKTGLSLHRSCRGVDDRPLRVERERKSVSAEINY-GIRFTQDYEGVKF-IEELAGEVHKRLRE 597          
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Match: EDO28363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6P5])

HSP 1 Score: 66.2402 bits (160), Expect = 2.778e-12
Identity = 42/162 (25.93%), Postives = 81/162 (50.00%), Query Frame = 2
Query:  647 GAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPG--SNHLNTIDKVRYWLDQMAQEVAERV 1126
             + + Q++R+ +++ L  R SAGI+ +K  AK A  ++KPN Q  +  + +   +    I+K   + GK+         +     L  ++  +L  TFG K+G   YH+ RG  +  V   ++ +SI   + F    S+ +  I++    LD++A E+ +R+
Sbjct:   45 ASLIAQEIRQRIWDELTLRASAGISINKFIAKIASDINKPNGQKTINPEEVVSFLEELPINKFFGI-GKVTAAKMHNYGIFKGADLKKWTKEELEATFG-KSGAQYYHIVRGIHNSQVKPNRVRKSIAAERTFTENISSEIYMIER----LDKIAVELEKRM 200          
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Match: EDO29212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4A2])

HSP 1 Score: 54.299 bits (129), Expect = 1.197e-7
Identity = 72/270 (26.67%), Postives = 104/270 (38.52%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATD-EQCDDVRLALGAFL---------VQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDR--ISDLMNNASIDKIRNLG 847
            IV +DMD FY  VE++  P    K  AV                    S   +   +Y AR  GV  +M G  AK+ CP  HL  VP         KYR     V     ++       S+DEA++D+TD     L+      E  +   +  R  +   + G  S S+  +      A + E    V  ++G  +         VQ++R  + N      SAGIA +   AK     +KPN Q  +  DR  I   +    I KI  +G
Sbjct:   85 IVHVDMDAFYAAVEMRDDPSLKDKPMAV-------------------GSTSMLSTSNYPARRYGVRAAMPGFIAKKLCP--HLIIVP-----LHFDKYRAVSKIVRGIFREYDPRFVPMSLDEAYLDLTD----YLIERQRKTEKRLFYKKVYR--QTSPSAGVPSESESSEACGSNTAQESENVPSVAESVGEPIEFGNDVKDVVQEIRFRIENETQLTASAGIACNVLLAKVCTDCNKPNGQFYLKPDREEIVSFVKTLPIRKISGIG 322          
BLAST of DNA polymerase eta vs. Ensembl Medaka
Match: polh (DNA polymerase eta [Source:NCBI gene;Acc:101174214])

HSP 1 Score: 357.066 bits (915), Expect = 3.123e-113
Identity = 206/500 (41.20%), Postives = 286/500 (57.20%), Query Frame = 2
Query:   71 IIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVG------------YVSYSD---------WLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFL-VDCPINKSVASTSNKSVPIADSNFEDS 1504
            ++ L+DMDCFYVQVE +  P        V QY TW+GGG              IIAVSYEARA GV R+M  D+AK+ CPD+ +  V E+ GKADLT YR+A  EVI+ +S+ A  +ERASIDEA++D+T  V   L + T+      L   +   I+G    G             + Y +         W++ L    + +  C +++L +GA +V++MR  V    G+RCSAGI+H+K  AK ACG++KPN+QT++P + +++L N+  I KIRNLGGKMG  + + L V  MG L+ FS  QL   FG+KTG WLY LCRG + E+V  RQL +SIGCSK FPG   L T ++V+YWL Q+A E+ ER+++D  TN R+   + V   QL D    ++  S SR   L    AA +S  +F ++  +NTAG+   A   W PPL  L LSA KF     +   I+ FL       +SV++TS  S P A    +DS
Sbjct:    8 VVALVDMDCFYVQVEQRLNPALRNTPCVVAQYKTWKGGG--------------IIAVSYEARAHGVTRNMWVDDAKKLCPDLQVARVRESHGKADLTHYRDASVEVIEVMSRFA-VIERASIDEAYMDLTAAVQQRLKTTTEEQMSPCL--LKTTYIQGYPQSGLDPPSADASPEEMILYKEELRSKGLQQWMESLPTPSSGELNCAELQLTMGALIVEEMRAAVEKQTGFRCSAGISHNKVLAKLACGLNKPNRQTVLPLESVTELFNSLPIGKIRNLGGKMGASIIETLKVENMGDLTRFSQSQLVQHFGEKTGQWLYDLCRGVESEAVKPRQLPKSIGCSKNFPGKTSLATKEQVQYWLHQLALELEERLNKDKETNGRVAKLLTVGVRQLGD----KRPSSFSRCCALVHYEAAKLSSDSFAIIKSLNTAGNHQAA---WTPPLTLLHLSASKFS-DAPSSGGIAGFLSAGVAPGRSVSATSKVSTPQASELKQDS 482          
BLAST of DNA polymerase eta vs. Ensembl Medaka
Match: rev1 (REV1 DNA directed polymerase [Source:NCBI gene;Acc:101172774])

HSP 1 Score: 94.7449 bits (234), Expect = 1.463e-19
Identity = 92/396 (23.23%), Postives = 142/396 (35.86%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYN-----TWRGGGYTICELRFIQ--------------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSE 1132
            I  +DMDCF+V V ++  P   GK  AV           R G     E ++ Q                                      S+  I + SYEAR  GV   M   +AKQ CP +   SVP      D   Y+     + + L+ +   +E  S DEA ID +  +  L +S  D                                                     L Q +R D+    G   S G+  +   A+ A    KPN Q  + S+ + D + +  + ++  +G  MG  +   L V+T G L   SL QL   FG +TG  L+  CRG DD  V   +  +S+     +  +     +++   +L  ++ EV +R+ E
Sbjct:  547 IFHVDMDCFFVSVGIRHRPDLKGKPVAVTSNRGHGRVPTRPGANPQVEQQYYQRKHAHPQPEKEGDLLHTSPSQDSPDSYANGVNLDSAALSMAEIASCSYEARQAGVRNGMFFGKAKQLCPSLQ--SVP-----YDFEAYKEVAINMYEILASYTRDIEALSCDEALIDGSALLAELGISPDD-----------------------------------------------------LAQAIRADIKEKTGCSASVGMGSNILLARLATRKAKPNGQYFLKSEEVDDFIRDLPVTRLPGVGHVMGKKLAT-LGVTTCGDLQQVSLSQLQRMFGPRTGQTLFRFCRGLDDRPVRCEKERKSVSAEMNY--NIRFTKVEEAESFLSNLSMEVQKRLRE 879          
BLAST of DNA polymerase eta vs. Ensembl Medaka
Match: rev1 (REV1 DNA directed polymerase [Source:NCBI gene;Acc:101172774])

HSP 1 Score: 94.3597 bits (233), Expect = 1.669e-19
Identity = 92/396 (23.23%), Postives = 142/396 (35.86%), Query Frame = 2
Query:   74 IVLIDMDCFYVQVELKAAPQYVGKESAVVQYN-----TWRGGGYTICELRFIQ--------------------------------------SVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSE 1132
            I  +DMDCF+V V ++  P   GK  AV           R G     E ++ Q                                      S+  I + SYEAR  GV   M   +AKQ CP +   SVP      D   Y+     + + L+ +   +E  S DEA ID +  +  L +S  D                                                     L Q +R D+    G   S G+  +   A+ A    KPN Q  + S+ + D + +  + ++  +G  MG  +   L V+T G L   SL QL   FG +TG  L+  CRG DD  V   +  +S+     +  +     +++   +L  ++ EV +R+ E
Sbjct:  556 IFHVDMDCFFVSVGIRHRPDLKGKPVAVTSNRGHGRVPTRPGANPQVEQQYYQRKHAHPQPEKEGDLLHTSPSQDSPDSYANGVNLDSAALSMAEIASCSYEARQAGVRNGMFFGKAKQLCPSLQ--SVP-----YDFEAYKEVAINMYEILASYTRDIEALSCDEALIDGSALLAELGISPDD-----------------------------------------------------LAQAIRADIKEKTGCSASVGMGSNILLARLATRKAKPNGQYFLKSEEVDDFIRDLPVTRLPGVGHVMGKKLAT-LGVTTCGDLQQVSLSQLQRMFGPRTGQTLFRFCRGLDDRPVRCEKERKSVSAEMNY--NIRFTKVEEAESFLSNLSMEVQKRLRE 888          
BLAST of DNA polymerase eta vs. Ensembl Medaka
Match: ENSORLT00000045125.1 (pep primary_assembly:ASM223467v1:9:1943765:1946356:-1 gene:ENSORLG00000024554.1 transcript:ENSORLT00000045125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 7.984e-11
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = 2
Query:  212 IQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVD 472
            IQ    I+  +Y AR +GV + M   +AK+KCP++ L      RG+ DLT YR A  +V + LS     VER   DE F+D+T+ V+
Sbjct:   14 IQQKYIIVTCNYVARERGVTKLMSVTDAKEKCPELVLV-----RGE-DLTLYREASHQVTELLSSFCPLVERLGFDENFMDVTEMVE 94          
BLAST of DNA polymerase eta vs. Planmine SMEST
Match: SMESG000010346.1 (SMESG000010346.1)

HSP 1 Score: 1175.23 bits (3039), Expect = 0.000e+0
Identity = 620/639 (97.03%), Postives = 621/639 (97.18%), Query Frame = 2
Query:   56 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALXXXXXXXXXXXXXXXGFFARYMXXXXXXXXXXXXKTQAFXXXXXXXXXXXXXXXKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 1972
            MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG              IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSY+DWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGH DLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLR ANEESNSSLDPPQ HLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQF TK
Sbjct:    1 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG--------------IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYNDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHRDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRFANEESNSSLDPPQHHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFLTK 625          
BLAST of DNA polymerase eta vs. Planmine SMEST
Match: SMESG000010346.1 (SMESG000010346.1)

HSP 1 Score: 1152.5 bits (2980), Expect = 0.000e+0
Identity = 609/628 (96.97%), Postives = 610/628 (97.13%), Query Frame = 2
Query:   89 MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALXXXXXXXXXXXXXXXGFFARYMXXXXXXXXXXXXKTQAFXXXXXXXXXXXXXXXKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 1972
            MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG              IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSY+DWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGH DLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLR ANEESNSSLDPPQ HLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQF TK
Sbjct:    1 MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG--------------IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYNDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHRDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRFANEESNSSLDPPQHHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFLTK 614          
BLAST of DNA polymerase eta vs. Planmine SMEST
Match: SMESG000010346.1 (SMESG000010346.1)

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 589/639 (92.18%), Postives = 592/639 (92.64%), Query Frame = 2
Query:   56 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALXXXXXXXXXXXXXXXGFFARYMXXXXXXXXXXXXKTQAFXXXXXXXXXXXXXXXKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 1972
            MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG              IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTK        +  +                  I DEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSY+DWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGH DLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLR ANEESNSSLDPPQ HLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQF TK
Sbjct:    1 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG--------------IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKLSVPMVVAMTPV------------------IADEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYNDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHRDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRFANEESNSSLDPPQHHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENIYEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFLTK 607          
BLAST of DNA polymerase eta vs. Planmine SMEST
Match: SMESG000010350.1 (SMESG000010350.1)

HSP 1 Score: 1072.38 bits (2772), Expect = 0.000e+0
Identity = 579/640 (90.47%), Postives = 581/640 (90.78%), Query Frame = 2
Query:   56 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALXXXXXXXXXXXXXXXGFFARYMXXXXXXXXXXXXKTQAFXXXXXXXXXXXXXXXKQILMWHAPEHCDWHVAKALQKEISENIY-EERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 1972
            MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG              IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDK+                                        PWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGH DLADGSWFPPLLSLGLS GKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCD CC QI+MWHAPEHCDWHVAKALQKEISENIY EERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK
Sbjct:    1 MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG--------------IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKM----------------------------------------PWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHPDLADGSWFPPLLSLGLSVGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDHCCMQIIMWHAPEHCDWHVAKALQKEISENIYEEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 586          
BLAST of DNA polymerase eta vs. Planmine SMEST
Match: SMESG000010350.1 (SMESG000010350.1)

HSP 1 Score: 1051.2 bits (2717), Expect = 0.000e+0
Identity = 568/629 (90.30%), Postives = 570/629 (90.62%), Query Frame = 2
Query:   89 MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICELRFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTGPWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALXXXXXXXXXXXXXXXGFFARYMXXXXXXXXXXXXKTQAFXXXXXXXXXXXXXXXKQILMWHAPEHCDWHVAKALQKEISENIY-EERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 1972
            MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG              IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDK+                                        PWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGH DLADGSWFPPLLSLGLS GKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCD CC QI+MWHAPEHCDWHVAKALQKEISENIY EERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK
Sbjct:    1 MDCFYVQVELKAAPQYVGKESAVVQYNTWRGGG--------------IIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKADLTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGELAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAFLVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISDLMNNASIDKM----------------------------------------PWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMAQEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELTAAGISKAAFVVLSGVNTAGHPDLADGSWFPPLLSLGLSVGKFKPQMAAKNDISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCANEESNSSLDPPQQHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREEREKTQAFDSPSSSDYYYCDHCCMQIIMWHAPEHCDWHVAKALQKEISENIYEEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK 575          
The following BLAST results are available for this feature:
BLAST of DNA polymerase eta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLH3.349e-10340.40DNA polymerase eta [Source:HGNC Symbol;Acc:HGNC:91... [more]
POLH4.748e-10042.06DNA polymerase eta [Source:HGNC Symbol;Acc:HGNC:91... [more]
POLI1.743e-2727.96DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9... [more]
POLI2.367e-2229.24DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9... [more]
POLI1.654e-1926.03DNA polymerase iota [Source:HGNC Symbol;Acc:HGNC:9... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
polh-11.476e-6933.26DNA polymerase eta; POLH (DNA polymerase eta) homo... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNApol-eta3.947e-9236.00gene:FBgn0037141 transcript:FBtr0078489[more]
DNApol-iota5.759e-2525.33gene:FBgn0037554 transcript:FBtr0081797[more]
DNApol-iota5.759e-2525.33gene:FBgn0037554 transcript:FBtr0081798[more]
DNApol-iota5.759e-2525.33gene:FBgn0037554 transcript:FBtr0339606[more]
Rev14.035e-1723.58gene:FBgn0035150 transcript:FBtr0072557[more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polh3.962e-10842.16polymerase (DNA directed), eta [Source:ZFIN;Acc:ZD... [more]
polh5.150e-10842.16polymerase (DNA directed), eta [Source:ZFIN;Acc:ZD... [more]
polh5.150e-10842.16polymerase (DNA directed), eta [Source:ZFIN;Acc:ZD... [more]
poli4.469e-2726.98polymerase (DNA directed) iota [Source:ZFIN;Acc:ZD... [more]
rev13.376e-1824.62REV1 DNA directed polymerase [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ngef1.668e-3128.95neuronal guanine nucleotide exchange factor [Sourc... [more]
ngef6.011e-2628.83neuronal guanine nucleotide exchange factor [Sourc... [more]
ngef3.554e-1727.38neuronal guanine nucleotide exchange factor [Sourc... [more]
trmo1.514e-1621.96tRNA methyltransferase O [Source:Xenbase;Acc:XB-GE... [more]
trmo1.805e-1621.96tRNA methyltransferase O [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Polh4.013e-9841.56polymerase (DNA directed), eta (RAD 30 related) [S... [more]
Poli2.374e-2626.81polymerase (DNA directed), iota [Source:MGI Symbol... [more]
Polh1.482e-2552.00polymerase (DNA directed), eta (RAD 30 related) [S... [more]
Poli1.661e-2127.24polymerase (DNA directed), iota [Source:MGI Symbol... [more]
Poli1.661e-2127.24polymerase (DNA directed), iota [Source:MGI Symbol... [more]
back to top
BLAST of DNA polymerase eta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y253|POLH_HUMAN1.608e-10240.40DNA polymerase eta OS=Homo sapiens OX=9606 GN=POLH... [more]
sp|Q9JJN0|POLH_MOUSE2.807e-9741.56DNA polymerase eta OS=Mus musculus OX=10090 GN=Pol... [more]
sp|Q9VNX1|POLH_DROME3.956e-9136.00DNApol-eta OS=Drosophila melanogaster OX=7227 GN=D... [more]
sp|Q8H2D5|POLH_ARATH8.837e-8540.30DNA polymerase eta OS=Arabidopsis thaliana OX=3702... [more]
sp|O42917|ESO1_SCHPO9.214e-3327.74N-acetyltransferase eso1 OS=Schizosaccharomyces po... [more]
back to top
BLAST of DNA polymerase eta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KD689.800e-12044.99DNA polymerase eta OS=Lingula unguis OX=7574 GN=LO... [more]
A0A2R5LBP55.169e-11943.79Putative dna polymerase iota/dna damage inducible ... [more]
A0A2T7NW771.043e-11544.94UmuC domain-containing protein OS=Pomacea canalicu... [more]
A0A1Z5LFU51.118e-11543.71DNA polymerase eta (Fragment) OS=Ornithodoros moub... [more]
W4Y5M13.268e-11441.27UmuC domain-containing protein OS=Strongylocentrot... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
poli1.883e-2827.41DNA polymerase iota [Source:NCBI gene;Acc:10304428... [more]
poli2.431e-2827.41DNA polymerase iota [Source:NCBI gene;Acc:10304428... [more]
polh1.161e-2251.02polymerase (DNA directed), eta [Source:ZFIN;Acc:ZD... [more]
polh1.369e-2251.02polymerase (DNA directed), eta [Source:ZFIN;Acc:ZD... [more]
rev17.748e-1923.23REV1 DNA directed polymerase [Source:NCBI gene;Acc... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009425.11.980e-1836.75pep scaffold:Pmarinus_7.0:GL478442:69188:73716:-1 ... [more]
ENSPMAT00000005239.11.872e-928.48pep scaffold:Pmarinus_7.0:GL477257:209381:216639:1... [more]
polk1.292e-723.89polymerase (DNA directed) kappa [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RAD301.775e-1625.23DNA polymerase eta; involved in translesion synthe... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422117.297e-9845.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389059.080e-3226.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499811.125e-1525.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283632.778e-1225.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292121.197e-726.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA polymerase eta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polh3.123e-11341.20DNA polymerase eta [Source:NCBI gene;Acc:101174214... [more]
rev11.463e-1923.23REV1 DNA directed polymerase [Source:NCBI gene;Acc... [more]
rev11.669e-1923.23REV1 DNA directed polymerase [Source:NCBI gene;Acc... [more]
ENSORLT00000045125.17.984e-1140.23pep primary_assembly:ASM223467v1:9:1943765:1946356... [more]
back to top
BLAST of DNA polymerase eta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010346.10.000e+097.03SMESG000010346.1[more]
SMESG000010346.10.000e+096.97SMESG000010346.1[more]
SMESG000010346.10.000e+092.18SMESG000010346.1[more]
SMESG000010350.10.000e+090.47SMESG000010350.1[more]
SMESG000010350.10.000e+090.30SMESG000010350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034709 ID=SMED30034709|Name=DNA polymerase eta|organism=Schmidtea mediterranea sexual|type=transcript|length=2011bp
GTTTGAATAATCACGAATAATTTCTGATTATTTAAGATTTTGGGATCATT
GAAAAATGAAAAGCAATCCTATTATTGTATTAATCGATATGGATTGTTTC
TATGTTCAAGTTGAACTAAAAGCAGCGCCACAGTATGTTGGAAAAGAATC
TGCAGTTGTTCAGTATAATACTTGGCGTGGTGGAGGGTATACGATATGCG
AATTAAGATTTATCCAATCGGTTTTAAGAATAATTGCAGTTAGTTATGAA
GCAAGAGCTAAAGGTGTTAATAGATCCATGCGAGGGGATGAAGCTAAACA
AAAGTGTCCCGATATTCATTTATTTAGCGTTCCCGAAAATCGAGGAAAAG
CTGATTTAACCAAGTATCGCAACGCCGGTGCAGAAGTCATTAAATGCCTA
TCGAAACACGCGAGCTGCGTTGAACGCGCAAGCATTGATGAAGCCTTCAT
TGACATTACAGACGAGGTTGACAATTTGTTGGTTTCCCTCACCGATTTAG
GCGAGTTGGCAATGCTCAAGGATAGGAGGGACCGTTCGATTGAGGGGTGT
CATGCTGTTGGCTACGTGTCGTATAGTGATTGGTTGGATCATTTGATGGA
ATTGAGGGCCACTGATGAGCAATGTGATGATGTGAGGCTGGCATTGGGAG
CGTTCCTTGTCCAGCAAATGAGAGAGGATGTCTACAACAGTCTCGGATAC
CGTTGCTCAGCCGGCATCGCCCATAGCAAGACTACGGCAAAATTTGCTTG
CGGAGTCCACAAACCAAACCAACAAACGCTCGTACCCAGCGATCGCATCA
GCGACCTTATGAACAACGCTTCAATTGATAAAATTCGCAATCTGGGGGGC
AAAATGGGCACCTTTGTGCAGCAGCAGTTGAATGTCTCGACTATGGGCCA
ACTTTCTGCTTTCTCCCTCGGACAGTTAACTGACACGTTCGGAGACAAAA
CTGGGCCTTGGCTATACCATTTGTGCCGAGGCCAGGATGATGAGAGCGTG
CTGTCGAGACAACTGACCCAGTCAATCGGGTGCAGCAAAAGATTCCCTGG
ATCTAATCATTTGAATACAATTGATAAAGTTCGCTACTGGCTGGATCAAA
TGGCCCAAGAAGTGGCTGAGAGAGTTAGCGAGGACTGCTCTACCAATGCC
CGATTACCCACTCATATGTGCGTATCCTATCATCAGTTGCGAGATGGAAA
TGATTCTCGCAAGAGTTTGTCTGGTTCTCGCGTTGTTCCATTGAAGGAAC
TGACAGCGGCAGGCATAAGCAAGGCTGCATTTGTCGTGCTGTCTGGGGTA
AATACTGCTGGTCATTGTGATCTTGCTGATGGTTCCTGGTTCCCCCCCTT
GTTGTCGCTTGGGCTTTCTGCTGGGAAATTCAAGCCCCAAATGGCCGCCA
AAAATGACATTTCCAGATTTCTAGTCGACTGTCCAATAAACAAATCCGTT
GCTAGCACGTCTAATAAATCCGTCCCAATTGCGGATTCCAATTTCGAGGA
TTCTAATTCCGTCACTCTCGATTCAATTGCATCAGATTCCTCACTGCGAT
GCGCAAATGAGGAATCCAACTCGTCCCTTGACCCCCCTCAGCAGCATTTG
CCTGCGCTTCCTGAACCGCCAATTTCACCATTTATGCCGCCTCCTAAGAA
GAAGGGATTCTTTGCAAGGTACATGGAGAACGAGGAAAGAATCGAGAGAG
AAGAACGTGAGAAAACTCAAGCATTCGACAGTCCATCGAGTTCCGATTAT
TATTACTGCGACCAGTGCTGCAAGCAGATCCTCATGTGGCACGCACCGGA
GCATTGTGATTGGCACGTTGCCAAAGCACTACAGAAGGAAATCTCCGAGA
ATATTTATGAGGAAAGGAAATCTCGACTTGCCAAACAAAATCAAAACTCC
AAGTTAAAAAGAAAACAAATTTCGAAGCCTTCGAAATCAAATCAGTTGAA
AATAGACCAATTTTTCACCAAATAATTCTCGCCCCCCTCCAGCAATATTA
TTGATTTCCTG
back to top

protein sequence of SMED30034709-orf-1

>SMED30034709-orf-1 ID=SMED30034709-orf-1|Name=SMED30034709-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=640bp
MKSNPIIVLIDMDCFYVQVELKAAPQYVGKESAVVQYNTWRGGGYTICEL
RFIQSVLRIIAVSYEARAKGVNRSMRGDEAKQKCPDIHLFSVPENRGKAD
LTKYRNAGAEVIKCLSKHASCVERASIDEAFIDITDEVDNLLVSLTDLGE
LAMLKDRRDRSIEGCHAVGYVSYSDWLDHLMELRATDEQCDDVRLALGAF
LVQQMREDVYNSLGYRCSAGIAHSKTTAKFACGVHKPNQQTLVPSDRISD
LMNNASIDKIRNLGGKMGTFVQQQLNVSTMGQLSAFSLGQLTDTFGDKTG
PWLYHLCRGQDDESVLSRQLTQSIGCSKRFPGSNHLNTIDKVRYWLDQMA
QEVAERVSEDCSTNARLPTHMCVSYHQLRDGNDSRKSLSGSRVVPLKELT
AAGISKAAFVVLSGVNTAGHCDLADGSWFPPLLSLGLSAGKFKPQMAAKN
DISRFLVDCPINKSVASTSNKSVPIADSNFEDSNSVTLDSIASDSSLRCA
NEESNSSLDPPQQHLPALPEPPISPFMPPPKKKGFFARYMENEERIEREE
REKTQAFDSPSSSDYYYCDQCCKQILMWHAPEHCDWHVAKALQKEISENI
YEERKSRLAKQNQNSKLKRKQISKPSKSNQLKIDQFFTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036775DNA_pol_Y-fam_lit_finger_sf
IPR041298Znf_UBZ
IPR043128Rev_trsase/Diguanyl_cyclase
IPR001126UmuC
IPR017961DNA_pol_Y-fam_little_finger
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
Vocabulary: molecular function
TermDefinition
GO:0003684damaged DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePIRSFPIRSF036603DNA_pol_etacoord: 527..640
e-value: 1.9E-8
score: 31.0
coord: 1..508
e-value: 2.7E-143
score: 476.7
NoneNo IPR availableGENE3DG3DSA:1.10.150.20coord: 257..314
e-value: 4.0E-22
score: 79.8
NoneNo IPR availableGENE3DG3DSA:2.30.40.20coord: 14..99
e-value: 1.2E-70
score: 240.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 604..640
NoneNo IPR availablePANTHERPTHR45873FAMILY NOT NAMEDcoord: 6..640
NoneNo IPR availablePANTHERPTHR45873:SF1DNA POLYMERASE ETAcoord: 6..640
NoneNo IPR availablePROSITEPS51907ZF_UBZ3coord: 561..595
score: 16.228
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 6..315
IPR017961DNA polymerase, Y-family, little finger domainPFAMPF11799IMS_Ccoord: 318..445
e-value: 1.6E-4
score: 22.3
IPR036775DNA polymerase, Y-family, little finger domain superfamilyGENE3DG3DSA:3.30.1490.100coord: 315..444
e-value: 1.5E-29
score: 104.7
IPR036775DNA polymerase, Y-family, little finger domain superfamilySUPERFAMILYSSF100879Lesion bypass DNA polymerase (Y-family), little finger domaincoord: 320..442
IPR041298Ubiquitin-binding zinc fingerPFAMPF18439zf_UBZcoord: 564..595
e-value: 7.0E-7
score: 28.7
IPR001126UmuC domainPFAMPF00817IMScoord: 10..232
e-value: 2.4E-40
score: 138.0
IPR001126UmuC domainPROSITEPS50173UMUCcoord: 7..264
score: 27.404
IPR043128Reverse transcriptase/Diguanylate cyclase domainGENE3DG3DSA:3.30.70.270coord: 6..245
e-value: 1.2E-70
score: 240.0