SMED30034706

Overview
NameSMED30034706
Smed IDSMED30034706
Length (bp)1317
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034706 (SMED30034706) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034706 (SMED30034706) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034706 (SMED30034706) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034706 (SMED30034706) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034706

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30034706SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30034706SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034706SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30034706SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034706SMESG000041505.1 dd_Smed_v4_6997_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034706 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004667:7..8693 -6470
Homology
BLAST of SMED30034706 vs. Ensembl Human
Match: CNTN4 (contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174])

HSP 1 Score: 66.2402 bits (160), Expect = 5.824e-11
Identity = 82/372 (22.04%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   Y K    +      D   +V    ++ P+  +   V   N    GP    +V    +E    P   I      + ++ + W   L+K  G I GY ++    +   EN  +I         T+T + +LK    Y +++ A NS G       +  T R+ PP
Sbjct:  212 IDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKI---RTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPP 573          
BLAST of SMED30034706 vs. Ensembl Human
Match: CNTN4 (contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174])

HSP 1 Score: 66.2402 bits (160), Expect = 7.622e-11
Identity = 82/372 (22.04%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   Y K    +      D   +V    ++ P+  +   V   N    GP    +V    +E    P   I      + ++ + W   L+K  G I GY ++    +   EN  +I         T+T + +LK    Y +++ A NS G       +  T R+ PP
Sbjct:  540 IDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKI---RTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. Ensembl Human
Match: CNTN4 (contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174])

HSP 1 Score: 66.2402 bits (160), Expect = 7.622e-11
Identity = 82/372 (22.04%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   Y K    +      D   +V    ++ P+  +   V   N    GP    +V    +E    P   I      + ++ + W   L+K  G I GY ++    +   EN  +I         T+T + +LK    Y +++ A NS G       +  T R+ PP
Sbjct:  540 IDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKI---RTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. Ensembl Human
Match: CNTN4 (contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174])

HSP 1 Score: 66.2402 bits (160), Expect = 7.622e-11
Identity = 82/372 (22.04%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   Y K    +      D   +V    ++ P+  +   V   N    GP    +V    +E    P   I      + ++ + W   L+K  G I GY ++    +   EN  +I         T+T + +LK    Y +++ A NS G       +  T R+ PP
Sbjct:  540 IDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKI---RTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. Ensembl Human
Match: CNTN1 (contactin 1 [Source:HGNC Symbol;Acc:HGNC:2171])

HSP 1 Score: 65.855 bits (159), Expect = 9.683e-11
Identity = 90/382 (23.56%), Postives = 148/382 (38.74%), Query Frame = -3
Query:    2 KKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFK-----NLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVES---RNVTLTIQCLDCMDREKMKGKLLSFVIIY----SDEYSKFNLTVPYYNGTDIEVHV-TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENR--IIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 1096
            + F+   NG L+I N     A  Y C A         S +L+VRGPP      + E +  + +   W       + IS   +   K++++ +      + P    + +     +L P+ +Y   +VA N +G  E      R    T  A P V  ++V     RN  LTI     + RE   G    +++ +     +E+ K  +T P    T   VH    + P   +   V A N    GP   V+     ++      T + V    S+E+S+HW+  L+K   +  Y +    +    E  NR  +   EY A   N     L   T Y I + A NS G   P  ++    ++ PP     ++  V+   R  I +
Sbjct:  547 RNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQ-TKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRI--KTDGAAPNVAPSDVGGGGGRNRELTITWAP-LSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNP---DTGRYVHKDETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKI--VESYQIRYWAAHDKEEAANRVQVTSQEYSARLEN-----LLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQPPRIISSVRSGSRYIITW 914          
BLAST of SMED30034706 vs. Ensembl Celegans
Match: let-805 (Myotactin form A [Source:UniProtKB/TrEMBL;Acc:Q9UB29])

HSP 1 Score: 58.9214 bits (141), Expect = 5.658e-9
Identity = 46/196 (23.47%), Postives = 85/196 (43.37%), Query Frame = -3
Query:  404 PFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITK-ECN-------TVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARP-FVRKTNVESRNVTLTIQCLDCMDREKMKGKL--LSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP 958
            P  + N + + +    L+ +W   V  +  I+   +T    LI++  C+       T+++N P F+     L P+  YR  + A +NVG  ERV L+ +T    P   P ++R  ++   +V+++ Q   C+   +  G++    + +   D       T     GT     + NL+P   Y   V A+    +GP
Sbjct: 1298 PGAVANLRVQPIGPDSLQCSWQPPVNPNGRITQYEVTY--QLISRGNCDNNQEAPRTITVNGPHFT--ITGLHPHSKYRVGVAAKSNVGAGERVSLEIQTDQAAPSGAPLYLRTEDIRPTDVSISWQAPPCL---QTNGEITEYEYEVTAGDRRQTVQKTTENIRGT--RAKIENLQPQTRYNVKVRAYTARGAGP 1484          

HSP 2 Score: 50.0618 bits (118), Expect = 3.469e-6
Identity = 51/251 (20.32%), Postives = 102/251 (40.64%), Query Frame = -3
Query:  266 RGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLT-------LCKSL----ITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVA-INNVGVSERVDLQARTLPGTPVARPF-VRKTNVESRNVTLTIQCLDCMDREKMKGKLL--SFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGY 967
            +G P  + + + ++LS + +   W   +     I   +++        C       ++++  TV  N+    Y+   L PY  Y   + A    +G  E  ++     P  P + P  +  T    R+++   + +DC  R    G ++   + I+  D+++K    +   N +D+ V +  L PY  Y   V A+N +  GP  ++ V    K   P P   + V ++ ++   + W      +GP   Y
Sbjct: 1907 QGAPGSVRDLRVKALSPNEVHVQWLAPLVQRGTIVGYDISYRLKHRLACPEEEPRDVSRDFVTV-YNHKDLDYTITGLLPYSLYEVRVRARTTELGPEETKEVSTEQQP--PSSPPLNLESTYALERSLSFQWEPVDCSQRH---GHVVNYEYEILGQDDWAKLERQI--ANTSDLRVTIDGLTPYTKYVMRVKAYNSIGGGPNTENLVVMTAKAQAPLPPQDLVVAQEGTSFFMVSWLPPYPPYGPHDAY 2149          

HSP 3 Score: 48.9062 bits (115), Expect = 8.632e-6
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = -3
Query:   56 VTNLKPYKNYTFFVSAH--NGVKSGPQDSVSCKTKEV-LPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQNSENE--NRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 475
            +++L P + Y   VSAH   G  S   D ++ +T++  +P     ++VT++ SN +S+ W+    D+   + GYVLE    D N+E +  N ++K    +      V+ L++ T Y   L             ++GK D+   P P
Sbjct: 2790 LSDLDPEQEYDIQVSAHTEGGGWSEWSDELTSRTQQQNIPVLERELEVTDKTSNSISLKWEGLPQDQATHVVGYVLEFKSEDDNAEWQEYNGVVKHRKTSSDYKITVKQLETATLYFFRLR------------VVGKNDKRGQPGP 2923          
BLAST of SMED30034706 vs. Ensembl Celegans
Match: let-805 (Myotactin form A [Source:UniProtKB/TrEMBL;Acc:Q9UB29])

HSP 1 Score: 58.9214 bits (141), Expect = 6.319e-9
Identity = 46/196 (23.47%), Postives = 85/196 (43.37%), Query Frame = -3
Query:  404 PFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITK-ECN-------TVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARP-FVRKTNVESRNVTLTIQCLDCMDREKMKGKL--LSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP 958
            P  + N + + +    L+ +W   V  +  I+   +T    LI++  C+       T+++N P F+     L P+  YR  + A +NVG  ERV L+ +T    P   P ++R  ++   +V+++ Q   C+   +  G++    + +   D       T     GT     + NL+P   Y   V A+    +GP
Sbjct: 1298 PGAVANLRVQPIGPDSLQCSWQPPVNPNGRITQYEVTY--QLISRGNCDNNQEAPRTITVNGPHFT--ITGLHPHSKYRVGVAAKSNVGAGERVSLEIQTDQAAPSGAPLYLRTEDIRPTDVSISWQAPPCL---QTNGEITEYEYEVTAGDRRQTVQKTTENIRGT--RAKIENLQPQTRYNVKVRAYTARGAGP 1484          

HSP 2 Score: 50.447 bits (119), Expect = 3.018e-6
Identity = 51/251 (20.32%), Postives = 102/251 (40.64%), Query Frame = -3
Query:  266 RGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLT-------LCKSL----ITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVA-INNVGVSERVDLQARTLPGTPVARPF-VRKTNVESRNVTLTIQCLDCMDREKMKGKLL--SFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGY 967
            +G P  + + + ++LS + +   W   +     I   +++        C       ++++  TV  N+    Y+   L PY  Y   + A    +G  E  ++     P  P + P  +  T    R+++   + +DC  R    G ++   + I+  D+++K    +   N +D+ V +  L PY  Y   V A+N +  GP  ++ V    K   P P   + V ++ ++   + W      +GP   Y
Sbjct: 1907 QGAPGSVRDLRVKALSPNEVHVQWLAPLVQRGTIVGYDISYRLKHRLACPEEEPRDVSRDFVTV-YNHKDLDYTITGLLPYSLYEVRVRARTTELGPEETKEVSTEQQP--PSSPPLNLESTYALERSLSFQWEPVDCSQRH---GHVVNYEYEILGQDDWAKLERQI--ANTSDLRVTIDGLTPYTKYVMRVKAYNSIGGGPNTENLVVMTAKAQAPLPPQDLVVAQEGTSFFMVSWLPPYPPYGPHDAY 2149          

HSP 3 Score: 48.9062 bits (115), Expect = 8.256e-6
Identity = 39/146 (26.71%), Postives = 69/146 (47.26%), Query Frame = -3
Query:   56 VTNLKPYKNYTFFVSAH--NGVKSGPQDSVSCKTKEV-LPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQNSENE--NRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 475
            +++L P + Y   VSAH   G  S   D ++ +T++  +P     ++VT++ SN +S+ W+    D+   + GYVLE    D N+E +  N ++K    +      V+ L++ T Y   L             ++GK D+   P P
Sbjct: 2790 LSDLDPEQEYDIQVSAHTEGGGWSEWSDELTSRTQQQNIPVLERELEVTDKTSNSISLKWEGLPQDQATHVVGYVLEFKSEDDNAEWQEYNGVVKHRKTSSDYKITVKQLETATLYFFRLR------------VVGKNDKRGQPGP 2923          
BLAST of SMED30034706 vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0333589)

HSP 1 Score: 61.6178 bits (148), Expect = 1.151e-9
Identity = 82/349 (23.50%), Postives = 146/349 (41.83%), Query Frame = -3
Query:  113 ISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCK-SLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIY----SDEYSKFNLTVPY-YNGTDIEVH------VTNLKPYKNYTFFVSAHNGVKSG-PQDSVSCKTKEVLP-NPSTYIQVTEQKSNELSIHWDKA-LD-KFGPITGY-VLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 1105
            I D+    G    L I++    D  +YIC+A       ++SI L+V+  P +  N +  S     L+  W      ++ I   ++   + S I +    +++       + + L+P   Y   + A N +G SE  + +Q  TL   P   P   +   E ++ T      D  +R+   G LL + + Y    + E  + N T  + +   ++  H      + NL  +  Y   V A+    SG P   ++ +T E +P +P    Q     S  + I W    +D + G I GY V  +SV D+  E +  ++KS    +T    + +L+  T Y++ + A   VG
Sbjct:  857 IRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVR--AEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISV-DELYETDPEVVKSTNQYVT----IENLRKYTNYTVWVLAYTKVG 1198          
BLAST of SMED30034706 vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0333590)

HSP 1 Score: 61.6178 bits (148), Expect = 1.151e-9
Identity = 82/349 (23.50%), Postives = 146/349 (41.83%), Query Frame = -3
Query:  113 ISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCK-SLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIY----SDEYSKFNLTVPY-YNGTDIEVH------VTNLKPYKNYTFFVSAHNGVKSG-PQDSVSCKTKEVLP-NPSTYIQVTEQKSNELSIHWDKA-LD-KFGPITGY-VLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 1105
            I D+    G    L I++    D  +YIC+A       ++SI L+V+  P +  N +  S     L+  W      ++ I   ++   + S I +    +++       + + L+P   Y   + A N +G SE  + +Q  TL   P   P   +   E ++ T      D  +R+   G LL + + Y    + E  + N T  + +   ++  H      + NL  +  Y   V A+    SG P   ++ +T E +P +P    Q     S  + I W    +D + G I GY V  +SV D+  E +  ++KS    +T    + +L+  T Y++ + A   VG
Sbjct:  857 IRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVR--AEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSFKTVEVRSHFGGETVLANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISV-DELYETDPEVVKSTNQYVT----IENLRKYTNYTVWVLAYTKVG 1198          
BLAST of SMED30034706 vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0340197)

HSP 1 Score: 61.2326 bits (147), Expect = 1.389e-9
Identity = 64/238 (26.89%), Postives = 111/238 (46.64%), Query Frame = -3
Query:   98 SYSFKNLKPYFDYRASIVAINNVGVSER-VDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-CMDREK-MKGKLLSFVIIY--SDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRD-LKSRTTYSISLYAKNSVGISKPI 787
            S+S   L  + +YR  ++A N  G   R   +  +TLPG P A   +R +++       T+Q L+   D  K + G++L +++ Y  ++E  KF+  V     ++  + V NL+    YTF V A   V  GP   ++V+   ++  P     + +T+  S+ + +HW       GPI GY++E    D +     +I ++    +   TV    L   T Y+  + A N  GIS P+
Sbjct: 1691 SHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAPLHLRFSDI-------TMQSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQV-KQKVSNTTLRVQNLEEEVTYTFTVRAQTSVDYGPGISENVTTGPQDGSPVAPRDLILTKTLSS-VEMHWINGPSGRGPILGYLIEAKKRDDS--RWTKIEQTRKGMMQDFTVSYHILMPSTAYTFRVIAYNRYGISFPV 1917          
BLAST of SMED30034706 vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0340196)

HSP 1 Score: 61.2326 bits (147), Expect = 1.417e-9
Identity = 64/238 (26.89%), Postives = 111/238 (46.64%), Query Frame = -3
Query:   98 SYSFKNLKPYFDYRASIVAINNVGVSER-VDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDC-MDREK-MKGKLLSFVIIY--SDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRD-LKSRTTYSISLYAKNSVGISKPI 787
            S+S   L  + +YR  ++A N  G   R   +  +TLPG P A   +R +++       T+Q L+   D  K + G++L +++ Y  ++E  KF+  V     ++  + V NL+    YTF V A   V  GP   ++V+   ++  P     + +T+  S+ + +HW       GPI GY++E    D +     +I ++    +   TV    L   T Y+  + A N  GIS P+
Sbjct: 1743 SHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAPLHLRFSDI-------TMQSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQV-KQKVSNTTLRVQNLEEEVTYTFTVRAQTSVDYGPGISENVTTGPQDGSPVAPRDLILTKTLSS-VEMHWINGPSGRGPILGYLIEAKKRDDS--RWTKIEQTRKGMMQDFTVSYHILMPSTAYTFRVIAYNRYGISFPV 1969          
BLAST of SMED30034706 vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0302259)

HSP 1 Score: 61.2326 bits (147), Expect = 1.506e-9
Identity = 64/238 (26.89%), Postives = 111/238 (46.64%), Query Frame = -3
Query:   98 SYSFKNLKPYFDYRASIVAINNVGVSER-VDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDC-MDREK-MKGKLLSFVIIY--SDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRD-LKSRTTYSISLYAKNSVGISKPI 787
            S+S   L  + +YR  ++A N  G   R   +  +TLPG P A   +R +++       T+Q L+   D  K + G++L +++ Y  ++E  KF+  V     ++  + V NL+    YTF V A   V  GP   ++V+   ++  P     + +T+  S+ + +HW       GPI GY++E    D +     +I ++    +   TV    L   T Y+  + A N  GIS P+
Sbjct: 1747 SHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAPLHLRFSDI-------TMQSLEVTWDPPKFLNGEILGYLVTYETTEENEKFSKQV-KQKVSNTTLRVQNLEEEVTYTFTVRAQTSVDYGPGISENVTTGPQDGSPVAPRDLILTKTLSS-VEMHWINGPSGRGPILGYLIEAKKRDDS--RWTKIEQTRKGMMQDFTVSYHILMPSTAYTFRVIAYNRYGISFPV 1973          
BLAST of SMED30034706 vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 68.5514 bits (166), Expect = 9.483e-12
Identity = 80/322 (24.84%), Postives = 137/322 (42.55%), Query Frame = -3
Query:   62 LVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLN----YPTFSYSFKNLKPYFDYRASIVAINNVGVSERV-DLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYS-----DEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPN-PSTYIQVTEQKSNELSIHWDKAL--DKFGPITGYVLELSVSDQNSENEN-RIIKSEYDALTTNTVVRDLKSRTTYSISLYA---KNSVGISKPIVIMGKTDRENPP 973
            +++G P +  NF+   +SD+ ++  W+       +IS         L  KE     L      PT S+    L+P  +Y  S+ A+++ G+     DL   T    P A P  +     S + T+ +        E   G+L  +++ Y+      E S  ++  P    T  ++ +  L+ +  Y   V+A   V SGP+ + + C+T E +P  P   ++V    S  + + W   L   + G I GY +   V  +N E+    +IK    A     V+  L+  TTYSI++ A   K     SKP +++ K     PP
Sbjct:  505 VLQGVPGQPTNFQVGEVSDTGVELTWEPAFEKEGIIS-------YELHYKEGKDGPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPP--QDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAP----TSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHY-VRVENGESRGLPLIKDVMLADAQEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPP 812          

HSP 2 Score: 53.9138 bits (128), Expect = 3.838e-7
Identity = 100/413 (24.21%), Postives = 165/413 (39.95%), Query Frame = -3
Query:   92 KIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALG-PNILYQVSINLLVR----GPPFRIH------------NFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTV--SLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERV-DLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKF----NLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLP-NPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG---ISKPIVI 1243
            K+    +T  + C A   NP  E I WFK+            ID + S+ +    R+G+L I N + +D   Y C A     + Y    NL VR     P F I             N  C ++   +    W  N    +L     + + ++++  E N+V  S NY                  + VA++++G+ E V  +  ++LP  P   P V +T   S  +T      D  + E +   ++ +     +  SKF    ++T   Y+       +  L P  +Y   VSA N +  GP  + V  +T E  P +P   IQ      N + + WD+  +  G I GY +  ++      +  +I   +   LTT   ++ L +  TY+I + A  SVG    S PI +
Sbjct:  142 KVVERTRTATMLC-AASGNPDPE-ITWFKD---------FLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNS--EDLTPEDEMPVGRNVL--ELNSVRESANY------------------TCVAMSSLGIIETVAQITVKSLP-KPPGTPVVTETTATSITITW-----DSGNPEPVSHYIIQYRAKSPE--SKFETVDSITTTRYS-------IGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTT---IQSLVTSETYTIRVLAFTSVGDGPFSDPIHV 503          
BLAST of SMED30034706 vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 68.5514 bits (166), Expect = 1.025e-11
Identity = 80/322 (24.84%), Postives = 137/322 (42.55%), Query Frame = -3
Query:   62 LVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLN----YPTFSYSFKNLKPYFDYRASIVAINNVGVSERV-DLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYS-----DEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPN-PSTYIQVTEQKSNELSIHWDKAL--DKFGPITGYVLELSVSDQNSENEN-RIIKSEYDALTTNTVVRDLKSRTTYSISLYA---KNSVGISKPIVIMGKTDRENPP 973
            +++G P +  NF+   +SD+ ++  W+       +IS         L  KE     L      PT S+    L+P  +Y  S+ A+++ G+     DL   T    P A P  +     S + T+ +        E   G+L  +++ Y+      E S  ++  P    T  ++ +  L+ +  Y   V+A   V SGP+ + + C+T E +P  P   ++V    S  + + W   L   + G I GY +   V  +N E+    +IK    A     V+  L+  TTYSI++ A   K     SKP +++ K     PP
Sbjct:  400 VLQGVPGQPTNFQVGEVSDTGVELTWEPAFEKEGIIS-------YELHYKEGKDGPLGKKKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIGAFTNDLAQTTSQAKPSAPP--QDIKCSSSSSTVLMVSWRPPPAESQNGELAGYIVRYAVVGAGAEVSTEHVEAP----TSDQILLQRLEKWTMYRVTVAASTSVGSGPESEPLLCRTDEDVPGAPPRRVEVEVLNSTAIKVMWRSLLPGKQHGQIRGYQVHY-VRVENGESRGLPLIKDVMLADAQEMVIGGLQPDTTYSITVAAYTTKGDGARSKPKLVLTKGAVPGPP 707          

HSP 2 Score: 53.9138 bits (128), Expect = 3.743e-7
Identity = 100/413 (24.21%), Postives = 165/413 (39.95%), Query Frame = -3
Query:   92 KIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALG-PNILYQVSINLLVR----GPPFRIH------------NFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTV--SLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERV-DLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKF----NLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLP-NPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG---ISKPIVI 1243
            K+    +T  + C A   NP  E I WFK+            ID + S+ +    R+G+L I N + +D   Y C A     + Y    NL VR     P F I             N  C ++   +    W  N    +L     + + ++++  E N+V  S NY                  + VA++++G+ E V  +  ++LP  P   P V +T   S  +T      D  + E +   ++ +     +  SKF    ++T   Y+       +  L P  +Y   VSA N +  GP  + V  +T E  P +P   IQ      N + + WD+  +  G I GY +  ++      +  +I   +   LTT   ++ L +  TY+I + A  SVG    S PI +
Sbjct:   37 KVVERTRTATMLC-AASGNPDPE-ITWFKD---------FLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNS--EDLTPEDEMPVGRNVL--ELNSVRESANY------------------TCVAMSSLGIIETVAQITVKSLP-KPPGTPVVTETTATSITITW-----DSGNPEPVSHYIIQYRAKSPE--SKFETVDSITTTRYS-------IGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNVQDSVLTT---IQSLVTSETYTIRVLAFTSVGDGPFSDPIHV 398          
BLAST of SMED30034706 vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 59.6918 bits (143), Expect = 6.959e-9
Identity = 99/426 (23.24%), Postives = 166/426 (38.97%), Query Frame = -3
Query:   59 NKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVR-----GPP---FRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE---------RVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYS----KFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLEL---SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG---ISKPIVIMGKTDRENPPE 1228
             + I+L C   +S   V  + W+K+  E+         D  + D   V G + SL I + D +   +Y  +A   N      +++LVR     GPP    R  N   E  +        D    +SN +     T  +  +L+T +C   S N          L    +Y+  + A+N  GV +         ++       PGTP        T+V   ++TL      C  R +  G  ++  +++   ++ S    K +   P    T++   VTNL     Y F V A NG   GP   +S    C+     P+  T ++V +     +++ W K +   G  I GY++E+   S+ + +  N    I++ Y        V +L+S   Y   + A N  G    S+   I+   DR   PE
Sbjct: 16938 GENIKLSCS--ISGRPVPQVTWYKDGKEV---------DKMLVDITTVIG-SSSLFIRDADRNHRGIYTVEAK--NSSGTTKVDVLVRVQDTPGPPEGPLRFTNISAEKATLWWSPPENDGCAAISNYVIEKRETSRISWALVTSKCEACSFNA-------TKLIKGNEYQFRVSAVNKFGVGKPLESDPIIAQMQYTVPDAPGTPDC------THVTGNSITL------CWTRPRHDGGNEIKQYILERREKKSLRWVKVSAKRPI---TELRHRVTNLTEGNEYEFRVMAENGAGIGPASGISRLFKCREPTSAPSAPTLVKVIDSTKTSVTLAWTKPVFDGGLEIIGYIIEMCKASLEEWHRVNNQTCIQTHYR-------VTELESGEEYKFRVCAVNGAGKGEFSETPHIVQAVDRLTSPE 17320          
BLAST of SMED30034706 vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 59.3066 bits (142), Expect = 9.113e-9
Identity = 99/426 (23.24%), Postives = 166/426 (38.97%), Query Frame = -3
Query:   59 NKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVR-----GPP---FRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE---------RVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYS----KFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLEL---SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG---ISKPIVIMGKTDRENPPE 1228
             + I+L C   +S   V  + W+K+  E+         D  + D   V G + SL I + D +   +Y  +A   N      +++LVR     GPP    R  N   E  +        D    +SN +     T  +  +L+T +C   S N          L    +Y+  + A+N  GV +         ++       PGTP        T+V   ++TL      C  R +  G  ++  +++   ++ S    K +   P    T++   VTNL     Y F V A NG   GP   +S    C+     P+  T ++V +     +++ W K +   G  I GY++E+   S+ + +  N    I++ Y        V +L+S   Y   + A N  G    S+   I+   DR   PE
Sbjct: 22554 GENIKLSCS--ISGRPVPQVTWYKDGKEV---------DKMLVDITTVIG-SSSLFIRDADRNHRGIYTVEA--KNSSGTTKVDVLVRVQDTPGPPEGPLRFTNISAEKATLWWSPPENDGCAAISNYVIEKRETSRISWALVTSKCEACSFNA-------TKLIKGNEYQFRVSAVNKFGVGKPLESDPIIAQMQYTVPDAPGTPDC------THVTGNSITL------CWTRPRHDGGNEIKQYILERREKKSLRWVKVSAKRPI---TELRHRVTNLTEGNEYEFRVMAENGAGIGPASGISRLFKCREPTSAPSAPTLVKVIDSTKTSVTLAWTKPVFDGGLEIIGYIIEMCKASLEEWHRVNNQTCIQTHYR-------VTELESGEEYKFRVCAVNGAGKGEFSETPHIVQAVDRLTSPE 22936          
BLAST of SMED30034706 vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 58.9214 bits (141), Expect = 1.012e-8
Identity = 48/172 (27.91%), Postives = 78/172 (45.35%), Query Frame = -3
Query:   11 YNGTDIEVHVTNLKPYKNYTFFVSAHN----GVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQNSENENRIIKSEYDA--LTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGK-TDRENPPEPSITLVERVKQYIRVR 502
            Y GT  ++ VT+L P   Y F V A N    G  S P  + + +     P P + ++VT+     +++ W K   D   P+ GYV+E+ V     + +    +    A  + T   V  L  +  Y   + A+N VG+S+P  + G  T +E    P I L   +K+ + VR
Sbjct: 14384 YAGT--QMTVTSLLPNHEYQFRVKAENEIGVGDASKPSRTFTARDPVEPPGPVSNLKVTDSSKTSITLAWTKPTYDGGAPLIGYVVEIRVKGTGKKGDEGWKRCNVAAQLIGTEFTVSSLDEKLEYEFRVSAQNQVGMSQPTNLEGAVTPKEVLEAPEIDLDAELKKGLTVR 14553          

HSP 2 Score: 56.6102 bits (135), Expect = 4.959e-8
Identity = 62/236 (26.27%), Postives = 105/236 (44.49%), Query Frame = -3
Query:   86 DYRASIVAINNVGVSERVDLQA------RTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLP----NPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQNSENENRIIKSEY-DALTTNTVVRDLKSRTTYSISLYAKNSVG-ISKPIVIMG 754
            +Y+  I A N  G+S+ +D Q+       T+PG P + P+V   + ES  V      +D  +       +  + +   +  S    T+     +  ++ VTN+ P   Y F V+A N    G     S  ++EVL     +P   ++++E   N +S+ W K   D    ITGY++E     +      R  K+ + + + TN  V  L    +Y   ++AKN VG +S P +I G
Sbjct: 22599 EYQFRIKAENRFGISDHLDCQSVTVKLPYTVPGPP-STPWVGFVSRESLTVCWNDPVVDGGN------PVFGYHVQMKERSSILWQTLNKTAISATQIRVTNICPGMIYEFKVAAENAAGIG---KFSKTSEEVLAIDACDPPANVRISEVTKNSVSLVWQKPPFDGGSKITGYMVE-----RRDAPNGRWTKANFTNVIDTNFTVSGLTQDQSYEFRIFAKNVVGSVSNPSLIAG 22819          

HSP 3 Score: 51.2174 bits (121), Expect = 2.722e-6
Identity = 75/292 (25.68%), Postives = 118/292 (40.41%), Query Frame = -3
Query:    5 TKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVA---RPFVRKTN--VESRNVTLTIQC-LDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP----QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGI---SKPIVIMGKTDRENPPEP--SITLVERVKQYIRVRIK 829
            T+E   V+ + PT  +S K L    +Y   + AIN  G SE  D      P  PV    R +V      +E  N+T  I C L   + +   G  ++  ++   +  +           D +  VT L     Y F V+A N V        +DSV  K     P P   + V E     + + W+      G PIT YV+E     +  +   R +KS +     +   V D+   T     + A+N  G+   S+P VIM   D  +PP P   + +V+  +++I +  K
Sbjct: 9971 TEEWVRVAEDVPTTEHSLKGLMEKQEYSFRVKAINVAGESEPSD------PSDPVVCKERLYVPNPPRWLEVVNIT-KINCDLKWTEPDSDGGSPITNYVVEKRDVRRRTWQAVDTTVKDTKYTVTPLSEGSLYVFRVAAENAVGISEFCELEDSVLAKDTFTTPGPPYALTVVEVSKRHVDLKWEPPNSDGGRPITKYVIE-----KKEKVGTRWVKSGKTSGPESKYRVTDVDEGTEVQFQVRAENEAGVGHPSEPTVIMTIEDAISPPSPPLEVKIVDASREHINITWK 10250          
BLAST of SMED30034706 vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 65.855 bits (159), Expect = 9.271e-11
Identity = 71/295 (24.07%), Postives = 123/295 (41.69%), Query Frame = -3
Query:   95 GPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV-SERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAH----NGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIV 964
            G P +  NFK E  S++ +  +W      S+ ISS +L   K     E   ++++ P  SY  + LKP   Y   + A   VG+ +   ++ ART+   P A P   + N +S    L       +  EK  GK++ + I Y+ E                 + ++ L+P   Y+  V+A+    +G +S P+      T   +P     + ++  + N   I W   ++ FGP+ GY L+    D ++     +   E+     +    D+     Y   L A+N VG  + IV
Sbjct:  500 GVPSQPLNFKAEPESETSILLSW--TPPRSDTISSYDL-YYKEGDHAEEQVITID-PATSYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPPPV--EKQNGKIMGYSIKYTGE-----------------MIISGLQPETAYSITVTAYTTKGDGARSKPK---IVSTSAAVPGKPRLV-ISHTQMNTALIQWYPPVETFGPVIGYRLKFGRKDLDT-----LTTLEFSEKEEHFTATDIHKGALYIFKLSARNKVGYGEEIV 762          

HSP 2 Score: 50.8322 bits (120), Expect = 4.766e-6
Identity = 56/250 (22.40%), Postives = 105/250 (42.00%), Query Frame = -3
Query:   56 TFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEV-HVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIV-IMGKTDRENPPEP 793
            T  YS   L PY +Y   +VA+NN+G     + +  RT    P + P     NV++R ++ T   +   + E+  G++  + + Y+ + ++   +   +N  D ++  + NL+P K Y+  V A   V  GP  + +   T+  +P+     +   +    + + W     +   I+ Y L     D   E    I  +      T+  ++ LK  + Y   L A+  VG+      I  +T +  P  P
Sbjct:  361 TTRYSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPP----RNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSWTPP--RSDTISSYDLYYKEGDHAEEQVITIDPA------TSYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAP 598          
BLAST of SMED30034706 vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 64.3142 bits (155), Expect = 2.393e-10
Identity = 42/144 (29.17%), Postives = 70/144 (48.61%), Query Frame = -3
Query:   71 NGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRE 499
            +G      +T LKPY NY+  V+  NG   G   +S   +T E +P+P +++++  Q    L++ W       G +TGY +   ++   SE  N       D    N  + ++ S+ TY   LYA  SVG S+ +++ G T +E
Sbjct:  855 HGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEIYHQIAKYFSETIN-------DPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQE 991          
BLAST of SMED30034706 vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 64.3142 bits (155), Expect = 2.679e-10
Identity = 42/144 (29.17%), Postives = 70/144 (48.61%), Query Frame = -3
Query:   71 NGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRE 499
            +G      +T LKPY NY+  V+  NG   G   +S   +T E +P+P +++++  Q    L++ W       G +TGY +   ++   SE  N       D    N  + ++ S+ TY   LYA  SVG S+ +++ G T +E
Sbjct:  853 HGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEIYHQIAKYFSETIN-------DPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQE 989          
BLAST of SMED30034706 vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 64.3142 bits (155), Expect = 2.919e-10
Identity = 39/144 (27.08%), Postives = 70/144 (48.61%), Query Frame = -3
Query:   71 NGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRE 499
            +G      +T LKPY NY+  V+  NG   G   +S   +T E +P+P +++++  Q    L++ W       G +TGY +   + ++         ++  D    N  + ++ S+ TY   LYA  SVG S+ +++ G T +E
Sbjct:  862 HGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEIYHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQE 1005          
BLAST of SMED30034706 vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 63.929 bits (154), Expect = 3.137e-10
Identity = 39/144 (27.08%), Postives = 70/144 (48.61%), Query Frame = -3
Query:   71 NGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRE 499
            +G      +T LKPY NY+  V+  NG   G   +S   +T E +P+P +++++  Q    L++ W       G +TGY +   + ++         ++  D    N  + ++ S+ TY   LYA  SVG S+ +++ G T +E
Sbjct:  874 HGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEIYHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQE 1017          
BLAST of SMED30034706 vs. Ensembl Mouse
Match: Cntn4 (contactin 4 [Source:MGI Symbol;Acc:MGI:1095737])

HSP 1 Score: 68.5514 bits (166), Expect = 8.914e-12
Identity = 83/372 (22.31%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C          V+ +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  NTV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   + K    +      D   +V    +++P+  +   V   N    GP    +     +E    P   I      + ++ + W   + K  G I GY ++    D   EN  +I         T+T + +LK    Y +S+ A NS G       +  T R+ PP
Sbjct:  540 IDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVNTVPDLVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKYWRHDDKEENAKKI---RTVGNQTSTKITNLKGSALYHLSVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. Ensembl Mouse
Match: Cntn4 (contactin 4 [Source:MGI Symbol;Acc:MGI:1095737])

HSP 1 Score: 68.5514 bits (166), Expect = 8.914e-12
Identity = 83/372 (22.31%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C          V+ +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  NTV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   + K    +      D   +V    +++P+  +   V   N    GP    +     +E    P   I      + ++ + W   + K  G I GY ++    D   EN  +I         T+T + +LK    Y +S+ A NS G       +  T R+ PP
Sbjct:  540 IDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVNTVPDLVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKYWRHDDKEENAKKI---RTVGNQTSTKITNLKGSALYHLSVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 58.5362 bits (140), Expect = 1.439e-8
Identity = 101/398 (25.38%), Postives = 150/398 (37.69%), Query Frame = -3
Query:  101 TIRLDCPALMSNPSVETIIWFKNIDEI-IIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGP--NILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWD-----FNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV---SERVDLQART---LPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDI---EVHVTNLKPYKNYTFFVSAHNGVKSG----PQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLEL--SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKP 1222
            TIRL+   +   P  E + W K+ D   +  SP   ID      KF         +T    SD   Y+  A  P  + +   ++N+L +  P R  N K   +S       WD         + N I    L  C+S      +T S N  T S +   L    +Y   + A N +G    +E   + A+T    PG P   P V K + E   V       D        GK  S    Y ++  K  +     N + I    + V NL P   Y F V A N V  G    P   V  K     P P T  +V +   + +++ W K + D   PI GYV+E+   ++D + +   +   +    +     V  L     Y   + A+N VGI +P
Sbjct: 11680 TIRLEA-GVRGKPFPE-VAWTKDKDATDLTRSPRVKIDTSAESSKFS--------LTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVR--NLKITDVSSDRCTIRWDPPEDDGGCEIQNYI----LEKCESKRMV-WSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDP-PEVTKVSKEEMTVVWNAPEYDG-------GK--SITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRP 12050          

HSP 2 Score: 56.225 bits (134), Expect = 8.597e-8
Identity = 63/257 (24.51%), Postives = 105/257 (40.86%), Query Frame = -3
Query:   11 IVAINNVGVSERVDLQAR------TLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEV----LPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPE-PSITLVERVKQYIRVR 739
            I+A+N  GV E ++           LPG P +   +  TN+   ++T+      C +R    G  +++ +++   D      +       TD+ + VT L     Y F VSA N    G     +   K       P P T   V +   N +++ W K + D    I GYV+E+  +D   E E +I+  +     T   +  L     Y I + A N VG+ +   + G    E+  E P + L   +++ I VR
Sbjct: 17255 IMAVNKYGVGEPLESAPVLMKNPFVLPGPPKS---LEVTNIAKDSMTV------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKAD---EEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVR 17499          

HSP 3 Score: 54.6842 bits (130), Expect = 2.504e-7
Identity = 95/414 (22.95%), Postives = 165/414 (39.86%), Query Frame = -3
Query:   11 IIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKA--LGPNILYQVSINLLVR-GPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECN--TVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQA------RTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN--GVKSGPQDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNT----------VVRDLKSRTTYSISLYAKNSVGISKPIVIMGK-TDRENPPEPSITLVERVKQYIRVR 1171
            IIW K+ +E+   +    I   +        +  +LI+ +   +D   Y  K   +G      +++ +L R GPP      K   ++       W  N  L +  +S++  + +   T   +   VS      +Y    L P  +Y   ++A+N  G+ E ++ +          PG P + P       +S  +T T    D     +++G +L         ++K N        TD+   VT L    +Y F V+A N  GV    + SV  +  + L  P P +  +VT+   + +S+ W+K + D   P+ GYV+EL              K+  D  TT T           V  LK  T Y+  + A N+ G+ +P  I G    +E    P I L   +++ + +R
Sbjct: 18201 IIWSKDGNELEETAARMEIKSTL--------QKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPE--GPLKVTGVTAEKCYLAW--NPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPP-STPEASAITKDSMVLTWTRPVDDGG--AEIEGYILEKRDKEGIRWTKCNKKTL----TDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELK-------------KAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLR 18582          

HSP 4 Score: 51.6026 bits (122), Expect = 1.994e-6
Identity = 60/234 (25.64%), Postives = 97/234 (41.45%), Query Frame = -3
Query:   92 DYRASIVAINNVGVSERVDLQ------ARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 754
            +Y   + A+N  G+ E ++ +      A   PG P + P V K    S  V          DR  + G  ++  + +   D+ S   L V      D    VT L    +Y + V A N    GP  + S   K  + +  P P   I++ +   + +++ W K + D    +TGYV+E+    Q  E E  I+ +  +  TT  VV +LK    Y   + A N  G  +PI +
Sbjct: 20497 EYVFRVRAVNKYGIGEPLESEPVVAKNAFVTPGPP-SIPEVTKITKNSMTV--------VWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMK---QGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITM 20718          

HSP 5 Score: 51.6026 bits (122), Expect = 2.369e-6
Identity = 44/140 (31.43%), Postives = 61/140 (43.57%), Query Frame = -3
Query:   92 TDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDKA-LDKFGPITGYVLELSVSDQNSENENRIIKSEYDALT-TNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 493
            +D+   VT L+    Y F VSA N    GP    S     K     P P +   VT+      S+ W K   D    ITGYV+E     Q   ++  I  +   AL  T  VV DL+++  Y+  + A N  G+ +P VI
Sbjct: 14089 SDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVE----HQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 14224          

HSP 6 Score: 50.8322 bits (120), Expect = 3.833e-6
Identity = 99/432 (22.92%), Postives = 168/432 (38.89%), Query Frame = -3
Query:    2 ALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHN-FKCESLSDSVLKFNW-----DFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV-----SERVDLQAR-TLPGTP-VARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLEL---SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMG---KTDRENPPEPSI------TLVERVKQYIRVRIKY 1201
            AL+    V  + WFK+  EI      R ++++I+D   V G   SL + +       VY  +A   +   +  + + V+  P ++    +  +++   +   W     D    +++ I     T  L  +LI   C          SY+   L    +Y+  I A+N  GV     S+ V  Q + T+P  P V  P    +NV   ++TLT    +     +++  +L      S  + K     P    ++    VT L     Y F V A N    GP   +S    C+     P+  + ++VT+     +S+ W +   D    I GY++E+    + D +  N    +K+ Y        V DL++   Y   + A N  G      + G     DR + PE  I      T + R    IR+ I Y
Sbjct: 21442 ALVQGRPVPRVTWFKDGVEI-----ERRMNMEITD---VLGST-SLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEA-------LSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYTIPDAPGVPEP----SNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPI---SETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRY-------TVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAY 21843          

HSP 7 Score: 49.6766 bits (117), Expect = 8.096e-6
Identity = 74/315 (23.49%), Postives = 131/315 (41.59%), Query Frame = -3
Query:   86 INLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVT--LSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNL-KPYFDYRASIVAINNVGVSERVD----LQART---LPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEV----LPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLELSVSDQNSENENRIIKSEYDALTTNTV-VRDLKSRTTYSISLYAKNSVGISKPIVIMG 982
            INL V   P  + N +     D  +   W+  +T   S +I  V     + +  K    V+    +  ++   L K   +Y   + A N VG  E V+    ++AR+   +PG P+    V  T+V    V+LT +  +         ++ ++VI   D+ S    T       D+   VT++   + Y+F V A N +  G   + +   K       P+P   +  +EQ  + + + W+  L   G PI GY++E     +  E ++  I+     +   T  V  L+    Y   + A+N+ G+S P  I+G
Sbjct: 6544 INLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYV--VERRDIKRKTWVLVTDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLN---VTITDVNRFGVSLTWEPPEY----DGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIE-----RREEGKDNWIRCNMKPVPELTYKVTGLQKGNKYLYRVSAENAAGVSDPSEILG 6844          
BLAST of SMED30034706 vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 58.151 bits (139), Expect = 1.774e-8
Identity = 101/398 (25.38%), Postives = 150/398 (37.69%), Query Frame = -3
Query:  101 TIRLDCPALMSNPSVETIIWFKNIDEI-IIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGP--NILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWD-----FNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV---SERVDLQART---LPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDI---EVHVTNLKPYKNYTFFVSAHNGVKSG----PQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLEL--SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKP 1222
            TIRL+   +   P  E + W K+ D   +  SP   ID      KF         +T    SD   Y+  A  P  + +   ++N+L +  P R  N K   +S       WD         + N I    L  C+S      +T S N  T S +   L    +Y   + A N +G    +E   + A+T    PG P   P V K + E   V       D        GK  S    Y ++  K  +     N + I    + V NL P   Y F V A N V  G    P   V  K     P P T  +V +   + +++ W K + D   PI GYV+E+   ++D + +   +   +    +     V  L     Y   + A+N VGI +P
Sbjct: 20132 TIRLEA-GVRGKPFPE-VAWTKDKDATDLTRSPRVKIDTSAESSKFS--------LTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVR--NLKITDVSSDRCTIRWDPPEDDGGCEIQNYI----LEKCESKRMV-WSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDP-PEVTKVSKEEMTVVWNAPEYDG-------GK--SITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRP 20502          

HSP 2 Score: 55.8398 bits (133), Expect = 9.718e-8
Identity = 63/257 (24.51%), Postives = 105/257 (40.86%), Query Frame = -3
Query:   11 IVAINNVGVSERVDLQAR------TLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEV----LPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPE-PSITLVERVKQYIRVR 739
            I+A+N  GV E ++           LPG P +   +  TN+   ++T+      C +R    G  +++ +++   D      +       TD+ + VT L     Y F VSA N    G     +   K       P P T   V +   N +++ W K + D    I GYV+E+  +D   E E +I+  +     T   +  L     Y I + A N VG+ +   + G    E+  E P + L   +++ I VR
Sbjct: 25707 IMAVNKYGVGEPLESAPVLMKNPFVLPGPPKS---LEVTNIAKDSMTV------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKAD---EEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVR 25951          

HSP 3 Score: 54.299 bits (129), Expect = 3.221e-7
Identity = 95/414 (22.95%), Postives = 165/414 (39.86%), Query Frame = -3
Query:   11 IIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKA--LGPNILYQVSINLLVR-GPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECN--TVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQA------RTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN--GVKSGPQDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNT----------VVRDLKSRTTYSISLYAKNSVGISKPIVIMGK-TDRENPPEPSITLVERVKQYIRVR 1171
            IIW K+ +E+   +    I   +        +  +LI+ +   +D   Y  K   +G      +++ +L R GPP      K   ++       W  N  L +  +S++  + +   T   +   VS      +Y    L P  +Y   ++A+N  G+ E ++ +          PG P + P       +S  +T T    D     +++G +L         ++K N        TD+   VT L    +Y F V+A N  GV    + SV  +  + L  P P +  +VT+   + +S+ W+K + D   P+ GYV+EL              K+  D  TT T           V  LK  T Y+  + A N+ G+ +P  I G    +E    P I L   +++ + +R
Sbjct: 26653 IIWSKDGNELEETAARMEIKSTL--------QKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPE--GPLKVTGVTAEKCYLAW--NPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPP-STPEASAITKDSMVLTWTRPVDD--GGAEIEGYILEKRDKEGIRWTKCN----KKTLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELK-------------KAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLR 27034          

HSP 4 Score: 51.6026 bits (122), Expect = 2.158e-6
Identity = 60/234 (25.64%), Postives = 97/234 (41.45%), Query Frame = -3
Query:   92 DYRASIVAINNVGVSERVDLQ------ARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 754
            +Y   + A+N  G+ E ++ +      A   PG P + P V K    S  V          DR  + G  ++  + +   D+ S   L V      D    VT L    +Y + V A N    GP  + S   K  + +  P P   I++ +   + +++ W K + D    +TGYV+E+    Q  E E  I+ +  +  TT  VV +LK    Y   + A N  G  +PI +
Sbjct: 28949 EYVFRVRAVNKYGIGEPLESEPVVAKNAFVTPGPP-SIPEVTKITKNSMTV--------VWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMK---QGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITM 29170          

HSP 5 Score: 51.2174 bits (121), Expect = 2.866e-6
Identity = 44/140 (31.43%), Postives = 61/140 (43.57%), Query Frame = -3
Query:   92 TDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLELSVSDQNSENENRIIKSEYDALT-TNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 493
            +D+   VT L+    Y F VSA N    GP    S     K     P P +   VT+      S+ W K     G  ITGYV+E     Q   ++  I  +   AL  T  VV DL+++  Y+  + A N  G+ +P VI
Sbjct: 22541 SDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVE----HQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 22676          

HSP 6 Score: 50.0618 bits (118), Expect = 6.267e-6
Identity = 99/432 (22.92%), Postives = 168/432 (38.89%), Query Frame = -3
Query:    2 ALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHN-FKCESLSDSVLKFNW-----DFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV-----SERVDLQAR-TLPGTP-VARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLEL---SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMG---KTDRENPPEPSI------TLVERVKQYIRVRIKY 1201
            AL+    V  + WFK+  EI      R ++++I+D   V G   SL + +       VY  +A   +   +  + + V+  P ++    +  +++   +   W     D    +++ I     T  L  +LI   C          SY+   L    +Y+  I A+N  GV     S+ V  Q + T+P  P V  P    +NV   ++TLT    +     +++  +L      S  + K     P    ++    VT L     Y F V A N    GP   +S    C+     P+  + ++VT+     +S+ W +   D    I GY++E+    + D +  N    +K+ Y        V DL++   Y   + A N  G      + G     DR + PE  I      T + R    IR+ I Y
Sbjct: 29894 ALVQGRPVPRVTWFKDGVEI-----ERRMNMEITD---VLGST-SLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEA-------LSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYTIPDAPGVPEP----SNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPI---SETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRY-------TVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAY 30295          
BLAST of SMED30034706 vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 58.151 bits (139), Expect = 1.884e-8
Identity = 101/398 (25.38%), Postives = 150/398 (37.69%), Query Frame = -3
Query:  101 TIRLDCPALMSNPSVETIIWFKNIDEI-IIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGP--NILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWD-----FNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV---SERVDLQART---LPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDI---EVHVTNLKPYKNYTFFVSAHNGVKSG----PQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLEL--SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKP 1222
            TIRL+   +   P  E + W K+ D   +  SP   ID      KF         +T    SD   Y+  A  P  + +   ++N+L +  P R  N K   +S       WD         + N I    L  C+S      +T S N  T S +   L    +Y   + A N +G    +E   + A+T    PG P   P V K + E   V       D        GK  S    Y ++  K  +     N + I    + V NL P   Y F V A N V  G    P   V  K     P P T  +V +   + +++ W K + D   PI GYV+E+   ++D + +   +   +    +     V  L     Y   + A+N VGI +P
Sbjct: 18261 TIRLEA-GVRGKPFPE-VAWTKDKDATDLTRSPRVKIDTSAESSKFS--------LTKAKRSDGGKYVITATNPAGSFVAYATVNVLDKPGPVR--NLKITDVSSDRCTIRWDPPEDDGGCEIQNYI----LEKCESK-RMVWSTYSANVLTPSATVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDP-PEVTKVSKEEMTVVWNAPEYDG-------GK--SITGYYLEKKEKHAVRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGEPSLPSRPVVAKDPIEPPGPPTNFKVVDTTKSSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLIRMEFTVTSLDENQEYEFRVCAQNQVGIGRP 18631          

HSP 2 Score: 56.225 bits (134), Expect = 8.536e-8
Identity = 63/257 (24.51%), Postives = 105/257 (40.86%), Query Frame = -3
Query:   11 IVAINNVGVSERVDLQAR------TLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEV----LPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPE-PSITLVERVKQYIRVR 739
            I+A+N  GV E ++           LPG P +   +  TN+   ++T+      C +R    G  +++ +++   D      +       TD+ + VT L     Y F VSA N    G     +   K       P P T   V +   N +++ W K + D    I GYV+E+  +D   E E +I+  +     T   +  L     Y I + A N VG+ +   + G    E+  E P + L   +++ I VR
Sbjct: 23836 IMAVNKYGVGEPLESAPVLMKNPFVLPGPPKS---LEVTNIAKDSMTV------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHVVDTTKNSITLAWSKPIYDGGSEILGYVVEICKAD---EEEWQIVTPQTGLRVTRFEIAKLIEHQEYKIRVCALNKVGLGEAASVPGTVKPEDKLEAPELDLDSELRKGIVVR 24080          

HSP 3 Score: 54.299 bits (129), Expect = 2.980e-7
Identity = 95/414 (22.95%), Postives = 165/414 (39.86%), Query Frame = -3
Query:   11 IIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKA--LGPNILYQVSINLLVR-GPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECN--TVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQA------RTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN--GVKSGPQDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNT----------VVRDLKSRTTYSISLYAKNSVGISKPIVIMGK-TDRENPPEPSITLVERVKQYIRVR 1171
            IIW K+ +E+   +    I   +        +  +LI+ +   +D   Y  K   +G      +++ +L R GPP      K   ++       W  N  L +  +S++  + +   T   +   VS      +Y    L P  +Y   ++A+N  G+ E ++ +          PG P + P       +S  +T T    D     +++G +L         ++K N        TD+   VT L    +Y F V+A N  GV    + SV  +  + L  P P +  +VT+   + +S+ W+K + D   P+ GYV+EL              K+  D  TT T           V  LK  T Y+  + A N+ G+ +P  I G    +E    P I L   +++ + +R
Sbjct: 24782 IIWSKDGNELEETAARMEIKSTL--------QKTTLIVKDCIRTDGGQYTLKLSNVGGTKTIPITVKVLDRPGPPE--GPLKVTGVTAEKCYLAW--NPPLQDGGASISHYIIEKRETSRLSWTQVSNEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEALESEPVIACNPYKRPGPP-STPEASAITKDSMVLTWTRPVDD--GGAEIEGYILEKRDKEGIRWTKCNKK----TLTDLRFRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWNKPIYDGGAPVRGYVIELK-------------KAAADEWTTCTPPSGLQGKQFTVTKLKENTEYNFRICAFNTEGVGEPATIPGSVVAQERMEAPEIELDADLRKVVTLR 25163          

HSP 4 Score: 51.6026 bits (122), Expect = 1.980e-6
Identity = 60/234 (25.64%), Postives = 97/234 (41.45%), Query Frame = -3
Query:   92 DYRASIVAINNVGVSERVDLQ------ARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 754
            +Y   + A+N  G+ E ++ +      A   PG P + P V K    S  V          DR  + G  ++  + +   D+ S   L V      D    VT L    +Y + V A N    GP  + S   K  + +  P P   I++ +   + +++ W K + D    +TGYV+E+    Q  E E  I+ +  +  TT  VV +LK    Y   + A N  G  +PI +
Sbjct: 27078 EYVFRVRAVNKYGIGEPLESEPVVAKNAFVTPGPP-SIPEVTKITKNSMTV--------VWDRPTVDGGSEINGYFLERRDKKSLAWLKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGVGPFSEPSDFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSDVTGYVVEMK---QGDEEEWTIVSTRGEVRTTEYVVSNLKPGVNYYFQVSAVNCAGQGEPITM 27299          

HSP 5 Score: 51.2174 bits (121), Expect = 2.541e-6
Identity = 44/140 (31.43%), Postives = 61/140 (43.57%), Query Frame = -3
Query:   92 TDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLELSVSDQNSENENRIIKSEYDALT-TNTVVRDLKSRTTYSISLYAKNSVGISKPIVI 493
            +D+   VT L+    Y F VSA N    GP    S     K     P P +   VT+      S+ W K     G  ITGYV+E     Q   ++  I  +   AL  T  VV DL+++  Y+  + A N  G+ +P VI
Sbjct: 20670 SDLRCKVTGLQEGNTYEFRVSAENRAGIGPPSDASNPVLMKDVAYPPGPPSNAHVTDTTKKSASLAWGKPHYDGGLEITGYVVE----HQKVGDDAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVI 20805          

HSP 6 Score: 50.447 bits (119), Expect = 5.367e-6
Identity = 99/432 (22.92%), Postives = 168/432 (38.89%), Query Frame = -3
Query:    2 ALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHN-FKCESLSDSVLKFNW-----DFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGV-----SERVDLQAR-TLPGTP-VARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVS----CKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLEL---SVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMG---KTDRENPPEPSI------TLVERVKQYIRVRIKY 1201
            AL+    V  + WFK+  EI      R ++++I+D   V G   SL + +       VY  +A   +   +  + + V+  P ++    +  +++   +   W     D    +++ I     T  L  +LI   C          SY+   L    +Y+  I A+N  GV     S+ V  Q + T+P  P V  P    +NV   ++TLT    +     +++  +L      S  + K     P    ++    VT L     Y F V A N    GP   +S    C+     P+  + ++VT+     +S+ W +   D    I GY++E+    + D +  N    +K+ Y        V DL++   Y   + A N  G      + G     DR + PE  I      T + R    IR+ I Y
Sbjct: 28023 ALVQGRPVPRVTWFKDGVEI-----ERRMNMEITD---VLGST-SLFVRDATRDHRGVYTVEAKNVSGSTKAEVTVKVQDTPGKVVGPIRFTNITGEKMTLWWEAPLNDGCAPVTHYIIEKRETSRLAWALIEDNCEA-------LSYTAIKLITGNEYQFRISAVNKFGVGRPLESDPVVAQIQYTIPDAPGVPEP----SNVTGNSITLTWTRPESDGGSEIQHYILERREKKSTRWVKVISKRPI---SETRFKVTGLVEGNEYEFHVMAENAAGIGPASGISRLIKCREPVNPPSAPSVVKVTDTSKTTVSLEWARPVFDGGMEIIGYIIEMCKADLGDWHKVNTEPCVKTRY-------TVTDLQAGEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGVSIRLFIAY 28424          
BLAST of SMED30034706 vs. UniProt/SwissProt
Match: sp|Q69Z26|CNTN4_MOUSE (Contactin-4 OS=Mus musculus OX=10090 GN=Cntn4 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 6.235e-11
Identity = 83/372 (22.31%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C          V+ +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  NTV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   + K    +      D   +V    +++P+  +   V   N    GP    +     +E    P   I      + ++ + W   + K  G I GY ++    D   EN  +I         T+T + +LK    Y +S+ A NS G       +  T R+ PP
Sbjct:  540 IDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVNTVPDLVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKYWRHDDKEENAKKI---RTVGNQTSTKITNLKGSALYHLSVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. UniProt/SwissProt
Match: sp|Q8IWV2|CNTN4_HUMAN (Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.660e-10
Identity = 82/372 (22.04%), Postives = 145/372 (38.98%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGP--QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   Y K    +      D   +V    ++ P+  +   V   N    GP    +V    +E    P   I      + ++ + W   L+K  G I GY ++    +   EN  +I         T+T + +LK    Y +++ A NS G       +  T R+ PP
Sbjct:  540 IDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDRLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKI---RTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPP 901          
BLAST of SMED30034706 vs. UniProt/SwissProt
Match: sp|Q98902|L1CAM_TAKRU (Neural cell adhesion molecule L1 OS=Takifugu rubripes OX=31033 GN=l1cam PE=3 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 4.423e-10
Identity = 52/194 (26.80%), Postives = 86/194 (44.33%), Query Frame = -3
Query:   44 CMDREKMKGKLLSFVIIYSDEYSK-------FNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELS--VSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITL 595
             +D+E ++G LL + I  +  + +        N+ +      + +  +TNL+PY +Y   +SA N    GP  +  S  T E +P P   +Q+T    +E+++HW       G + GY L+     SD N      I   E   LT    ++ L   + Y   L A+ + G    I I+G T  E  P  +I+L
Sbjct:  849 AVDKETVRGHLLGYKIYLTWGHHRNSRAQEPENIVMVQTGANEEKKSITNLRPYCHYDLAISAFNSKGEGPLSEKTSFMTPEGVPGPPMSMQMTSPSESEITLHWTPPSKPNGILLGYSLQYRKMQSDDNPLQVVDIASPEITHLT----LKGLDRHSHYQFLLMARTAAGKGLSIEILGATTLEGLPPANISL 1038          

HSP 2 Score: 52.7582 bits (125), Expect = 5.413e-6
Identity = 96/425 (22.59%), Postives = 172/425 (40.47%), Query Frame = -3
Query:  113 IYGNNTDVNITILNETVHKIAILNKTIRLDCP-ALMSNPSVETIIWFKNIDEIIIASPL---RTIDVDI----SDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNV---TLTIQCLDCMDREKMKGKLLSFVIIYS-------DEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQ-DSVSCKTKEVLP-NPSTYIQVTEQKSNELSIHWDKALDK---FGPITGYVLELSVS---DQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 1297
            + G+N  VN         ++ +LN+T+ L  P AL   P    I     + +  ++SPL   R  D  I    SDKK+     G LII+N++  D  VY C+ +    + + S  L +   P    + +  +    V+  NW    D N  +   +        K    +E   V+ +    +     L PY  YR  ++AIN+ G S+   L    L  TP   P     +V S +    TL I   + MD+    G    +++++        D + ++ +  P+         VT+++ +  +   V A N    GP+ D +   + E +P      + V  + S  + + W  A+DK    G + GY + L+     +  ++    I+  +  A      + +L+    Y +++ A NS G
Sbjct:  516 VQGSNISVNA--------EVEVLNRTVILSPPQALRLQPGKTAIFTCLYVTDPKLSSPLLQWRKNDQKIFESHSDKKYTFDGPG-LIISNVEPGDEGVYTCQIITKLDMVEASSTLTLCDRPDPPVHLQVTNAKHRVVTLNWTPGDDNNSPILEYVVEFEDQDMKENGWEELKRVAADKKHVNLP---LWPYMSYRFRVIAINDQGKSDPSKLS--DLYKTPADAPDSNPEDVRSESTDPDTLVI-TWEEMDKRNFNGPDFKYLVMWRRVVGSGPDWHEEYTIAPPFI--------VTDVQNFSAFEIKVQAVNKKGLGPEPDPIIGYSGEDVPLEAPLNLGVLLENSTTIRVTW-SAVDKETVRGHLLGYKIYLTWGHHRNSRAQEPENIVMVQTGANEEKKSITNLRPYCHYDLAISAFNSKG 916          
BLAST of SMED30034706 vs. UniProt/SwissProt
Match: sp|Q12860|CNTN1_HUMAN (Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.656e-10
Identity = 90/382 (23.56%), Postives = 148/382 (38.74%), Query Frame = -3
Query:    2 KKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFK-----NLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVES---RNVTLTIQCLDCMDREKMKGKLLSFVIIY----SDEYSKFNLTVPYYNGTDIEVHV-TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENR--IIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 1096
            + F+   NG L+I N     A  Y C A         S +L+VRGPP      + E +  + +   W       + IS   +   K++++ +      + P    + +     +L P+ +Y   +VA N +G  E      R    T  A P V  ++V     RN  LTI     + RE   G    +++ +     +E+ K  +T P    T   VH    + P   +   V A N    GP   V+     ++      T + V    S+E+S+HW+  L+K   +  Y +    +    E  NR  +   EY A   N     L   T Y I + A NS G   P  ++    ++ PP     ++  V+   R  I +
Sbjct:  558 RNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQ-TKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRI--KTDGAAPNVAPSDVGGGGGRNRELTITWAP-LSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNP---DTGRYVHKDETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKI--VESYQIRYWAAHDKEEAANRVQVTSQEYSARLEN-----LLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQPPRIISSVRSGSRYIITW 925          
BLAST of SMED30034706 vs. UniProt/SwissProt
Match: sp|Q62845|CNTN4_RAT (Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.055e-10
Identity = 81/372 (21.77%), Postives = 144/372 (38.71%), Query Frame = -3
Query:   62 IDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCKSLITKECNTVS--LNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLT--IQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV---TNLKPYKNYTFFVSAHNGVKSGPQDSVSC--KTKEVLPNPSTYIQVTEQKSNELSIHWDKALDK-FGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1117
            ID D     F  V G++  G L+I NI    A  Y+C           + +L+VRGPP        + ++D+  + +W    D +  ++  +         S+  +  +TV   ++  TF+ +   L P+ +Y    VA N +G+ E  R   + RT    P   P     NV     + +  +   + +  E   G+   +V+ +   + K    +      D   +V    +++P+  +   V   N    GP    +     +E    P   I      + ++ + W   + K  G I GY ++    D   EN  +I         T+T + +LK    Y +S+ A NS G       +  T R+ PP
Sbjct:  540 IDFDKDGDHFERVGGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPF--SVGWQAVSTVPELVDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTP----ANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFR-PHGKMIWMLTVLASADASRYVFRNESVRPFSPFEVKVGVFNNKGEGPFSPTTLVYSAEEEPTKPPASIFARSLSATDIEVFWASPIGKNRGRIQGYEVKYWRHDDKEENARKI---RTVGNQTSTKITNLKGNALYHLSVKAYNSAGTGPSSAAVNVTTRKPPP 901          
BLAST of SMED30034706 vs. TrEMBL
Match: A0A183MHE0 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS15465 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.118e-17
Identity = 79/269 (29.37%), Postives = 123/269 (45.72%), Query Frame = -3
Query:   56 PTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-----------CMDREK-----MKGKLLSFVI-IYSDEYSKFNLTVPYYNGTDI---EVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 796
            P  S +  NLKPY  Y   I A+N++G SE      + TLPG PVA P V   NV S ++++ +               C+D++      + G L+ +++ + + +  KF  +  +YN ++     V +++LKPY  Y    + +NG  SGP  S+   T E +P     I+  E  SN LSI WD   D  G I  Y LEL    +N    ++ +K+ + D+     V  +L   T Y I L +    G      +  +T  E P  P
Sbjct:   37 PLSSTTLHNLKPYTCYTLYIRALNDIGWSEFSKPSHSLTLPGLPVAHPSVHIINVSSHSISVDVGIATLKDIIQDNVKRCIDQDARFISLLHGPLVGYIVTVATIQPYKF-ASKTFYNASESFSQVVDISHLKPYTRYNLSFAFYNGRFSGPFTSLVVSTTEGIPGKPR-IKHFESSSNSLSIDWDSNADAVGKILAYKLELHTCSKNDTQSSKRLKTVQVDSKELQFVFGNLDPNTCYVIRLASATKAGFGHFSEVEVRTKFEAPSPP 303          
BLAST of SMED30034706 vs. TrEMBL
Match: A0A183R7I8 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.895e-17
Identity = 78/269 (29.00%), Postives = 121/269 (44.98%), Query Frame = -3
Query:   56 PTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-----------CMDREK-----MKGKLLSFVI-IYSDEYSKFNLTVPYYNGTDIE---VHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 796
            P  S +  NLKPY  Y   I A+N++G SE      + TLPG PV  P V   NV S ++++ +  +            C+D++      + G L+ +++ + + +  KF  +   YN +      V +++LKPY  Y    + +NG  SGP  S+   T E +P     I+  E  SN LSI WD   D  G I  Y LEL    +N    ++ +K+ + D+     V  +L   T Y I + +    G      I  +T  E P  P
Sbjct:   37 PLSSTTLHNLKPYTCYTLYIRALNDIGWSEFSQPSHSLTLPGLPVVHPAVHIINVSSHSISVDVGIVTLKDVIQDNVKRCIDQDARFISLLHGPLVGYIVTVATTQPYKF-ASKTLYNASGSYSQIVDISHLKPYTRYNLSFAFYNGRFSGPFTSLVVSTTEGIPGKPR-IKNFESSSNSLSIDWDSNADAVGKILAYKLELHTCSKNDTQSSKRLKTVQVDSKELQFVFGNLDHNTCYIIRVASATKAGFGHFSEIEVRTKFEAPSPP 303          
BLAST of SMED30034706 vs. TrEMBL
Match: A0A183NE80 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS416 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.428e-17
Identity = 78/269 (29.00%), Postives = 124/269 (46.10%), Query Frame = -3
Query:   56 PTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-----------CMDREK-----MKGKLLSFVI-IYSDEYSKFNLTVPYYNGTDI---EVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 796
            P  S +  NLKPY  Y   I A+N++G SE      + TLPG PVA P V   NV S ++++ +   +           C+D++      + G L+ +++ + + +  KF  +  +YN ++     V +++LKPY  Y    + +NG  SGP  S+   T E +P     I+  E  SN LSI W+   D  G I  Y LEL    +N    ++ +K+ + D+     V  +L   T Y I + +    G      I  +T  E P  P
Sbjct:   37 PLSSTTLHNLKPYTCYTLYIRALNDIGWSEFSKPSHSLTLPGLPVAHPSVHIINVSSHSISVDVGIANLKDIIQDNVKRCIDQDARFISLLHGPLVGYIVTVATIQPYKF-ASKTFYNASESFSQVVDISDLKPYTRYNLSFAFYNGRFSGPFTSLVASTTEGIPGKPR-IKNFESSSNSLSIDWESNADAVGKILAYKLELHTCSKNDTQSSKRLKTVQVDSKELQFVFGNLDPNTCYVIRVASATKAGFGHFSEIEVRTKFEAPSPP 303          
BLAST of SMED30034706 vs. TrEMBL
Match: G4V5I5 (Putative receptor protein tyrosine phosphatase OS=Schistosoma mansoni OX=6183 GN=Smp_152750 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.049e-16
Identity = 80/269 (29.74%), Postives = 121/269 (44.98%), Query Frame = -3
Query:   56 PTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-----------CMDREK-----MKGKLLSFVI-IYSDEYSKFNLTVPYYNGTDIE---VHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 796
            P  S +  NLKPY  Y   I A+N++G SE      + TLPG PVA P V   NV S +++L +               C+D++      + G L+ +++ + + +  KF  +   YN +      V +++LKPY  Y    + +NG  SGP  S+   T E +P     I+  E  SN LSI WD   D  G I  Y LEL    +N    ++ +K+ + D+     V  +L   T Y I + +    G      I  +T  E P  P
Sbjct:   37 PLSSTTLHNLKPYTCYTLYIRALNDIGWSEFSKPSHSLTLPGLPVAHPAVHIINVSSHSISLDVGIATLKDVIQDNVKRCIDQDARFISLLHGPLVGYIVTVATTQPYKF-ASKTLYNASGSYSQIVDISHLKPYTRYNLSFAFYNGRFSGPFTSLVVSTTEGIPGKPR-IKNFESSSNSLSIDWDSNADAVGKILAYKLELHTCSKNDTQSSKRLKTVQVDSKELQFVFGNLDHNTCYIIRVASATKAGFGHFSEIEVRTKFEAPSPP 303          
BLAST of SMED30034706 vs. TrEMBL
Match: A0A5K4ESA0 (Putative receptor protein tyrosine phosphatase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.059e-16
Identity = 78/268 (29.10%), Postives = 117/268 (43.66%), Query Frame = -3
Query:   56 PTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLD-----------CMDREK-----MKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIE---VHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKS-EYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 796
            P  S +  NLKPY  Y   I A+N++G SE      + TLPG PVA P V   NV S +++L +               C+D++      + G L+ +++  +        +   YN +      V +++LKPY  Y    + +NG  SGP  S+   T E +P     I+  E  SN LSI WD   D  G I  Y LEL    +N    ++ +K+ + D+     V  +L   T Y I + +    G      I  +T  E P  P
Sbjct:   37 PLSSTTLHNLKPYTCYTLYIRALNDIGWSEFSKPSHSLTLPGLPVAHPAVHIINVSSHSISLDVGIATLKDVIQDNVKRCIDQDARFISLLHGPLVGYIVTVATTQPYKFASKTLYNASGSYSQIVDISHLKPYTRYNLSFAFYNGRFSGPFTSLVVSTTEGIPGKPR-IKNFESSSNSLSIDWDSNADAVGKILAYKLELHTCSKNDTQSSKRLKTVQVDSKELQFVFGNLDHNTCYIIRVASATKAGFGHFSEIEVRTKFEAPSPP 303          
BLAST of SMED30034706 vs. Ensembl Cavefish
Match: l1cama (L1 cell adhesion molecule, paralog a [Source:NCBI gene;Acc:30634])

HSP 1 Score: 63.5438 bits (153), Expect = 2.519e-10
Identity = 47/198 (23.74%), Postives = 88/198 (44.44%), Query Frame = -3
Query:   44 MDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDI------------EVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEY--DALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITL 592
            ++RE ++G L+ + I    ++S     + + +G  +               +  L+PY  Y+ FV+  NG   GP  +    +T E +P P T +++      E+++ W       G + GY+L+     Q  +N ++ ++ E   D   T   ++ L SR+ Y   L  + +VG   PIV  G T  +  P  +I+ 
Sbjct:  807 VERESVRGHLMGYKIKIYYKHSDLQ-GLQHLDGQPLSEIVIKTGPNEERKELGGLQPYSCYSLFVNVFNGKGDGPPSEDCPFETPEGVPGPPTSLELISPSETEMTLQWTPPAKPNGILIGYLLQY----QQLDNTDKPMQVEKIDDPKKTQLTLKKLDSRSRYRFDLRGRTNVGSGMPIVKEGATTLDGAPPHNISF 999          
BLAST of SMED30034706 vs. Ensembl Cavefish
Match: l1cama (L1 cell adhesion molecule, paralog a [Source:NCBI gene;Acc:30634])

HSP 1 Score: 63.1586 bits (152), Expect = 3.189e-10
Identity = 40/148 (27.03%), Postives = 69/148 (46.62%), Query Frame = -3
Query:   44 HVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEY--DALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITL 478
             +  L+PY  Y+ FV+  NG   GP  +    +T E +P P T +++      E+++ W       G + GY+L+     Q  +N ++ ++ E   D   T   ++ L SR+ Y   L  + +VG   PIV  G T  +  P  +I+ 
Sbjct:  905 ELGGLQPYSCYSLFVNVFNGKGDGPPSEDCPFETPEGVPGPPTSLELISPSETEMTLQWTPPAKPNGILIGYLLQY----QQLDNTDKPMQVEKIDDPKKTQLTLKKLDSRSRYRFDLRGRTNVGSGMPIVKEGATTLDGAPPHNISF 1048          
BLAST of SMED30034706 vs. Ensembl Cavefish
Match: ENSAMXT00000056314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000056.1:1022977:1063492:1 gene:ENSAMXG00000041624.1 transcript:ENSAMXT00000056314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.383e-8
Identity = 85/392 (21.68%), Postives = 156/392 (39.80%), Query Frame = -3
Query:  101 TIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCK----SLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARP-----FVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVH----VTNLKPYKNYTFFVSAHNGVKSGPQDSVSC-KTKEVLP-NPSTYIQVTEQKSNELSIHWDKALDK---FGPITGYVLE---LSVSDQNSENENRIIKSEYDALTTNTVVRDLKSR---------TTYSISLYAKNSVGISKP 1174
            TI+W K+ ++I+ ++          D K+    NGSL IT++   DA  Y C+ +      + S ++ V   P   H+ +    S   +  +W    + N  +S  +  V   +        ++ E N + +           L P+  Y   + A+NN+G S+   L + +   TP A+P      VR  + + +++ +T + L   DR    G    + +++     +     P +N  D   H    V N   +  +   V A N +  GP  +     + E  P  P T + V +     ++I W  A+D+    G + GY +    L    ++  N  R+++   +      V+RD K           + Y +S+ A NS G   P
Sbjct:  476 TILWRKDNNKIMTSA---------QDDKYTVFENGSLKITDVQQKDAGSYSCEVMTKLDADKASGSITVVDKPDAPHSLRLSEKSSRSVTLSWIPGNENNSPVSEYVIEVREEMHGLSEVKRVSAEMNHLEI----------PLLPFCTYNFRVTAVNNIGTSD-FSLPSESY-TTPPAKPDKNPGSVRSESTDPKSMVITWEVL---DRRHFNGPGFRYKVMWRQAAGQG----PKWN-EDFVSHPPFTVNNTDTFSAFEIKVQALNDLGHGPSPAPKLGHSGEDTPLKPPTGVAVNQYNDTAVTITW-TAVDRESVRGHLLGYKIHLKRLGPHQEHHGNRKRLLERSREESWEIDVLRDEKEEKIVSGLEYYSNYQLSITAHNSKGEGPP 837          

HSP 2 Score: 55.8398 bits (133), Expect = 7.576e-8
Identity = 38/140 (27.14%), Postives = 61/140 (43.57%), Query Frame = -3
Query:   65 VTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKT--DRENP 475
            V+ L+ Y NY   ++AHN    GP  D V   T E +P   T ++       +LS+HW+      G + GYVL       +       + + +D    N  + +L S++ Y  SL A+   G+ +   +   T  D E P
Sbjct:  813 VSGLEYYSNYQLSITAHNSKGEGPPSDPVHFNTPEGVPGAPTDLRCESPSQTKLSLHWNHPHKPNGVLRGYVLHYQAQGVDGSPSEVQMVTIHDPSLNNYTLDNLDSQSRYFFSLRAETHAGLGEEAKVNATTLLDGEPP 952          
BLAST of SMED30034706 vs. Ensembl Cavefish
Match: ENSAMXT00000056255.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000056.1:1027813:1063492:1 gene:ENSAMXG00000041624.1 transcript:ENSAMXT00000056255.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 4.228e-8
Identity = 84/392 (21.43%), Postives = 156/392 (39.80%), Query Frame = -3
Query:  101 TIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNW----DFNVTLSNLISSVNLTLCK----SLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARP-----FVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVH----VTNLKPYKNYTFFVSAHNGVKSGPQDSVSC-KTKEVLP-NPSTYIQVTEQKSNELSIHWDKALDK---FGPITGYVLE---LSVSDQNSENENRIIKSEYDALTTNTVVRDLKSR---------TTYSISLYAKNSVGISKP 1174
            TI+W K+ ++I+ ++          D K+    NGSL IT++   DA  Y C+ +      + S ++ V   P   H+ +    S   +  +W    + N  +S  +  V   +        ++ E N + +           L P+  Y   + A+NN+G S+   L + +   TP A+P      VR  + + +++ +T    + +DR    G    + +++     +     P +N  D   H    V N   +  +   V A N +  GP  +     + E  P  P T + V +     ++I W  A+D+    G + GY +    L    ++  N  R+++   +      V+RD K           + Y +S+ A NS G   P
Sbjct:  515 TILWRKDNNKIMTSA---------QDDKYTVFENGSLKITDVQQKDAGSYSCEVMTKLDADKASGSITVVDKPDAPHSLRLSEKSSRSVTLSWIPGNENNSPVSEYVIEVREEMHGLSEVKRVSAEMNHLEI----------PLLPFCTYNFRVTAVNNIGTSD-FSLPSESY-TTPPAKPDKNPGSVRSESTDPKSMVIT---WEEVDRRHFNGPGFRYKVMWRQAAGQG----PKWN-EDFVSHPPFTVNNTDTFSAFEIKVQALNDLGHGPSPAPKLGHSGEDTPLKPPTGVAVNQYNDTAVTITW-TAVDRESVRGHLLGYKIHLKRLGPHQEHHGNRKRLLERSREESWEIDVLRDEKEEKIVSGLEYYSNYQLSITAHNSKGEGPP 876          

HSP 2 Score: 56.225 bits (134), Expect = 5.206e-8
Identity = 58/270 (21.48%), Postives = 106/270 (39.26%), Query Frame = -3
Query:   65 LNYPTFSYSFKNLKPYFDYRASIVAINNVG----VSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVII------YSDEYSKFNLTVPYYNGTDIEVHV----------TNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKT--DRENP 805
            +++P F+    N   +  +   + A+N++G     + ++       P  P     V + N  +  +T T      +DRE ++G LL + I       + + +      +        E+ V          + L+ Y NY   ++AHN    GP  D V   T E +P   T ++       +LS+HW+      G + GYVL       +       + + +D    N  + +L S++ Y  SL A+   G+ +   +   T  D E P
Sbjct:  729 VSHPPFT--VNNTDTFSAFEIKVQALNDLGHGPSPAPKLGHSGEDTPLKPPTGVAVNQYNDTAVTITWT-----AVDRESVRGHLLGYKIHLKRLGPHQEHHGNRKRLLERSREESWEIDVLRDEKEEKIVSGLEYYSNYQLSITAHNSKGEGPPSDPVHFNTPEGVPGAPTDLRCESPSQTKLSLHWNHPHKPNGVLRGYVLHYQAQGVDGSPSEVQMVTIHDPSLNNYTLDNLDSQSRYFFSLRAETHAGLGEEAKVNATTLLDGEPP 991          
BLAST of SMED30034706 vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 56.225 bits (134), Expect = 5.151e-8
Identity = 57/240 (23.75%), Postives = 104/240 (43.33%), Query Frame = -3
Query:  107 TFSYSFKNLKPYFDYRASIVAINNVGVSERVD-LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEV-------HVTNLKPYKNYTFFVSAHNGVKSGPQDS-VSCKTKEVLPNPSTYIQVTEQKSNELSIHW--DKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGIS 793
            T  YS   L PY DY   +VA+NN+G     + ++ +T    P   P      V  R ++ T   +   + E+  G+++ + + Y+ + S+      + N  + ++        +  L P K Y   V A+  V  GP  S +    K  +P+     +   +    + + W       +   ITGY  EL    ++ + E R+    +++ TT  +++DL+  TTYS  L A++  GI 
Sbjct:  352 TTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAP----RQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQ------HVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGY--ELLYKRKDEKEEKRV---SFES-TTTYLLKDLRPFTTYSFQLAARSRHGIG 575          
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Match: ncam1b (neural cell adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-010822-2])

HSP 1 Score: 64.6994 bits (156), Expect = 2.246e-11
Identity = 92/382 (24.08%), Postives = 150/382 (39.27%), Query Frame = -3
Query:  101 TIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINL---LVRGPPFRIH------------NFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRA-SIVAINNVGV-SERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDI-----EVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVL--PNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKP 1174
            TI W +  D+ +     +T++  I  + +   +  SL + ++ Y+DA  Y+C  +  N + Q S  +   +  GP F               N  CE L++     +W  +      I S NLT          N +  ++P FS      +   D+ + + VA+NN+   S+   L    LP  P +   V+ T V S +  +T++  D          +L++ +           T  Y+ G++I      V VTNL+P   Y   VSA NGV  GP    +    E +  P+P           N   I W    D   PI  Y+++  V       E R   +   A+ ++     LK  T Y + + A N  G S P
Sbjct:  223 TITWRRVSDQHVFRQGQQTLEGRIEVRSYA--KVSSLTLRDVQYTDAGEYMC--IANNNVGQASAAMHLDVAYGPKFAGEKVTYHSWPNNAVNVTCEVLANPKAAVSWSRD---GQPIPSANLT----------NVIVHSFPGFSVLEITPESQSDFGSYNCVAVNNIASESKEFVLVEAALPSAPQS---VKATAVYSTSAEITLEEPDYTG----GVPILTYTVRVRPANGLSEWTSYYFGGSEIWNYENTVKVTNLEPNTQYMAEVSARNGVGDGPFTKPTLFYTEPIREPSPPKVHGSVGSTGNSYVISWVSQDDGGSPIQHYLVKHRVDGSAEWLEQRAPSTSKHAMLSS-----LKWNTEYEVHVRAINKEGDSDP 575          
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 55.4546 bits (132), Expect = 1.806e-8
Identity = 83/380 (21.84%), Postives = 145/380 (38.16%), Query Frame = -3
Query:   62 RTIDVDISDKKF----VSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSF-----KNLKPYFDYRASIVAINNVGVSERV--DLQARTLPGTPVARPF-VRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKF--NLTVPYYNGTDIEVHVTNL----KPYKNYTFFVSAHNGVKSGPQD-SVSCKTKEVLPN--PSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIK-----SEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1123
            RT+D     +KF     S  +G L I  +  +D+  Y C A  P      S  L V+GPP    + +   ++++    +W      ++ I    +   ++  +++  +VS        S      + L P+ +Y   + A+++VG SE+     + RT    P   P  V       R +T+T    + +  E   G    +V+ +    S       VP+    +  ++V  L     PY  +   V   N    GP+  +V   + E LP+  P +   V    S EL + W     +   + G +L  SVS   +   N +       +      T   +  L + TTYS+++   N  G   P      T  + PP
Sbjct:  437 RTLDPGRDAEKFWIASQSEDSGDLTIVKVRLADSGRYTCTARTPIDSVSASATLRVKGPPGPPASVRVMKVTNTSAMLSWKQGTVNNSPIRRYRVE-ARTPQSRQWASVSTAPAEIEGSAVTAVCEGLVPWTEYEFRVAAVSDVGTSEQSAPSRRIRTNAAPPTVVPVAVSGGGGRPRELTIT---WNPVHPELRYGDDFGYVVSFRPNSSSCWTQAVVPH---AETALYVAELPPDVPPYAAFLVRVGTFNSAGEGPRGPAVIVHSAEALPSAVPESVAAVGASAS-ELDVSWLPVPQEG--LHGRLLGYSVSYWPAAAANELSAGTRQNARVSGEATGVRIAGLSATTTYSLTVRVLNGAGAGPPSRTANGTTLKPPP 806          
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002463.1 (pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 gene:ENSPMAG00000002229.1 transcript:ENSPMAT00000002463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 2.065e-8
Identity = 94/413 (22.76%), Postives = 158/413 (38.26%), Query Frame = -3
Query:   11 TIIWFKNIDEIIIASPLRTIDVD------ISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVR-GPP---FRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLT--LCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVD-----LQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEV----LPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPE-PSITLVERVKQYIRVR 1174
            TI WFK+  E+  ++ L   D D      + D   V G N  L ++N+             G      +++ +L R GPP     +     E  S +      D    +S+ +     T  L  +L+  E  T S+           L    +Y   I+AIN  GV E ++     ++   +P  P   P V  TN+   ++T+      C  R    G  +++ +++   D+     +       TD+   VT L    NY F VSA N    G     S  ++       P P T   V +   + ++  W K + D    I GY++E+   +   E+E ++         T   +  L     Y + + A N  GI +P+ + G    E   + P I L   +++ I VR
Sbjct: 9560 TIQWFKDDKELEESARLENKDADFKALIIVKDAIRVDGGNYVLQVSNV-------------GGTKTCPINVKVLDRPGPPEGPVVVTGVTAEKCSLAWNAPAQDGGSDISHYVVEKRETSRLAWTLVASEVVTTSVK-------VTKLLEGNEYIFRIMAINKFGVGEPLESAPVVIKNPYIPPGPPKAPEV--TNITKDSMTV------CWGRPDTDGGSEIVGYIVEKRDKDGIRWVKCNKRRVTDLRFRVTGLMEDHNYEFKVSAENAAGIGEPSQPSSYSRACDPIFKPGPPTNPYVVDTTKSSVTFAWSKPVYDGGSDIQGYIVEICTGE---EDEWKMCTPPTGLRVTRLEIGKLVELQEYRLRVCALNKAGIGEPVALPGTVKPEEKIDAPEIELDSELRKGIAVR 9941          

HSP 2 Score: 50.8322 bits (120), Expect = 6.635e-7
Identity = 60/244 (24.59%), Postives = 102/244 (41.80%), Query Frame = -3
Query:   59 DYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTI--QCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGV-KSGPQDSVSC-KTKEVL--PNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMG---KTDRENPPE 754
            +Y   I+A+N  GV E ++        T    PFV  +  ++  VT       + C  R +  G  ++  +++   D+     +       TD+   V+ L     Y F V A N   +S P +S    K  + +  P P    +VT+   + +S+ W K + D    I GY++E ++ +    +E ++       L     +  LK  T Y + + A NS G  +P +I G     DR  PPE
Sbjct: 7528 EYIFRIMAVNKYGVGEPLESDP-----TLAVNPFVPPSPPKTPEVTTVTNNSMVVCWGRPESDGGSEITGYIVERRDKAGLRWVKCNKRIVTDLRFKVSGLTEGHEYEFKVIAENAAGQSLPSNSSPFYKASDAVFKPGPPANPRVTDTSRSSISVAWSKPVYDGGAEIRGYIVETTLPEA---DEWKVATPTNGVLAQKYTITGLKENTEYKVRISAVNSEGAGEPALIPGVVKAEDRLLPPE 7763          

HSP 3 Score: 49.2914 bits (116), Expect = 1.767e-6
Identity = 57/219 (26.03%), Postives = 91/219 (41.55%), Query Frame = -3
Query:  101 IVAINNVGVSERVDLQARTL--PGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP---QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFG-PITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKP 739
            I+ + NVG  + V +  + L  PG P   P    T + +   TL+         ++  G  +S+ ++   E S+   T+   +   +   VT L     Y F V A N    G     DSVS +   V+P+P    +VT    + + + W + +   G  ITGY+LE    D++S    R  K     L     V  L+    Y   + A+N+ GI  P
Sbjct: 8519 ILLLKNVGGEKSVTVNVKVLDKPGPPEG-PLA-ATGITAEKCTLSWNAP-----KQDGGSEISYYVVEKRETSRLVWTLVQSDIQTLSCKVTRLLEGNEYIFRVMAVNKYGVGEPLESDSVSARNPYVVPDPPKQPEVTTITKDSMIVIWGRPVSDGGSEITGYILEK--RDKDSLRWTRCSKRPISELRLR--VTGLQEGHDYEFRVSAENAAGIGAP 8726          

HSP 4 Score: 48.9062 bits (115), Expect = 2.228e-6
Identity = 49/164 (29.88%), Postives = 70/164 (42.68%), Query Frame = -3
Query:   11 VTNLKPYKNYTFFVSAHNGVK----SGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQN---SENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIM-GKTDRENPPEPSITLVERVKQYIRVR 475
            V NL P   Y F V A N V     SGP      K     P P   ++V +   + + + W K A D   PI GYV+E+   D+     EN  R   +    LT  TV   L  +  Y   + A+N VG+ +P  +    T +E    P I L   +++ + VR
Sbjct: 4356 VANLTPGYEYQFRVKAENAVGLGDPSGPSRPTIAKDPIEPPGPPIGLKVVDSTRSSVMLGWTKPAYDGGAPIIGYVVEMRPKDEKMAPDENWKRCNVASQLILTQYTVT-SLDDKLEYEFRVSAQNQVGLGRPADLREAVTPKEILEPPEIDLDGSLRKTLTVR 4518          

HSP 5 Score: 48.1358 bits (113), Expect = 4.243e-6
Identity = 71/271 (26.20%), Postives = 114/271 (42.07%), Query Frame = -3
Query:   14 DYRASIVAINNVGV-----SERVDLQAR-TLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKG--KLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN----GVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDK-ALDKFGPITGYVLELSVSDQNSENENRIIKSEYDAL--TTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKT---DRENPPEPSI------TLVERVKQYIRV 754
            +Y   + A+N  GV     SE V ++ R   PG P A P V  TNV    VT++ +      R    G  +++ +++   ++     +     +  D+   +  L     Y F VSA N    G  S P   VS K +  +P P T  ++T+      +  W + + D    ITGY++E        E+E + +KS   A    T  VV +L +   Y   + A N+ G  +P  + G     +RE  P+  +      TLV R    IR+
Sbjct: 6444 EYIFRVSAVNQYGVGEPVQSEPVKVENRFGRPGPPNA-PEV--TNVTKSTVTISWK------RPSFDGGSEIIGYIVERKEKKGLRWVRATKNSIADLRYKIPGLLEGNEYEFRVSAENKAGVGEPSEPSHPVSTKEQAFVPGPPTNPKITDTTKTTATFTWGRPSYDGGLEITGYIVE-----HRKEDEEKWVKSTTGATLRITEFVVSNLLAGGKYHFRVRAVNAEGAGEPAEVDGVVEIKEREEVPDLELDADLRKTLVLRAGTTIRI 6700          
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003347.1 (pep scaffold:Pmarinus_7.0:GL478413:1221:29428:1 gene:ENSPMAG00000003054.1 transcript:ENSPMAT00000003347.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 9.625e-8
Identity = 52/240 (21.67%), Postives = 89/240 (37.08%), Query Frame = -3
Query:  113 YSFKNLKPYFDYRASIVAINNVG--------VSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSD-------EYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 784
            Y      P+  Y   + A+NN G        V    +   R  P  PV R  +        + TL +   D    + ++   L   I YS                V  ++G      +  L+P+  Y+  V+A N    GP    ++  T E +P     +QVT+   N +++ W    ++ G +TGY L     +  ++           A  T+  V DL+ ++ Y   L A+ + G
Sbjct:  305 YVLAGTPPFTPYEVKVQAVNNQGKGPEPLVIVGFSGEAGKRGRPAAPVGRCVIG-------DRTLWVPHWDPFGIQSLRSHCLITAIYYSKVRGLQERRRRHTGKKVLEFHGARNSGMLPGLEPFSTYSVEVAAFNSKGEGPLSHPITANTPEGVPGKVVGLQVTQATLNSVTLEWKPPAERNGILTGYTLTYEYINSTTQELGPSKTESIPANVTSWRVTDLEPQSKYKFYLGAQTNAG 537          
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003337.1 (pep scaffold:Pmarinus_7.0:GL478413:1212:29431:1 gene:ENSPMAG00000003054.1 transcript:ENSPMAT00000003337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.546e-7
Identity = 52/240 (21.67%), Postives = 89/240 (37.08%), Query Frame = -3
Query:  113 YSFKNLKPYFDYRASIVAINNVG--------VSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSD-------EYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 784
            Y      P+  Y   + A+NN G        V    +   R  P  PV R  +        + TL +   D    + ++   L   I YS                V  ++G      +  L+P+  Y+  V+A N    GP    ++  T E +P     +QVT+   N +++ W    ++ G +TGY L     +  ++           A  T+  V DL+ ++ Y   L A+ + G
Sbjct:  313 YVLAGTPPFTPYEVKVQAVNNQGKGPEPLVIVGFSGEAGKRGRPAAPVGRCVIG-------DRTLWVPHWDPFGIQSLRSHCLITAIYYSKVRGLQERRRRHTGKKVLEFHGARNSGMLPGLEPFSTYSVEVAAFNSKGEGPLSHPITANTPEGVPGKVVGLQVTQATLNSVTLEWKPPAERNGILTGYTLTYEYINSTTQELGPSKTESIPANVTSWRVTDLEPQSKYKFYLGAQTNAG 545          
BLAST of SMED30034706 vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 54.6842 bits (130), Expect = 5.681e-8
Identity = 82/373 (21.98%), Postives = 148/373 (39.68%), Query Frame = -3
Query:    2 DKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYS----DEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNT-VVRDLKSRTTYSISLYAKNSVGISK-PIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 1099
            D   +SG+NG LII  I  S    Y C A       Q    + VR  PF        S++   +K  W  +   +++++S  +       T E   ++      S     L+P+  Y   + A+N++G S R  L A     T   +P     N+E+  V+ T      +      G++  + + YS    ++ S++       N T     VT L     + F + A+N    GP  + V+ KT++ +P     +Q++   S  + + W         I GY +  + S Q+       + +   A   NT  +  L   T Y +++ AK+  G+     V+  +TD + P +    +  R +    + I +
Sbjct:  241 DGSRISGQNGELIIRGIQRSGN--YSCIADSNMGRVQAYAYVTVRLLPFAPSRPNAASITSDAIKITW--HPRGAHVVTSYEVQYRLKGKT-EWQEITNVRGMQSLVVSGLRPFSSYEFRVFAVNSLGRS-RPSLMAEYT--TSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMASSTNSTT----VTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPGQPRSVQLSVLSSTAIRVTWSPPRYPGDGIFGYDVYYNKSKQD-------MDTVIGAFQMNTKEIMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISW 594          
BLAST of SMED30034706 vs. Ensembl Nematostella
Match: EDO43189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ85])

HSP 1 Score: 54.6842 bits (130), Expect = 5.936e-8
Identity = 54/218 (24.77%), Postives = 101/218 (46.33%), Query Frame = -3
Query:   56 TLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPY-YNGTDIEVHVTNLKPYKNYTFFVSA----HNGVKSGPQDSVSCKTKEVLPN-PSTYIQVTEQKSNELSIHWDK--ALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEP 685
            ++PG P     VR   + S ++ +T  C DC D        ++F+  Y + +   N+T     N T   V++T L+P+  Y  +V++     NG++SGP   V+  T+E +P+ P + +Q     S  L+I W    + +  G + GY +        +++ N +  +     T+N ++  L+  T Y + + A   VG    + +  +TD + P  P
Sbjct: 1018 SVPGKPPVNLTVRA--LSSTSLEVTWDCSDCHDTNNT----IAFLATYRETHGNKNVTRGVTVNKTARLVNITGLEPFTEYAVWVNSVTIRGNGIQSGP---VNQTTQEDVPSLPPSNLQAWNLSSTSLNISWAAVPSGNHHGILLGYNVTYRREGHANQSLNYVRTN-----TSNVMLTSLEKYTWYDVRVAAFTRVGPGPALNVTVRTDEDIPSLP 1221          
BLAST of SMED30034706 vs. Ensembl Nematostella
Match: EDO41204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S8])

HSP 1 Score: 53.9138 bits (128), Expect = 1.075e-7
Identity = 79/339 (23.30%), Postives = 130/339 (38.35%), Query Frame = -3
Query:   65 GPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISS-----VNLTLC----KSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAIN--NVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVI---IYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPN-PSTYIQVTEQKSNELSIHWDKALDKF---GPITGYVLELSVSDQNSE------NENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENP 1009
            GP +  + S       P    H     + S + +K +W FN T  N++       V+L       + L +++   V  +     Y    L  Y  YR ++ A      GV    ++  RT    P A P  R T     N T      D + REK+ G LL + +   + ++   K NL     N  +       L+ +  Y   V   N    G Q ++  +T    P+ P TY+      S  L++ W    D +   G I GY +  + +D NS       + NR+++            +DL   T Y++++ A N  G      +M  TD++ P
Sbjct:  397 GPGVFGEKSQMTDESVPVVSPHGITGYNTSATSIKLHWAFNDTDRNVLGVLTGFVVHLKAANLDDEFLESEQTKRVIADPKAREYEVTALGIYTLYRFNMTATTSKGEGVVSLEEVLIRTNGKGPGAAPVTRYTT----NSTSISVDWDAIPREKLYGPLLGYKVGLYLVTESVEKANLINLAPNARN--ATFAGLRIFTRYKVIVYGFNEYGDGIQAAIDIRTDSERPSRPPTYLTCFNTSSTSLNVTWQPLSDSYYEHGDIQGYKVITNQTDGNSSFVIATCSSNRMLQ-----------FKDLIKYTEYNVTVEAFNEKGGGPSAEVMCTTDQDVP 718          
BLAST of SMED30034706 vs. Ensembl Medaka
Match: l1cama (L1 cell adhesion molecule [Source:NCBI gene;Acc:101166379])

HSP 1 Score: 70.4774 bits (171), Expect = 1.550e-12
Identity = 54/219 (24.66%), Postives = 101/219 (46.12%), Query Frame = -3
Query:   62 PVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV-------------TNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEY--DALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 670
            P+  P V    ++ +N T        +D+EK++G LL + I  + +  +F+     +  TD E  +             +NL+P+  Y   V+  N    GP  ++V   T+E +P P  ++ +      E+++ W   +   G +TGYVL+     Q +EN++ +IK +   +   T+  ++ L   ++Y   L  + +VG  KPI+  G T  +  P
Sbjct:  825 PLEGPLV--VGIDLKNSTTVEARWAPIDKEKVRGHLLGYKIHLTWKGYRFHHG---HGSTDSENTIVEKTEPNEERKVISNLRPFSKYDLAVTVFNNKGEGPYSETVPFMTEEGVPGPPAFLSLRSPSETEMTMEWKPPVHPNGNLTGYVLQYQ---QITENDDSLIKEKTIDNPKITHHTLKGLDPHSSYRFYLSGRTAVGNGKPIMKTGATKSDALP 1035          
BLAST of SMED30034706 vs. Ensembl Medaka
Match: l1cama (L1 cell adhesion molecule [Source:NCBI gene;Acc:101166379])

HSP 1 Score: 70.4774 bits (171), Expect = 1.579e-12
Identity = 54/219 (24.66%), Postives = 101/219 (46.12%), Query Frame = -3
Query:   62 PVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHV-------------TNLKPYKNYTFFVSAHNGVKSGP-QDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEY--DALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 670
            P+  P V    ++ +N T        +D+EK++G LL + I  + +  +F+     +  TD E  +             +NL+P+  Y   V+  N    GP  ++V   T+E +P P  ++ +      E+++ W   +   G +TGYVL+     Q +EN++ +IK +   +   T+  ++ L   ++Y   L  + +VG  KPI+  G T  +  P
Sbjct:  825 PLEGPLV--VGIDLKNSTTVEARWAPIDKEKVRGHLLGYKIHLTWKGYRFHHG---HGSTDSENTIVEKTEPNEERKVISNLRPFSKYDLAVTVFNNKGEGPYSETVPFMTEEGVPGPPAFLSLRSPSETEMTMEWKPPVHPNGNLTGYVLQYQ---QITENDDSLIKEKTIDNPKITHHTLKGLDPHSSYRFYLSGRTAVGNGKPIMKTGATKSDALP 1035          
BLAST of SMED30034706 vs. Ensembl Medaka
Match: cntn4 (contactin-4-like [Source:NCBI gene;Acc:101167031])

HSP 1 Score: 66.2402 bits (160), Expect = 3.463e-11
Identity = 90/408 (22.06%), Postives = 159/408 (38.97%), Query Frame = -3
Query:   62 AILNKTIRLDCPALMSNPSVE-TIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFN------VTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSK--FNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSV-SCKTKEVLPNPS-TYIQVTEQKSNELSIHWDKALDKFGP---ITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1237
            A + +++ L C  +  +PS+E    WF N   I   S       D   +K      G ++I NI    A  Y C          V+++L+VRGPP    + + E ++D+    +W         +T   + +    +L    +T     V       +    +L P+ +Y   ++A N +G  E  +   QART   +P   P        SR+  L I   + +  E   G    +V+ +    +       VP    +       +++P+  +   V  +N    GP   V +  + E  P  + T ++     + E+ + W KAL        + GY L        SE E+           T++++R L+  T+Y IS+ A N+ G   P   +  T ++ PP
Sbjct:  517 ATVGESVVLPC-QVSHDPSLELKFTWFFNEQLIHFGS------HDGFFEKVGGHSAGDIMIRNIQLKHAGKYTCAVQTKVDSISVALDLIVRGPPAPPTHIQVEEITDTTASLSWRPGPDNHSPITAYTIQARTPFSLGWQAVTTVPEVVGGR--QLTAVVIDLNPWVEYEFRVLASNRIGTGEPSKPSKQARTKSTSPKVTPANVSGGGGSRS-ELVI-TWEPVPEELQNGPGFGYVVAFRPHGATGWMQAAVPSPEASRYVFKNESIQPFSPFHVKVGVYNNEGEGPFGPVITIYSAEEEPGRAPTRVRARSLSAAEIEVSW-KALPWNASKRRVLGYELRYW---SKSEREDTASVQRTVGNQTSSIIRGLRGSTSYYISVRAYNTAGTGPPSGTVNVTTKKPPP 909          
BLAST of SMED30034706 vs. Ensembl Medaka
Match: cntn4 (contactin-4-like [Source:NCBI gene;Acc:101167031])

HSP 1 Score: 65.4698 bits (158), Expect = 5.750e-11
Identity = 92/412 (22.33%), Postives = 162/412 (39.32%), Query Frame = -3
Query:   62 AILNKTIRLDCPALMSNPSVE-TIIWFKNIDEIIIASPLRTIDVDISDKKF--VSGRN--GSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFN------VTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSE--RVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSK--FNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSV-SCKTKEVLPNPS-TYIQVTEQKSNELSIHWDKALDKFGP---ITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPP 1237
            A + +++ L C  +  +PS+E    WF N   I   S          D  F  V G++  G ++I NI    A  Y C          V+++L+VRGPP    + + E ++D+    +W         +T   + +    +L    +T     V       +    +L P+ +Y   ++A N +G  E  +   QART   +P   P        SR+  L I   + +  E   G    +V+ +    +       VP    +       +++P+  +   V  +N    GP   V +  + E  P  + T ++     + E+ + W KAL        + GY L        SE E+           T++++R L+  T+Y IS+ A N+ G   P   +  T ++ PP
Sbjct:  514 ATVGESVVLPC-QVSHDPSLELKFTWFFNEQLIHFGS---------HDGFFEKVGGQHSAGDIMIRNIQLKHAGKYTCAVQTKVDSISVALDLIVRGPPAPPTHIQVEEITDTTASLSWRPGPDNHSPITAYTIQARTPFSLGWQAVTTVPEVVGGR--QLTAVVIDLNPWVEYEFRVLASNRIGTGEPSKPSKQARTKSTSPKVTPANVSGGGGSRS-ELVI-TWEPVPEELQNGPGFGYVVAFRPHGATGWMQAAVPSPEASRYVFKNESIQPFSPFHVKVGVYNNEGEGPFGPVITIYSAEEEPGRAPTRVRARSLSAAEIEVSW-KALPWNASKRRVLGYELRYW---SKSEREDTASVQRTVGNQTSSIIRGLRGSTSYYISVRAYNTAGTGPPSGTVNVTTKKPPP 907          
BLAST of SMED30034706 vs. Ensembl Medaka
Match: ENSORLT00000037609.1 (titin [Source:NCBI gene;Acc:101157365])

HSP 1 Score: 65.855 bits (159), Expect = 5.941e-11
Identity = 98/409 (23.96%), Postives = 162/409 (39.61%), Query Frame = -3
Query:   11 IIWFKNIDEIIIASP-------LRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVR-GPPFRIHNFKCESLSDSVLKFNW-----DFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQ---ARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN----GVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKAL-DKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKT-DRENPPEPSITLVERVKQYIRVR 1171
            I+W K+  EI   +P       L    + + +   V G   +L ++NI             G +    V++ +L R GPP      K + LS       W     D   T+++ I     T   S +T  C  +  N    SY    L P  +Y   + A+N  GV E ++ +   A+    TP A      + V S +V LT +        ++ G ++  +      ++K N         D+    T L     Y F V A N    G  S P + +        P P T ++VT+  S+ +S+ W +   D   PITG+++E+  S   ++ E            TN  V+ L+  T YS  + A N+ G+ +P+ + G     E    P I L   +++ + VR
Sbjct:  493 IMWLKDGREIDKVTPRMEFKNTLTHTTLTVRECTRVDGGRFALSLSNI-------------GGSTSVSVNVKVLDRPGPP--DGQLKVKVLSAEKCNLYWNLPINDGGATITHYIVEKRET---SRVTWTC--LDSNIEAVSYKVSKLVPCKEYVFRVAAVNKFGVGEFLESEPFVAKNPFTTPSAPSSPTASAVTSDSVLLTWERPVSDGGSEIDGYIVEKIDKEGVRWTKCN----KRRLNDLCFRCTGLTEGHYYQFRVLAENAAGMGTPSEPSEYIKVCEASYPPGPPTNLKVTDYSSSTVSLTWSRPFYDGGAPITGFLVEMKGS---TDEEWTTCTPNTGIEDTNYTVKTLRENTEYSFRVRAINAAGVGEPMDLPGSVLATEKVEAPEIELDSALRKIVNVR 874          
BLAST of SMED30034706 vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 437/438 (99.77%), Postives = 438/438 (100.00%), Query Frame = -3
Query:    2 WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 1315
            WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGY+LELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY
Sbjct:   10 WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYILELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 447          
BLAST of SMED30034706 vs. Planmine SMEST
Match: SMESG000041505.1 (SMESG000041505.1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 437/438 (99.77%), Postives = 438/438 (100.00%), Query Frame = -3
Query:    2 WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYVLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 1315
            WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGY+LELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY
Sbjct:   10 WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETIIWFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICKALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLISSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGVKSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGYILELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSVGISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY 447          
BLAST of SMED30034706 vs. Planmine SMEST
Match: SMESG000010713.1 (SMESG000010713.1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.246e-7
Identity = 61/248 (24.60%), Postives = 105/248 (42.34%), Query Frame = -3
Query:  113 SYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGT---PVARPFVRKTNVESRNVTLTIQ------CLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN-GVKSGPQDSVSCKTKEVLPNPSTYIQVTEQ-KSNELSIHWDKALDKFG-PITGYVLELSVS----DQNSENENRIIK-------SEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 787
            ++    LKP  +Y   ++AIN+ G S   D  +    GT   P   P + + ++    +T   +      CL+ MD     G    F+ ++              NG +IE +V NL+   NY F ++A N   +S   + V+  TK  LP+P   + V  +  S    + WD+  D  G P+  Y LEL ++    +Q   N + I+        + Y+ +      ++L   +     + AK+SVG
Sbjct:  720 TFKVSKLKPSTEYLIRLLAINSFGSSPWSDPLSVLTSGTAPLPPDPPSLARADIGGLLLTWKKRPTDETFCLEMMDEATGYG----FITVF--------------NGPEIEHYVENLRRNTNYRFHLAASNQDGRSKWSEVVTHSTKPDLPSPPQKLHVRGKVHSTNFVLVWDEPEDDGGLPVIAYKLELDINSICDNQAKANSDGIVNDSDCDWVNNYEGIEREYNCKNLTPGSMVLARVSAKSSVG 949          
BLAST of SMED30034706 vs. Planmine SMEST
Match: SMESG000010713.1 (SMESG000010713.1)

HSP 1 Score: 51.9878 bits (123), Expect = 9.483e-7
Identity = 61/248 (24.60%), Postives = 105/248 (42.34%), Query Frame = -3
Query:  113 SYSFKNLKPYFDYRASIVAINNVGVSERVDLQARTLPGT---PVARPFVRKTNVESRNVTLTIQ------CLDCMDREKMKGKLLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHN-GVKSGPQDSVSCKTKEVLPNPSTYIQVTEQ-KSNELSIHWDKALDKFG-PITGYVLELSVS----DQNSENENRIIK-------SEYDALTTNTVVRDLKSRTTYSISLYAKNSVG 787
            ++    LKP  +Y   ++AIN+ G S   D  +    GT   P   P + + ++    +T   +      CL+ MD     G    F+ ++              NG +IE +V NL+   NY F ++A N   +S   + V+  TK  LP+P   + V  +  S    + WD+  D  G P+  Y LEL ++    +Q   N + I+        + Y+ +      ++L   +     + AK+SVG
Sbjct:  720 TFKVSKLKPSTEYLIRLLAINSFGSSPWSDPLSVLTSGTAPLPPDPPSLARADIGGLLLTWKKRPTDETFCLEMMDEATGYG----FITVF--------------NGPEIEHYVENLRRNTNYRFHLAASNQDGRSKWSEVVTHSTKPDLPSPPQKLHVRGKVHSTNFVLVWDEPEDDGGLPVIAYKLELDINSICDNQAKANSDGIVNDSDCDWVNNYEGIEREYNCKNLTPGSMVLARVSAKSSVG 949          
The following BLAST results are available for this feature:
BLAST of SMED30034706 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTN45.824e-1122.04contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174][more]
CNTN47.622e-1122.04contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174][more]
CNTN47.622e-1122.04contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174][more]
CNTN47.622e-1122.04contactin 4 [Source:HGNC Symbol;Acc:HGNC:2174][more]
CNTN19.683e-1123.56contactin 1 [Source:HGNC Symbol;Acc:HGNC:2171][more]
back to top
BLAST of SMED30034706 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
let-8055.658e-923.47Myotactin form A [Source:UniProtKB/TrEMBL;Acc:Q9U... [more]
let-8056.319e-923.47Myotactin form A [Source:UniProtKB/TrEMBL;Acc:Q9U... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dscam41.151e-923.50gene:FBgn0263219 transcript:FBtr0333589[more]
Dscam41.151e-923.50gene:FBgn0263219 transcript:FBtr0333590[more]
sdk1.389e-926.89gene:FBgn0021764 transcript:FBtr0340197[more]
sdk1.417e-926.89gene:FBgn0021764 transcript:FBtr0340196[more]
sdk1.506e-926.89gene:FBgn0021764 transcript:FBtr0302259[more]
back to top
BLAST of SMED30034706 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa9.483e-1224.84protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprsa1.025e-1124.84protein tyrosine phosphatase receptor type Sa [Sou... [more]
ttn.26.959e-923.24titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.29.113e-923.24titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.11.012e-827.91titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema6d9.271e-1124.07semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
l1cam2.393e-1029.17L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam2.679e-1029.17L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam2.919e-1027.08L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam3.137e-1027.08L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cntn48.914e-1222.31contactin 4 [Source:MGI Symbol;Acc:MGI:1095737][more]
Cntn48.914e-1222.31contactin 4 [Source:MGI Symbol;Acc:MGI:1095737][more]
Ttn1.439e-825.38titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.774e-825.38titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.884e-825.38titin [Source:MGI Symbol;Acc:MGI:98864][more]
back to top
BLAST of SMED30034706 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q69Z26|CNTN4_MOUSE6.235e-1122.31Contactin-4 OS=Mus musculus OX=10090 GN=Cntn4 PE=1... [more]
sp|Q8IWV2|CNTN4_HUMAN3.660e-1022.04Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 ... [more]
sp|Q98902|L1CAM_TAKRU4.423e-1026.80Neural cell adhesion molecule L1 OS=Takifugu rubri... [more]
sp|Q12860|CNTN1_HUMAN5.656e-1023.56Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 ... [more]
sp|Q62845|CNTN4_RAT7.055e-1021.77Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4... [more]
back to top
BLAST of SMED30034706 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183MHE02.118e-1729.37Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A183R7I86.895e-1729.00Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A183NE807.428e-1729.00Uncharacterized protein OS=Schistosoma mattheei OX... [more]
G4V5I51.049e-1629.74Putative receptor protein tyrosine phosphatase OS=... [more]
A0A5K4ESA01.059e-1629.10Putative receptor protein tyrosine phosphatase OS=... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l1cama2.519e-1023.74L1 cell adhesion molecule, paralog a [Source:NCBI ... [more]
l1cama3.189e-1027.03L1 cell adhesion molecule, paralog a [Source:NCBI ... [more]
ENSAMXT00000056314.11.383e-821.68pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056255.14.228e-821.43pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
PTPRD5.151e-823.75protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam1b2.246e-1124.08neural cell adhesion molecule 1b [Source:ZFIN;Acc:... [more]
cntn3b1.806e-821.84contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
ENSPMAT00000002463.12.065e-822.76pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 ... [more]
ENSPMAT00000003347.19.625e-821.67pep scaffold:Pmarinus_7.0:GL478413:1221:29428:1 ge... [more]
ENSPMAT00000003337.11.546e-721.67pep scaffold:Pmarinus_7.0:GL478413:1212:29431:1 ge... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034706 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO469615.681e-821.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431895.936e-824.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412041.075e-723.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30034706 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l1cama1.550e-1224.66L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cama1.579e-1224.66L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
cntn43.463e-1122.06contactin-4-like [Source:NCBI gene;Acc:101167031][more]
cntn45.750e-1122.33contactin-4-like [Source:NCBI gene;Acc:101167031][more]
ENSORLT00000037609.15.941e-1123.96titin [Source:NCBI gene;Acc:101157365][more]
back to top
BLAST of SMED30034706 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000041505.10.000e+099.77SMESG000041505.1[more]
SMESG000041505.10.000e+099.77SMESG000041505.1[more]
SMESG000010713.19.246e-724.60SMESG000010713.1[more]
SMESG000010713.19.483e-724.60SMESG000010713.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034706 ID=SMED30034706|Name=SMED30034706|organism=Schmidtea mediterranea sexual|type=transcript|length=1317bp
GATATTTAATACGCACGCGAATATATTGTTTCACTCGTTCCACAAGTGTA
ATTGAAGGTTCAGGAGGATTTTCTCGATCCGTTTTCCCCATAATGACTAT
TGGTTTACTTATTCCAACACTATTTTTAGCATACAGACTGATACTATAAG
TTGTTCGACTTTTGAGATCCCTAACAACAGTATTCGTCGTCAATGCATCG
TATTCTGATTTTATTATTCTATTCTCATTTTCAGAATTCTGATCAGATAC
GCTTAACTCCAGAACATATCCAGTGATTGGACCAAATTTATCCAACGCTT
TATCCCAGTGAATGGATAATTCGTTCGATTTTTGTTCTGTAACCTGAATA
TAAGTAGATGGATTTGGTAGAACCTCTTTGGTTTTACACGATACCGAATC
CTGTGGACCAGATTTTACTCCATTGTGTGCCGAAACGAAGAAAGTGTAAT
TCTTATACGGTTTCAAATTTGTAACATGGACTTCAATGTCAGTTCCGTTG
TAATATGGGACTGTTAAGTTAAATTTGGAATATTCATCACTGTAAATTAT
CACAAACGATAGCAGTTTTCCTTTCATTTTTTCCCGATCCATACAATCCA
AACACTGAATAGTCAATGTCACATTTCGACTTTCAACATTGGTTTTACGA
ACAAAAGGTCGAGCTACTGGAGTTCCTGGCAGTGTTCGGGCTTGCAGATC
GACCCGTTCACTGACTCCTACATTGTTAATTGCAACAATCGATGCTCGAT
AATCAAAATATGGCTTTAGATTTTTAAAAGAATAACTAAACGTTGGATAA
TTCAAAGAAACTGTGTTGCATTCCTTTGTAATTAAGCTTTTACAAAGTGT
CAAATTGACTGAGCTTATTAAATTGGATAATGTTACATTGAAATCCCAGT
TAAATTTTAAAACCGAGTCTGATAATGACTCACATTTAAAATTATGAATT
CTAAACGGTGGACCTCGAACTAAAAGATTTATAGAAACTTGGTATAATAT
GTTTGGCCCCAAAGCTTTACATATATAAACTCGTGCATCAGAGTAGTCAA
TGTTTGTAATTATCAGCGATCCATTCCTACCACTAACAAATTTTTTATCA
GATATATCGACATCGATAGTACGTAATGGAGATGCAATAATAATTTCATC
GATATTTTTGAACCAAATAATAGTTTCAACACTAGGGTTACTCATTAAAG
CAGGACAATCTAATCTTATCGTTTTATTTAAAATTGCTATCTTATGAACT
GTTTCATTTAATATAGTAATATTAACATCAGTGTTATTACCATAAATTGG
TGGTGGTGAAATCCAAA
back to top

protein sequence of SMED30034706-orf-1

>SMED30034706-orf-1 ID=SMED30034706-orf-1|Name=SMED30034706-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
WISPPPIYGNNTDVNITILNETVHKIAILNKTIRLDCPALMSNPSVETII
WFKNIDEIIIASPLRTIDVDISDKKFVSGRNGSLIITNIDYSDARVYICK
ALGPNILYQVSINLLVRGPPFRIHNFKCESLSDSVLKFNWDFNVTLSNLI
SSVNLTLCKSLITKECNTVSLNYPTFSYSFKNLKPYFDYRASIVAINNVG
VSERVDLQARTLPGTPVARPFVRKTNVESRNVTLTIQCLDCMDREKMKGK
LLSFVIIYSDEYSKFNLTVPYYNGTDIEVHVTNLKPYKNYTFFVSAHNGV
KSGPQDSVSCKTKEVLPNPSTYIQVTEQKSNELSIHWDKALDKFGPITGY
VLELSVSDQNSENENRIIKSEYDALTTNTVVRDLKSRTTYSISLYAKNSV
GISKPIVIMGKTDRENPPEPSITLVERVKQYIRVRIKY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003599Ig_sub
IPR003961FN3_dom
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 22..117
e-value: 1.2E-4
score: 31.4
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 317..403
e-value: 5.2E-8
score: 42.6
coord: 117..202
e-value: 4.4
score: 14.6
coord: 213..303
e-value: 0.028
score: 23.6
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 321..404
e-value: 3.3E-10
score: 40.2
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 119..215
score: 12.079
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 216..315
score: 10.967
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 319..416
score: 16.142
IPR003961Fibronectin type IIICDDcd00063FN3coord: 216..312
e-value: 4.91627E-6
score: 42.8687
IPR003961Fibronectin type IIICDDcd00063FN3coord: 317..405
e-value: 8.32878E-12
score: 59.0471
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 110..209
e-value: 5.1E-6
score: 28.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 313..418
e-value: 3.2E-15
score: 58.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 18..109
e-value: 5.3E-10
score: 41.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 210..312
e-value: 5.0E-12
score: 47.7
NoneNo IPR availablePFAMPF13927Ig_3coord: 21..101
e-value: 3.9E-7
score: 30.6
NoneNo IPR availablePANTHERPTHR13817TITINcoord: 242..406
NoneNo IPR availablePANTHERPTHR13817:SF94coord: 242..406
NoneNo IPR availableCDDcd00096Igcoord: 33..101
e-value: 3.10006E-5
score: 39.9181
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 5..113
score: 7.903
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 26..120
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 119..235
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 226..406