ATPase inhibitor mai-2-like protein

Overview
NameATPase inhibitor mai-2-like protein
Smed IDSMED30034702
Length (bp)509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase inhibitor mai-2-like protein (SMED30034702) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase inhibitor mai-2-like protein (SMED30034702) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase inhibitor mai-2-like protein (SMED30034702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase inhibitor mai-2-like protein (SMED30034702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30034702h1SMcG0000933 dd_Smed_v4_1438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034702h1SMcG0000933 dd_Smed_v4_1438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034702h1SMcG0000933 dd_Smed_v4_1438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Human
Match: ATP5IF1 (ATP synthase inhibitory factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:871])

HSP 1 Score: 51.9878 bits (123), Expect = 8.768e-9
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A EE YF+   RE++ A+KK+ ++E+  H++EIE     IERHKQ+I
Sbjct:   46 AFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Human
Match: ATP5IF1 (ATP synthase inhibitory factor subunit 1 [Source:HGNC Symbol;Acc:HGNC:871])

HSP 1 Score: 51.9878 bits (123), Expect = 8.768e-9
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A EE YF+   RE++ A+KK+ ++E+  H++EIE     IERHKQ+I
Sbjct:   46 AFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Celegans
Match: mai-2 (ATPase inhibitor mai-2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O44441])

HSP 1 Score: 55.4546 bits (132), Expect = 1.715e-10
Identity = 24/54 (44.44%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK EAA E+EYF + ++ ++  +++++Q+E+K HE ++ENH   +ERH+QRI
Sbjct:   43 AFGKMEAAREDEYFYKKQKAQLQELREHIQEEVKHHEGQLENHKKVLERHQQRI 96          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Celegans
Match: mai-2 (ATPase inhibitor mai-2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O44441])

HSP 1 Score: 55.4546 bits (132), Expect = 1.715e-10
Identity = 24/54 (44.44%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK EAA E+EYF + ++ ++  +++++Q+E+K HE ++ENH   +ERH+QRI
Sbjct:   43 AFGKMEAAREDEYFYKKQKAQLQELREHIQEEVKHHEGQLENHKKVLERHQQRI 96          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Celegans
Match: mai-1 (ATPase inhibitor mai-1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P37209])

HSP 1 Score: 44.669 bits (104), Expect = 1.207e-6
Identity = 19/54 (35.19%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            S G   A  EEEYF+R ++++++ +KK L+ ++   ++EI +H   +E+H+QR+
Sbjct:   26 SLGMMGATREEEYFRRQQKDQLDNLKKKLEADMTQSQQEIRDHEKVLEQHQQRL 79          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Celegans
Match: mai-1 (ATPase inhibitor mai-1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P37209])

HSP 1 Score: 44.669 bits (104), Expect = 1.207e-6
Identity = 19/54 (35.19%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            S G   A  EEEYF+R ++++++ +KK L+ ++   ++EI +H   +E+H+QR+
Sbjct:   26 SLGMMGATREEEYFRRQQKDQLDNLKKKLEADMTQSQQEIRDHEKVLEQHQQRL 79          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Fly
Match: CG13551 (gene:FBgn0040660 transcript:FBtr0072033)

HSP 1 Score: 43.1282 bits (100), Expect = 9.841e-6
Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQ 376
            +FGK EAA EEEYF + +RE+++ +K     + + H ++I+ H +AI+RHK+
Sbjct:   49 AFGKLEAAREEEYFYKKQREQLDRLKNDQIHQAEFHHQQIKEHEEAIQRHKE 100          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Fly
Match: CG13551 (gene:FBgn0040660 transcript:FBtr0072034)

HSP 1 Score: 43.1282 bits (100), Expect = 9.841e-6
Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQ 376
            +FGK EAA EEEYF + +RE+++ +K     + + H ++I+ H +AI+RHK+
Sbjct:   49 AFGKLEAAREEEYFYKKQREQLDRLKNDQIHQAEFHHQQIKEHEEAIQRHKE 100          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Zebrafish
Match: atp5if1a (ATP synthase inhibitory factor subunit 1a [Source:NCBI gene;Acc:100037369])

HSP 1 Score: 50.0618 bits (118), Expect = 3.048e-8
Identity = 26/54 (48.15%), Postives = 40/54 (74.07%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            SFG+REAA EE YF++ ERE++ A+K + ++E+  H++EIE     I+RHK +I
Sbjct:   45 SFGRREAAEEERYFRQKEREQLAALKNHHEEEIDHHKKEIERLQREIDRHKGKI 98          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Zebrafish
Match: atp5if1b (ATP synthase inhibitory factor subunit 1b [Source:NCBI gene;Acc:558368])

HSP 1 Score: 48.1358 bits (113), Expect = 2.034e-7
Identity = 24/53 (45.28%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  224 FGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            FGK++AA EE YFKR E+E+++A++++ Q+E+  H++EIE     I RH+ +I
Sbjct:   48 FGKKQAAEEEMYFKRKEQEQLSALRRHHQEEIDHHKKEIERLQHEITRHESKI 100          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Zebrafish
Match: atp5if1b (ATP synthase inhibitory factor subunit 1b [Source:NCBI gene;Acc:558368])

HSP 1 Score: 48.1358 bits (113), Expect = 2.034e-7
Identity = 24/53 (45.28%), Postives = 40/53 (75.47%), Query Frame = 2
Query:  224 FGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            FGK++AA EE YFKR E+E+++A++++ Q+E+  H++EIE     I RH+ +I
Sbjct:   48 FGKKQAAEEEMYFKRKEQEQLSALRRHHQEEIDHHKKEIERLQHEITRHESKI 100          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Xenopus
Match: plbd2 (phospholipase B domain containing 2 [Source:Xenbase;Acc:XB-GENE-992746])

HSP 1 Score: 50.8322 bits (120), Expect = 2.837e-8
Identity = 25/54 (46.30%), Postives = 41/54 (75.93%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKR+AA EE YF++ E+E+I +++K+ ++E++ H+ EIE     IERHK +I
Sbjct:   50 AFGKRQAAEEERYFRQKEQEQIASLRKHHEEEIRHHKGEIERLQKEIERHKSKI 103          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Mouse
Match: Atpif1 (ATPase inhibitory factor 1 [Source:MGI Symbol;Acc:MGI:1196457])

HSP 1 Score: 48.9062 bits (115), Expect = 9.490e-8
Identity = 24/54 (44.44%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A E+ YF+   +E++ A++K+ +DE+  H +EIE     IERHK++I
Sbjct:   46 AFGKREKAEEDRYFREKTKEQLAALRKHHEDEIDHHSKEIERLQKQIERHKKKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Mouse
Match: Atpif1 (ATPase inhibitory factor 1 [Source:MGI Symbol;Acc:MGI:1196457])

HSP 1 Score: 47.7506 bits (112), Expect = 1.197e-7
Identity = 24/54 (44.44%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A E+ YF+   +E++ A++K+ +DE+  H +EIE     IERHK++I
Sbjct:   14 AFGKREKAEEDRYFREKTKEQLAALRKHHEDEIDHHSKEIERLQKQIERHKKKI 67          
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Match: sp|O44441|ATIF2_CAEEL (ATPase inhibitor mai-2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mai-2 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.181e-9
Identity = 24/54 (44.44%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK EAA E+EYF + ++ ++  +++++Q+E+K HE ++ENH   +ERH+QRI
Sbjct:   43 AFGKMEAAREDEYFYKKQKAQLQELREHIQEEVKHHEGQLENHKKVLERHQQRI 96          
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Match: sp|Q5RFJ9|ATIF1_PONAB (ATPase inhibitor, mitochondrial OS=Pongo abelii OX=9601 GN=ATP5IF1 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.211e-8
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A EE YF+   RE++ A+KK+ ++E+  H++EIE     IERHKQ+I
Sbjct:   46 AFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Match: sp|Q9UII2|ATIF1_HUMAN (ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.211e-8
Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A EE YF+   RE++ A+KK+ ++E+  H++EIE     IERHKQ+I
Sbjct:   46 AFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Match: sp|Q03344|ATIF1_RAT (ATPase inhibitor, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5if1 PE=3 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 9.308e-8
Identity = 26/54 (48.15%), Postives = 38/54 (70.37%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKRE A E+ YF+   RE++ A+KK+ +DE+  H +EIE     IERHK++I
Sbjct:   46 AFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKI 99          
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Match: sp|F7BK26|ATIF1_XENTR (ATPase inhibitor, mitochondrial OS=Xenopus tropicalis OX=8364 GN=atp5if1 PE=3 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.503e-7
Identity = 25/54 (46.30%), Postives = 41/54 (75.93%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGKR+AA EE YF++ E+E+I +++K+ ++E++ H+ EIE     IERHK +I
Sbjct:   50 AFGKRQAAEEERYFRQKEQEQIASLRKHHEEEIRHHKGEIERLQKEIERHKSKI 103          
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Match: W6U8R2 (SET and MYND domain-containing protein 4 OS=Echinococcus granulosus OX=6210 GN=EGR_08305 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.094e-10
Identity = 60/109 (55.05%), Postives = 71/109 (65.14%), Query Frame = 2
Query:   65 STLIFNTAFRVRIIPNNHRYISIMKAV-------YSGNDLXXXXXXXXXXXXXXXXXXXSFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERH 370
            S   F  AF  R  P   + I I+K V       Y G++LGRG  KGGGKGG +RDAGGSFGKREAA EEEYF R + E+I  +KK+L  E+K HEE+IE H  AIERH
Sbjct:  653 SGFAFIPAFLRRANP---KSIDILKPVVIGCYRMYPGDELGRGVSKGGGKGGPVRDAGGSFGKREAALEEEYFHRKDLEQIKELKKHLVAEVKFHEEQIERHKAAIERH 758          
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Match: A0A4S2MDF4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000802 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.166e-9
Identity = 52/104 (50.00%), Postives = 75/104 (72.12%), Query Frame = 2
Query:  101 IIPNNHRYIS-----IMKA-------VYSGNDLXXXXXXXXXXXXXXXXXXXSFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQ 376
            ++PN  R ++     I+K        +Y G++LGRG GKGGG GG IRDAGG FGKREA HEEEYF R E+E++ A+KK+L++E++  ++EIE H +AI+RH++
Sbjct:    8 VLPNEFRSLTNDRTNILKPAVIGCIRMYPGDELGRGAGKGGGGGGPIRDAGGPFGKREAKHEEEYFHRKEKEQLKALKKHLEEEMQYRKDEIERHKEAIQRHQK 111          
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Match: A0A0M3HRK6 (Uncharacterized protein OS=Ascaris lumbricoides OX=6252 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.397e-9
Identity = 27/54 (50.00%), Postives = 45/54 (83.33%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK EAA EE+YF+++++E+I A+++ L+ E++ HE++ +NH D I+RHKQRI
Sbjct:   29 AFGKMEAAREEQYFRKLQKEQIKALQEQLKKEIEHHEQQAKNHEDTIQRHKQRI 82          
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Match: A0A267E948 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023931g2 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 2.574e-9
Identity = 28/54 (51.85%), Postives = 44/54 (81.48%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK EAA EEEYF+R++ E+++ +K++L+DE+  HE+EI  H +AI+RHK R+
Sbjct:  107 TFGKMEAAREEEYFRRLQNEQLSKLKEHLEDEVDHHEKEIVRHLEAIQRHKSRM 160          
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Match: V4B411 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236756 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.987e-9
Identity = 28/54 (51.85%), Postives = 44/54 (81.48%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            SFGK EAAHEE+YF++++ E++  MK++L +E++ HE  I+ H ++IERHK+RI
Sbjct:   48 SFGKMEAAHEEQYFRKLQAEQLKKMKEHLGEEIEHHERSIKQHKESIERHKKRI 101          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Nematostella
Match: EDO33447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS84])

HSP 1 Score: 54.299 bits (129), Expect = 4.057e-10
Identity = 23/54 (42.59%), Postives = 43/54 (79.63%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            +FGK E AHEE+YF++M+ +++ A+K++ +  + +H++EIE+H +AI RHK+ +
Sbjct:   54 AFGKMEQAHEEQYFRQMQAQQLAALKEHQEHLIATHKQEIEHHEEAIRRHKEAL 107          
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Medaka
Match: atp5if1b (ATPase inhibitor B, mitochondrial [Source:NCBI gene;Acc:101166514])

HSP 1 Score: 47.3654 bits (111), Expect = 3.025e-7
Identity = 24/54 (44.44%), Postives = 40/54 (74.07%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            + GKR+AA EE YFKR E+E++ A++++ ++E+  H++EIE     I+RHK +I
Sbjct:   47 AMGKRQAAEEELYFKRKEKEQLAALRQHHEEEIDHHKKEIERLQRDIDRHKGKI 100          
BLAST of ATPase inhibitor mai-2-like protein vs. Planmine SMEST
Match: SMESG000074861.1 (SMESG000074861.1)

HSP 1 Score: 188.348 bits (477), Expect = 3.015e-62
Identity = 114/115 (99.13%), Postives = 114/115 (99.13%), Query Frame = 2
Query:   38 MQNLNFLKLSTLIFNTAFRVRIIPNNHRYISIMKAVYSGNDLXXXXXXXXXXXXXXXXXXXSFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            MQNLNFLKLSTLIFNTAFRVRIIPNNHRYISIMKAVYSGNDLGRGDGKGGGKGGAIRDAGGSFGKREAAHEEEYFKRMEREKIN MKKYLQDELKSHEEEIENHTDAIERHKQRI
Sbjct:    1 MQNLNFLKLSTLIFNTAFRVRIIPNNHRYISIMKAVYSGNDLGRGDGKGGGKGGAIRDAGGSFGKREAAHEEEYFKRMEREKINGMKKYLQDELKSHEEEIENHTDAIERHKQRI 115          
BLAST of ATPase inhibitor mai-2-like protein vs. Planmine SMEST
Match: SMESG000074861.1 (SMESG000074861.1)

HSP 1 Score: 120.939 bits (302), Expect = 5.094e-36
Identity = 82/83 (98.80%), Postives = 82/83 (98.80%), Query Frame = 2
Query:  134 MKAVYSGNDLXXXXXXXXXXXXXXXXXXXSFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            MKAVYSGNDLGRGDGKGGGKGGAIRDAGGSFGKREAAHEEEYFKRMEREKIN MKKYLQDELKSHEEEIENHTDAIERHKQRI
Sbjct:    1 MKAVYSGNDLGRGDGKGGGKGGAIRDAGGSFGKREAAHEEEYFKRMEREKINGMKKYLQDELKSHEEEIENHTDAIERHKQRI 83          
BLAST of ATPase inhibitor mai-2-like protein vs. Planmine SMEST
Match: SMESG000046687.1 (SMESG000046687.1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.720e-11
Identity = 27/54 (50.00%), Postives = 41/54 (75.93%), Query Frame = 2
Query:  221 SFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEEIENHTDAIERHKQRI 382
            SFGKREA  EEEYF+++   K+  +K+ L+DE+ +H  EIE H +AI+RHK+++
Sbjct:   55 SFGKREAYLEEEYFRKLNENKVKELKEQLEDEVDTHVHEIEKHEEAIKRHKRKV 108          
The following BLAST results are available for this feature:
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ATP5IF18.768e-950.00ATP synthase inhibitory factor subunit 1 [Source:H... [more]
ATP5IF18.768e-950.00ATP synthase inhibitory factor subunit 1 [Source:H... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mai-21.715e-1044.44ATPase inhibitor mai-2, mitochondrial [Source:Uni... [more]
mai-21.715e-1044.44ATPase inhibitor mai-2, mitochondrial [Source:Uni... [more]
mai-11.207e-635.19ATPase inhibitor mai-1, mitochondrial [Source:Uni... [more]
mai-11.207e-635.19ATPase inhibitor mai-1, mitochondrial [Source:Uni... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG135519.841e-642.31gene:FBgn0040660 transcript:FBtr0072033[more]
CG135519.841e-642.31gene:FBgn0040660 transcript:FBtr0072034[more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp5if1a3.048e-848.15ATP synthase inhibitory factor subunit 1a [Source:... [more]
atp5if1b2.034e-745.28ATP synthase inhibitory factor subunit 1b [Source:... [more]
atp5if1b2.034e-745.28ATP synthase inhibitory factor subunit 1b [Source:... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
plbd22.837e-846.30phospholipase B domain containing 2 [Source:Xenbas... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Atpif19.490e-844.44ATPase inhibitory factor 1 [Source:MGI Symbol;Acc:... [more]
Atpif11.197e-744.44ATPase inhibitory factor 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O44441|ATIF2_CAEEL2.181e-944.44ATPase inhibitor mai-2, mitochondrial OS=Caenorhab... [more]
sp|Q5RFJ9|ATIF1_PONAB4.211e-850.00ATPase inhibitor, mitochondrial OS=Pongo abelii OX... [more]
sp|Q9UII2|ATIF1_HUMAN4.211e-850.00ATPase inhibitor, mitochondrial OS=Homo sapiens OX... [more]
sp|Q03344|ATIF1_RAT9.308e-848.15ATPase inhibitor, mitochondrial OS=Rattus norvegic... [more]
sp|F7BK26|ATIF1_XENTR1.503e-746.30ATPase inhibitor, mitochondrial OS=Xenopus tropica... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6U8R23.094e-1055.05SET and MYND domain-containing protein 4 OS=Echino... [more]
A0A4S2MDF41.166e-950.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0M3HRK61.397e-950.00Uncharacterized protein OS=Ascaris lumbricoides OX... [more]
A0A267E9482.574e-951.85Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
V4B4112.987e-951.85Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO334474.057e-1042.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp5if1b3.025e-744.44ATPase inhibitor B, mitochondrial [Source:NCBI gen... [more]
back to top
BLAST of ATPase inhibitor mai-2-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000074861.13.015e-6299.13SMESG000074861.1[more]
SMESG000074861.15.094e-3698.80SMESG000074861.1[more]
SMESG000046687.13.720e-1150.00SMESG000046687.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034702 ID=SMED30034702|Name=ATPase inhibitor mai-2-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=509bp
CTGTCTAACAGAAATCAGGAGCTAAAATTTAATTGAAATGCAAAATTTGA
ATTTTCTTAAACTTTCTACGTTAATTTTTAATACAGCCTTTCGAGTAAGA
ATTATACCAAATAATCATCGATATATTTCCATAATGAAAGCAGTTTATAG
TGGAAATGATTTAGGAAGAGGTGACGGCAAAGGCGGAGGAAAAGGTGGCG
CAATTCGTGATGCAGGTGGTTCATTCGGTAAGAGAGAAGCTGCACATGAA
GAAGAGTATTTTAAACGAATGGAGCGAGAAAAAATTAACGCCATGAAAAA
ATATCTTCAAGATGAATTGAAAAGCCATGAAGAAGAAATTGAAAATCATA
CAGACGCCATAGAACGTCACAAGCAACGAATCAAAGAAATCAAAGAAGTT
GTCGGCAAAAAATAAAAACTCATTTTATCTGCCTTTATTTAGTAAATATA
AATTTATTAGTGCATGAAAGAACTAAAGCTTCTGTCGTAATAATTATTTA
TTTATACAA
back to top

protein sequence of SMED30034702-orf-1

>SMED30034702-orf-1 ID=SMED30034702-orf-1|Name=SMED30034702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MQNLNFLKLSTLIFNTAFRVRIIPNNHRYISIMKAVYSGNDLGRGDGKGG
GKGGAIRDAGGSFGKREAAHEEEYFKRMEREKINAMKKYLQDELKSHEEE
IENHTDAIERHKQRIKEIKEVVGKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR007648ATPase_inhibitor_mt
Vocabulary: biological process
TermDefinition
GO:0032780negative regulation of ATPase activity
Vocabulary: molecular function
TermDefinition
GO:0042030ATPase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 80..121
NoneNo IPR availableGENE3DG3DSA:1.20.5.500coord: 43..107
e-value: 5.7E-22
score: 79.4
NoneNo IPR availablePANTHERPTHR23407ATPASE INHIBITOR/5-FORMYLTETRAHYDROFOLATE CYCLO-LIGASEcoord: 37..119
NoneNo IPR availablePANTHERPTHR23407:SF6ATPASE INHIBITOR, MITOCHONDRIALcoord: 37..119
NoneNo IPR availableSUPERFAMILYSSF64602F1 ATPase inhibitor, IF1, C-terminal domaincoord: 60..120
IPR007648Mitochondrial ATPase inhibitorPFAMPF04568IATPcoord: 31..110
e-value: 2.6E-23
score: 82.3