Testis-specific Y-encoded-like protein 1

Overview
NameTestis-specific Y-encoded-like protein 1
Smed IDSMED30034697
Length (bp)918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Testis-specific Y-encoded-like protein 1 (SMED30034697) t-SNE clustered cells

Violin plots show distribution of expression levels for Testis-specific Y-encoded-like protein 1 (SMED30034697) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Testis-specific Y-encoded-like protein 1 (SMED30034697) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Testis-specific Y-encoded-like protein 1 (SMED30034697) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034697

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034697SMESG000027817.1 SMESG000027807.1 SmedASXL_004275SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30034697SMESG000027817.1 SMESG000027807.1 SmedASXL_004275SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v4_393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034697SMESG000027817.1 SMESG000027807.1 Contig51317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034697SMESG000027817.1 SMESG000027807.1 Contig51317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30034697SMESG000027817.1 SMESG000027807.1 dd_Smed_v6_393_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30034697SMESG000027817.1 SMESG000027807.1 H.96.10csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30034697SMESG000027817.1 SMESG000027807.1 H.96.10csmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 210.69 bits (535), Expect = 1.965e-66
Identity = 114/219 (52.05%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            A A K+SK +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 APAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 208.764 bits (530), Expect = 9.345e-66
Identity = 108/194 (55.67%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL 
Sbjct:   18 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 211          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 208.379 bits (529), Expect = 1.021e-65
Identity = 108/194 (55.67%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL 
Sbjct:   17 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 210          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 208.379 bits (529), Expect = 1.156e-65
Identity = 108/194 (55.67%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL 
Sbjct:   20 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 213          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Match: SET (SET nuclear proto-oncogene [Source:HGNC Symbol;Acc:HGNC:10760])

HSP 1 Score: 209.149 bits (531), Expect = 1.349e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   42 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 234          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Celegans
Match: spr-2 (Suppressor of presenilin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18240])

HSP 1 Score: 142.124 bits (357), Expect = 5.914e-40
Identity = 78/196 (39.80%), Postives = 117/196 (59.69%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSA------EAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ++E + ++D +Q+Q+DV++E A+EE+LKVEQ +N+ R P YEKR  L  +I +FW  AF+NH   S  I +E E +L  L +L V+E ED++SG+KII TF  N YF N V+TK +++     ++E T+IEW   K    K  + +   +        A+ DS             D+  EVIKDDL+ NP+QYY+
Sbjct:   27 VKEKLIELDAIQHQLDVMSENAAEEVLKVEQIFNQKRLPIYEKRKKLTTKIDNFWQTAFLNHHLLSTAIPEEQEDLLAALRDLEVQEFEDLRSGFKIIMTFDPNEYFTNEVITKSYHLQSESPSTEITEIEWKENKKPPFKPEDGDSAHTFLEWLTYAALPDS-------------DEIAEVIKDDLYVNPLQYYV 209          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Celegans
Match: spr-2 (Suppressor of presenilin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18240])

HSP 1 Score: 141.354 bits (355), Expect = 1.223e-39
Identity = 78/195 (40.00%), Postives = 118/195 (60.51%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWY-----PGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ++E + ++D +Q+Q+DV++E A+EE+LKVEQ +N+ R P YEKR  L  +I +FW  AF+NH   S  I +E E +L  L +L V+E ED++SG+KII TF  N YF N V+TK +++     ++E T+IEW      P  +    +H   +  +  A+ DS             D+  EVIKDDL+ NP+QYY+
Sbjct:   27 VKEKLIELDAIQHQLDVMSENAAEEVLKVEQIFNQKRLPIYEKRKKLTTKIDNFWQTAFLNHHLLSTAIPEEQEDLLAALRDLEVQEFEDLRSGFKIIMTFDPNEYFTNEVITKSYHLQSESPSTEITEIEWKENKKPPFPEDGDSAHTFLEWLTYAALPDS-------------DEIAEVIKDDLYVNPLQYYV 208          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Celegans
Match: nap-1 (Nucleosome Assembly Protein [Source:UniProtKB/TrEMBL;Acc:Q19007])

HSP 1 Score: 58.5362 bits (140), Expect = 1.329e-9
Identity = 31/76 (40.79%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  247 KQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA 474
            K I  FW  A   H   +  I + D  IL YL ++    S+D  +G+KI F FA+NPYFKN VLTK + +  + +A
Sbjct:  111 KGIKDFWLTALRTHDLVAEAIEEHDVPILSYLTDVTTAASKD-PAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDA 185          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Fly
Match: Set (gene:FBgn0014879 transcript:FBtr0083062)

HSP 1 Score: 185.267 bits (469), Expect = 5.971e-57
Identity = 114/229 (49.78%), Postives = 154/229 (67.25%), Query Frame = 1
Query:   46 MASAEKISKVD---------AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVN-----ENGE--ASESTKIEWYPG----KDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            M+S  K +K+D         A   N+    E +E+ID  QN++D LNEKASEEILKVEQKYN++R+P YEKRS L+K+IP+FW  +F+NHPQ S ++ +E+E+ L  L  L V+E EDIKSGY+I F F  NPYF+N VLTK+F++N     ENG+  AS ST I+W  G    K +  K +  +KKR++E    +FF++F DNT    D+  E+IKDDLW NP+QYYL
Sbjct:    1 MSSVPKRAKLDGAPADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSE--YKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Fly
Match: CG3708 (gene:FBgn0040345 transcript:FBtr0331301)

HSP 1 Score: 50.0618 bits (118), Expect = 1.318e-6
Identity = 33/143 (23.08%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  172 EEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNT--VLTKQFNVNENGEA-------------SESTKIEWYPGKDVTAKSHNKEKKRSA 555
            EE+ ++ QK   +        S     +P FW   F N P  S ++ D DE +LE L ++ +   +D    Y +IF F  N +  ++  +LTK++ +  + +               E   I W  G ++T ++    ++  A
Sbjct:  146 EELRQLRQKLAPV--------SPTTLGVPRFWLTVFQNVPLLSELVQDHDEPLLESLMDVRLAYDQD---SYMVIFQFRPNSFLHDSSLLLTKRYFLQHSADPEYPFLFEGPEIVRCEGCHIHWRDGSNLTLQTVESRRRNRA 277          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Match: seta (SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-030131-2221])

HSP 1 Score: 209.149 bits (531), Expect = 4.135e-66
Identity = 115/220 (52.27%), Postives = 155/220 (70.45%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDVN-------IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNKE----KKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ASA K+SK +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  N YF+N VL+K+ ++NE+G+  S+ST+I+W PGKD+T++S   +    KKR  E  +  F  F D   +G  D+ GEVIKDD+W NP+QYYL
Sbjct:    3 ASAAKVSKKELNSNHDGGDETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENMYFENKVLSKEIHLNESGDPTSKSTEIKWKPGKDLTSRSSQTQSKAGKKRQHEEPESFFTWFTDHADSG-ADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 209.149 bits (531), Expect = 5.125e-66
Identity = 113/219 (51.60%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDV---TAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ASA K+S+ +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N V +K+F++NE+G+ +S+ST+I+W  GKD+   T ++ NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTEIKWKAGKDLTKRTGQTPNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 208.764 bits (530), Expect = 1.133e-65
Identity = 113/219 (51.60%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSH---NKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ASA K+S+ +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N V +K+F++NE+G+ +S+ST+I+W  GKD+T ++    NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTEIKWKAGKDLTKRTGQTPNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Match: tspy (testis specific protein Y-linked [Source:ZFIN;Acc:ZDB-GENE-030131-9158])

HSP 1 Score: 116.701 bits (291), Expect = 6.646e-29
Identity = 60/191 (31.41%), Postives = 116/191 (60.73%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            +++ +  + +VQ ++D L +K +    ++E K +  R+P+ ++RS + + +P FW  A +NHP  SA I + DE  L Y+ NL ++  ++ K GY+I F F  NP+F+N ++ K+ ++   G   S S  I W+ G+++       E +R+++ +  SFF++F D++    DD  +++++DL+ NP++YYL
Sbjct:  225 VRQSVALLAQVQMRLDALEKKGARLHQRLEMKLSRQRRPHLDQRSAITQAVPGFWVTALLNHPHLSAHIDETDEDALSYMTNLEIESFKNNKLGYRICFHFRRNPFFQNKMIVKELHLGMGGSPVSFSNPILWHRGQNLVGSG---EPRRTSQGVYQSFFHWFSDHSNPGRDDIAQILREDLYRNPLRYYL 412          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Match: nap1l4b (nucleosome assembly protein 1-like 4b [Source:ZFIN;Acc:ZDB-GENE-041114-168])

HSP 1 Score: 56.225 bits (134), Expect = 1.750e-8
Identity = 34/105 (32.38%), Postives = 50/105 (47.62%), Query Frame = 1
Query:  247 KQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENL-VVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-------------SESTKIEWYPGKDVT 519
            K IP FW   F +    S ++ + DE IL++L ++ V+    D    + + F F  N YF NTVLTK + +    +A              E  +I+W  GKDVT
Sbjct:  139 KGIPEFWLTIFRSVDMLSDMLQEHDEPILKHLHDIKVIFSGPDQPMSFTLEFHFEPNEYFTNTVLTKVYKMKSEPDADDPFSFEGPEIIDCEGCEIDWQKGKDVT 243          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 210.69 bits (535), Expect = 1.460e-66
Identity = 114/219 (52.05%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            A A K+SK +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 APAAKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 211.075 bits (536), Expect = 1.571e-66
Identity = 114/219 (52.05%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            A A K+SK +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 APAAKVSKKEVNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Match: bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1 [Source:Xenbase;Acc:XB-GENE-957116])

HSP 1 Score: 208.764 bits (530), Expect = 1.093e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   36 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 228          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Match: os9 (osteosarcoma amplified 9, endoplasmic reticulum lectin [Source:Xenbase;Acc:XB-GENE-5952460])

HSP 1 Score: 137.117 bits (344), Expect = 3.019e-36
Identity = 72/187 (38.50%), Postives = 116/187 (62.03%), Query Frame = 1
Query:  115 IEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ++ ++ +Q ++  +NE+A    L+++++Y  +R+P+ +KR+++I++IP FW  AF+NHPQ SA+I D DE  L Y+ NL V++    K+  KI F F  NPYFKN V+ K+F    +G   S ST I W+ G++   +      K S  A   SFF++F D++    D    +IK+DLW NP++YYL
Sbjct:  193 LQALESIQKELRAVNERADRAFLQLKRRYGHLRRPHIQKRNDIIRKIPGFWVTAFLNHPQLSAMIDDRDEDTLSYMNNLQVEDFTHTKASCKIKFYFNPNPYFKNEVIIKEFQYGSSGRLVSRSTPIRWWRGQNPAYRG-----KSSGSAP--SFFSWFSDHSFPAADRIAAIIKEDLWPNPLEYYL 372          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Match: nap1l1 (nucleosome assembly protein 1 like 1 [Source:NCBI gene;Acc:407956])

HSP 1 Score: 54.299 bits (129), Expect = 8.195e-8
Identity = 46/196 (23.47%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLI-------------------------------------------KQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKS-GYKIIFTFASNPYFKNTVLTKQFNVNENGEASE-------------STKIEWYPGKDVT 519
            ++  +  +  +Q +   +  K  EE+ ++E+KY  + QP ++KRS++I                                           K IP FW   F N    S ++ + DE IL++L+++ VK SE  +   + + F F  N +F N VLTK + +    + S+                I+W  GK+VT
Sbjct:   84 VKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLFDKRSDIINATYEPTEEECEWKVDEEEDISGDLKDKAKLEEEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSEAGQPMSFTLEFHFEPNDFFTNEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCLIDWKKGKNVT 279          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 208.764 bits (530), Expect = 7.455e-66
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   29 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 208.764 bits (530), Expect = 1.140e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   41 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 181.8 bits (460), Expect = 4.103e-56
Identity = 88/150 (58.67%), Postives = 119/150 (79.33%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNKEKKRS 552
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S   + K S
Sbjct:   41 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKAS 190          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Match: Set (SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:1860267])

HSP 1 Score: 149.058 bits (375), Expect = 3.106e-44
Identity = 71/111 (63.96%), Postives = 89/111 (80.18%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVL 438
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL
Sbjct:   41 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVL 151          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Match: Tspyl3 (TSPY-like 3 [Source:MGI Symbol;Acc:MGI:2139328])

HSP 1 Score: 133.265 bits (334), Expect = 3.862e-36
Identity = 68/191 (35.60%), Postives = 113/191 (59.16%), Query Frame = 1
Query:  112 IIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSH-NKEKKRS--AEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            I++ ++ +Q +++ ++ +A    L++ +++  +R+ +  +RS +I+ IP FW  AF+NHPQ SA+I+  DE +L YL NL V+E    ++G K  F F SNPYF+N V+ K++    +G   S +T+I W+ G++  A  H N++  RS  +   Q S             D   ++IKDDLW NP+QYYL
Sbjct:  124 IVDPLEAIQWELEAMSAQADGAHLQLVRRFGRMRRLHLARRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLGYLMNLEVRELRHSRTGCKFKFLFESNPYFRNEVIVKEYECRASGGVVSIATRILWHRGQEPPALVHRNRDAVRSFFSWFSQHSLLE---------ADRVAQIIKDDLWPNPLQYYL 305          
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Match: sp|Q01105|SET_HUMAN (Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3)

HSP 1 Score: 209.149 bits (531), Expect = 6.479e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   42 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 234          
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9EQU5|SET_MOUSE (Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 7.977e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   41 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Match: sp|Q63945|SET_RAT (Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 9.082e-65
Identity = 108/193 (55.96%), Postives = 147/193 (76.17%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   41 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 233          
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Match: sp|P0DME0|SETLP_HUMAN (Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 4.579e-60
Identity = 105/193 (54.40%), Postives = 143/193 (74.09%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ SEEILKVEQKYN++RQP+++KRS LI +IP+F    F+NHPQ S+++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N V +K+F++NE+G+ +S+STKI+W  GKDVT +S    NK  ++      +SFF +F D++    D+  EVIKDD+W NP+QYYL
Sbjct:   52 QEAIEHIDEVQNEIDRLNEQDSEEILKVEQKYNKLRQPFFQKRSELIAKIPNFGVTTFVNHPQVSSLLGEEDEEALHYLTKVEVTEFEDIKSGYRIDFYFDENPYFENKVFSKEFHLNESGDPSSKSTKIKWKSGKDVTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELEEVIKDDIWPNPLQYYL 244          
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Match: sp|P53997|SET_DROME (Protein SET OS=Drosophila melanogaster OX=7227 GN=Set PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 5.985e-56
Identity = 114/229 (49.78%), Postives = 154/229 (67.25%), Query Frame = 1
Query:   46 MASAEKISKVD---------AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVN-----ENGE--ASESTKIEWYPG----KDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            M+S  K +K+D         A   N+    E +E+ID  QN++D LNEKASEEILKVEQKYN++R+P YEKRS L+K+IP+FW  +F+NHPQ S ++ +E+E+ L  L  L V+E EDIKSGY+I F F  NPYF+N VLTK+F++N     ENG+  AS ST I+W  G    K +  K +  +KKR++E    +FF++F DNT    D+  E+IKDDLW NP+QYYL
Sbjct:    1 MSSVPKRAKLDGAPADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSE--YKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYL 227          
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Match: A0A3S1B9G3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_009283 PE=3 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.690e-69
Identity = 120/219 (54.79%), Postives = 165/219 (75.34%), Query Frame = 1
Query:   46 MASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHN-KEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MA+A K+SK D + ++D          QE IE+IDEVQN++D LNE ASEEILKVEQKYN +RQPY++KRS+LI +IP+FW  AF+NHPQ SA++ ++DE+ L+YL  + V+E EDIKSGY+I F F  NPYF N +LTK+F++N+ G+ +SEST I+W  GKD+T K++N K+ K+ +   Q+SFF++F D+     D+ GEVIKDD+W NP+QYYLA
Sbjct:    1 MATAPKVSKTDGKNNHDAADEQADKEQQEAIEQIDEVQNEIDKLNENASEEILKVEQKYNTLRQPYFKKRSDLIAKIPNFWVTAFVNHPQVSALLNEDDEEALQYLTKVEVQEFEDIKSGYRINFYFDKNPYFTNDMLTKEFHLNDTGDPSSESTAIKWNEGKDLTKKTNNGKQGKKRSHEDQESFFSWFGDHGDAGADELGEVIKDDIWPNPLQYYLA 219          
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Match: A0A4S2M319 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003064 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 1.410e-67
Identity = 119/220 (54.09%), Postives = 162/220 (73.64%), Query Frame = 1
Query:   46 MASAEKISKVD----AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNK----EKKRSAE-AMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MA+  K+ +      A GD   +   II++I+EVQN +D LNE+ASEEILKVEQK+N++RQP++EKRS LI +IP+FW  AF+NHPQ S ++T  DE +L+YL  + V+E EDIKSG++I F F  N +FKN VLTK+F++ + GE +S+ TKIEWYPGKD+TAK+  K    +KKR+ E   QDSFF +F D ++ + D+ GEVIKDDLW NP+QYYL+
Sbjct:    1 MATQPKVPRASNDSGADGDMGASTNAIIDEIEEVQNAIDNLNEQASEEILKVEQKFNKMRQPHFEKRSELIAKIPNFWLTAFVNHPQLSDLLTTTDEAVLKYLRKVEVQEFEDIKSGFQINFHFDKNEWFKNPVLTKEFHLGDTGEPSSKYTKIEWYPGKDLTAKAGKKNNGEQKKRAFEDQSQDSFFCWFTDESSAFGDELGEVIKDDLWPNPLQYYLS 220          
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Match: A0A4S2M8E3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001920 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.270e-67
Identity = 119/220 (54.09%), Postives = 162/220 (73.64%), Query Frame = 1
Query:   46 MASAEKISKVD----AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNK----EKKRSAE-AMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MA+  K+ +      A GD   +   II++I+EVQN +D LNE+ASEEILKVEQK+N++RQP++EKRS LI +IP+FW  AF+NHPQ S ++T  DE +L+YL  + V+E EDIKSG++I F F  N +FKN VLTK+F++ + GE +S+ TKIEWYPGKD+TAK+  K    +KKR+ E   QDSFF +F D ++ + D+ GEVIKDDLW NP+QYYL+
Sbjct:    1 MATQPKVPRASNDSGADGDMGASTNAIIDEIEEVQNAIDNLNEQASEEILKVEQKFNKMRQPHFEKRSELIAKIPNFWLTAFVNHPQLSDLLTTTDEAVLKYLRKVEVQEFEDIKSGFQINFHFDKNEWFKNPVLTKEFHLGDTGEPSSKYTKIEWYPGKDLTAKAGKKNNGEQKKRAFEDQSQDSFFCWFTDESSAFGDELGEVIKDDLWPNPLQYYLS 220          
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Match: A0A074ZFX4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06562 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.270e-67
Identity = 119/220 (54.09%), Postives = 162/220 (73.64%), Query Frame = 1
Query:   46 MASAEKISKVD----AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNK----EKKRSAE-AMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MA+  K+ +      A GD   +   II++I+EVQN +D LNE+ASEEILKVEQK+N++RQP++EKRS LI +IP+FW  AF+NHPQ S ++T  DE +L+YL  + V+E EDIKSG++I F F  N +FKN VLTK+F++ + GE +S+ TKIEWYPGKD+TAK+  K    +KKR+ E   QDSFF +F D ++ + D+ GEVIKDDLW NP+QYYL+
Sbjct:    1 MATQPKVPRASNDSGADGDMGASTNAIIDEIEEVQNAIDNLNEQASEEILKVEQKFNKMRQPHFEKRSELIAKIPNFWLTAFVNHPQLSDLLTTTDEAVLKYLRKVEVQEFEDIKSGFQINFHFDKNEWFKNPVLTKEFHLGDTGEPSSKYTKIEWYPGKDLTAKAGKKNNGEQKKRAFEDQSQDSFFCWFTDESSAFGDELGEVIKDDLWPNPLQYYLS 220          
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Match: H2KT93 (Protein SET OS=Clonorchis sinensis OX=79923 GN=Set PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.270e-67
Identity = 119/220 (54.09%), Postives = 162/220 (73.64%), Query Frame = 1
Query:   46 MASAEKISKVD----AQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNK----EKKRSAE-AMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MA+  K+ +      A GD   +   II++I+EVQN +D LNE+ASEEILKVEQK+N++RQP++EKRS LI +IP+FW  AF+NHPQ S ++T  DE +L+YL  + V+E EDIKSG++I F F  N +FKN VLTK+F++ + GE +S+ TKIEWYPGKD+TAK+  K    +KKR+ E   QDSFF +F D ++ + D+ GEVIKDDLW NP+QYYL+
Sbjct:    1 MATQPKVPRASNDSGADGDMGASTNAIIDEIEEVQNAIDNLNEQASEEILKVEQKFNKMRQPHFEKRSELIAKIPNFWLTAFVNHPQLSDLLTTTDEAVLKYLRKVEVQEFEDIKSGFQINFHFDKNEWFKNPVLTKEFHLGDTGEPSSKYTKIEWYPGKDLTAKAGKKNNGEQKKRAFEDQSQDSFFCWFTDESSAFGDELGEVIKDDLWPNPLQYYLS 220          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 211.46 bits (537), Expect = 5.570e-67
Identity = 114/219 (52.05%), Postives = 158/219 (72.15%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVT---AKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ASA K+S+ +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T    ++ NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 ASAAKVSRKEQNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRAGQTQNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 208.764 bits (530), Expect = 1.397e-65
Identity = 108/194 (55.67%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVT---AKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T    ++ NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL 
Sbjct:   55 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKAGKDLTKRAGQTQNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 248          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Match: seta (SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-GENE-030131-2221])

HSP 1 Score: 204.527 bits (519), Expect = 2.817e-64
Identity = 112/219 (51.14%), Postives = 157/219 (71.69%), Query Frame = 1
Query:   49 ASAEKISKVDAQGDNDV-------NIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEAS-ESTKIEWYPGKDVT---AKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            ASA K+SK +   ++D          QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  N YF+N VL+K+ ++NE+G+ + +ST+I+W PGKD+T   +++ +K  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:    3 ASAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENMYFENKVLSKEIHLNESGDPTPKSTEIKWKPGKDLTNRPSQTQSKAGKKRQHEEPESFFTWFTDHSDSGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:103043256])

HSP 1 Score: 121.709 bits (304), Expect = 1.175e-30
Identity = 64/191 (33.51%), Postives = 117/191 (61.26%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            +++ +  + +VQ ++D L +K +    ++E K +  R+P+ ++R  + + IP FW  A +NHP  SA I + DE  L Y+ NL ++  ++ K GY+I F F  NP+F+N V+ K+ ++   G   S S  I W+ G+++     N E +R+A+ +  SFF++F D+++   D+  +++KDDL+ NP++YYL
Sbjct:  288 VRQSVSLLAQVQMRLDALEKKGARLHQRLELKLSRQRRPHLDQRGAITQTIPGFWVTALLNHPHLSAHIDENDEDALSYMTNLEIETFKNNKLGYRICFHFRRNPFFQNKVIVKELHLGMGGSPVSFSNPILWHRGQNLIG---NGEPRRTAQGVYQSFFHWFSDHSSPGRDEIAQILKDDLYRNPLRYYL 475          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:103043256])

HSP 1 Score: 120.939 bits (302), Expect = 2.861e-30
Identity = 64/191 (33.51%), Postives = 117/191 (61.26%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            +++ +  + +VQ ++D L +K +    ++E K +  R+P+ ++R  + + IP FW  A +NHP  SA I + DE  L Y+ NL ++  ++ K GY+I F F  NP+F+N V+ K+ ++   G   S S  I W+ G+++     N E +R+A+ +  SFF++F D+++   D+  +++KDDL+ NP++YYL
Sbjct:  288 VRQSVSLLAQVQMRLDALEKKGARLHQRLELKLSRQRRPHLDQRGAITQTIPGFWVTALLNHPHLSAHIDENDEDALSYMTNLEIETFKNNKLGYRICFHFRRNPFFQNKVIVKELHLGMGGSPVSFSNPILWHRGQNLIG---NGEPRRTAQGVYQSFFHWFSDHSSPGRDEIAQILKDDLYRNPLRYYL 475          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Sea Lamprey
Match: setb (SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-GENE-030131-433])

HSP 1 Score: 179.489 bits (454), Expect = 2.974e-56
Identity = 91/190 (47.89%), Postives = 132/190 (69.47%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            Q+ +E+ID  QN++D LNE+ASEEIL+VEQKYN +R+P+ E+RS LI++IP+FW  AF+NHPQ S +I + DE+   ++  L V+E EDIKSGY+I   FA NPYF+N ++TK+F++   G+  S+ST I W  G ++T + H     +  +    SFF +F D+     D+  EV+KDD+W NP+QYYL
Sbjct:    3 QKALEEIDACQNEIDALNEQASEEILRVEQKYNRLRKPHLEQRSELIRKIPNFWLTAFLNHPQISPLIDETDEEAFHHMTKLEVEEFEDIKSGYRIKLHFAENPYFENDIVTKEFHLGSAGKPVSQSTPIRWKAGMELT-RQHPPADTKGHKRGHSSFFMWFGDHNDPTSDEVAEVLKDDMWPNPLQYYL 191          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Sea Lamprey
Match: nap1l1 (nucleosome assembly protein 1-like 1 [Source:ZFIN;Acc:ZDB-GENE-030516-2])

HSP 1 Score: 54.299 bits (129), Expect = 1.169e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 1
Query:  253 IPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESE-DIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIE 495
            IP FW   F N    S ++ + DE IL +L ++ VK SE  I   + + F F+ N YF N VLTK + +    +AS+    E
Sbjct:  132 IPEFWLTVFRNVDLLSDMVQEHDEPILRHLHDIKVKFSEQGIPMSFTLDFCFSPNEYFTNAVLTKTYVMKSEPDASDPFSFE 213          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Yeast
Match: NAP1 (Histone chaperone; involved in histone exchange by removing and replacing histone H2A-H2B dimers or histone variant dimers from assembled nucleosomes; involved in the transport of H2A and H2B histones to the nucleus; required for the regulation of microtubule dynamics during mitosis; interacts with mitotic cyclin Clb2p; controls bud morphogenesis; phosphorylated by CK2; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001756])

HSP 1 Score: 63.1586 bits (152), Expect = 1.014e-11
Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 1
Query:  244 IKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTF--ASNPYFKNTVLTKQF 450
            +K IP FW  A  N P     ITD D ++LEYL+++ ++   D + G+K++F F  ++NP+F N +L K +
Sbjct:  182 VKGIPSFWLTALENLPIVCDTITDRDAEVLEYLQDIGLEYLTDGRPGFKLLFRFDSSANPFFTNDILCKTY 252          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Nematostella
Match: EDO44259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW70])

HSP 1 Score: 189.889 bits (481), Expect = 2.937e-59
Identity = 101/205 (49.27%), Postives = 140/205 (68.29%), Query Frame = 1
Query:   61 KISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            K+  VD    N    Q+II++ID+VQNQ+D LNE+ASEEIL+VEQKYN  R+P++  R+NLIK+IP+FW   F+NHPQ   ++ ++DE++L+Y+  + V+E EDIKSGYKI F F  NPYF N  + K+F +N+NGE  S ST I+W  G D+T +     K R  +    SFF +F D      D+ GE+IKDD+W NP+QYY+
Sbjct:   13 KVEVVDGAEGNMSAHQDIIDQIDQVQNQIDSLNEEASEEILRVEQKYNAKRRPHFTARTNLIKKIPNFWITVFLNHPQIQMLLNEDDEEVLQYMAYVEVEEFEDIKSGYKIKFGFEDNPYFTNQEICKEFILNDNGEQMSRSTTIKWKQGMDLTQRFKENSKGRKRDHPPSSFFCWFTDLMDN-SDELGELIKDDIWPNPLQYYM 216          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Nematostella
Match: EDO43162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZK7])

HSP 1 Score: 55.0694 bits (131), Expect = 1.199e-8
Identity = 37/129 (28.68%), Postives = 58/129 (44.96%), Query Frame = 1
Query:  247 KQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVV-----------KESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVN-----------ENGE--ASESTKIEWYPGKDVTAKSHNKEKKRSAEA 561
            K IP FW  A  N    S +I + DE IL++L ++ V           +  +    G+ + F F  NP+F NTVLTK + +            E  E  ++   KI+W  GK++T K   K+++     
Sbjct:  173 KGIPEFWLTAMKNVELLSEMIQEHDEPILKHLHDVRVIFTGPESTNTTQYPQPTPMGFVLEFHFTPNPFFTNTVLTKSYKMKCEPDEDDPFSFEGPEIVSTSGCKIDWKKGKNITQKVIKKKQRHKGRG 301          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Match: setb (protein SET [Source:NCBI gene;Acc:101171505])

HSP 1 Score: 210.305 bits (534), Expect = 1.149e-66
Identity = 109/193 (56.48%), Postives = 144/193 (74.61%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ ++DE+ L YL  + V E EDIKSGY+I F F  NPYF+N  L+K+FNVNE G+  S+ST+I+W  GKD+T +S    NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL
Sbjct:   25 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEDDEEALHYLSKVEVTEFEDIKSGYRIDFCFDENPYFENKTLSKEFNVNEGGDPISKSTEIKWKTGKDLTKRSGQTSNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYL 217          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Match: seta (protein SET [Source:NCBI gene;Acc:101158031])

HSP 1 Score: 209.149 bits (531), Expect = 2.972e-66
Identity = 108/193 (55.96%), Postives = 146/193 (75.65%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGE-ASESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ +EDE+ L YL  + V E EDIKSGY+I F F  NPYF+N VL+K+F++NE+G+ +S+ST+I+W  GKD+T +S    NK  ++      +SFF +F D+     D+ GEVIKDD+W NP+QYYL
Sbjct:   29 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLSRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKAGRKRQHEEPESFFTWFTDHADAGADELGEVIKDDIWPNPLQYYL 221          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Match: setb (protein SET [Source:NCBI gene;Acc:101171505])

HSP 1 Score: 208.379 bits (529), Expect = 1.309e-65
Identity = 109/194 (56.19%), Postives = 144/194 (74.23%), Query Frame = 1
Query:  106 QEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKS---HNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            QE IE IDEVQN++D LNE+ASEEILKVEQKYN++RQP+++KRS LI +IP+FW   F+NHPQ SA++ ++DE+ L YL  + V E EDIKSGY+I F F  NPYF+N  L+K+FNVNE G+  S+ST+I+W  GKD+T +S    NK  K+      +SFF +F D++    D+ GEVIKDD+W NP+QYYL 
Sbjct:   45 QEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEDDEEALHYLSKVEVTEFEDIKSGYRIDFCFDENPYFENKTLSKEFNVNEGGDPISKSTEIKWKTGKDLTKRSGQTSNKAGKKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLV 238          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Match: tspy (testis-specific Y-encoded-like protein 1 [Source:NCBI gene;Acc:101169699])

HSP 1 Score: 128.642 bits (322), Expect = 4.857e-33
Identity = 68/191 (35.60%), Postives = 121/191 (63.35%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYL 672
            I++ +  + +VQ ++D L +K+     ++EQK + +R+P  ++RS++ K IP FW  A +NHP  SA I + DE  L Y+ +L ++  ++ K GY+I F F  NPYF+N ++ K+ ++   G   S S  I W+ G ++TA S   E ++S+  + ++FF++F D++   VDD  +++KDDL+ +P++YYL
Sbjct:  263 IRQSVALLAQVQMRLDALEKKSGRLHQRLEQKISRLRRPQLDQRSSITKSIPGFWVTALLNHPHLSAHIDETDEDALSYMTDLEIESFKNNKMGYRIRFHFRRNPYFQNNIIMKELHIGMGGPPMSFSNPILWHRGHNLTAHS---EPRKSSRGVYETFFSWFSDHSNPGVDDVAQILKDDLYRDPLRYYL 450          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Match: nap1l4b (nucleosome assembly protein 1-like 4 [Source:NCBI gene;Acc:101172303])

HSP 1 Score: 60.4622 bits (145), Expect = 4.486e-10
Identity = 49/200 (24.50%), Postives = 83/200 (41.50%), Query Frame = 1
Query:  103 IQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLI-----------------------------------------------KQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKS-GYKIIFTFASNPYFKNTVLTKQFNVNENGEAS-------------ESTKIEWYPGKDVT 519
            ++  I  + ++Q Q   +  K  EE+ ++E+KY  + QP ++KR +++                                               K IP FW   F +    S ++ + DE IL++L+++ VK SE  +   + + F F  N YF N VLTK + +    +AS             E  +I+W+ GKDVT
Sbjct:   31 VRRRINALRKLQVQCAHIEAKFYEEVHELERKYAALYQPLFDKRRDVVSGAVEPTDEECEWPSDKDEEEELAEEVKEKASIEDAKKEEATPEEGPKGIPEFWLAIFKSVDMLSDMLQEHDEPILKHLKDIQVKFSEPGQPMSFTLEFHFEPNGYFNNAVLTKVYKMKSEPDASDPFSFEGPEIIDCEGCQIDWHKGKDVT 230          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Match: SMESG000027817.1 (SMESG000027817.1)

HSP 1 Score: 402.519 bits (1033), Expect = 6.551e-143
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   46 MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA
Sbjct:    1 MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA 210          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Match: SMESG000027807.1 (SMESG000027807.1)

HSP 1 Score: 402.519 bits (1033), Expect = 6.551e-143
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   46 MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA
Sbjct:    1 MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSFFNFFDDNTTGYVDDFGEVIKDDLWNNPMQYYLA 210          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Match: SMESG000026284.1 (SMESG000026284.1)

HSP 1 Score: 230.72 bits (587), Expect = 3.445e-75
Identity = 119/211 (56.40%), Postives = 157/211 (74.41%), Query Frame = 1
Query:   46 MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEA-SESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVDDFGEVIKDDLWNNPMQYYLA 675
            MAS  KI K++  G  D N+ E+IE+I+EVQN+VD+LNE+ASEEILKVEQKYN++RQPY++KRS L  +IP+FW+ A +NHPQ + + +++D   L YL  + VKE E+IKSGYKI+FTFA N YFKN VL K FN NENGE  ++STKIEW+ GK +  K   K +KR    M DSFF++F+       D+ GE+IKDD+WNNPMQY+L+
Sbjct:    1 MASNPKIQKIEMNGSADFNMTEVIEQIEEVQNEVDLLNEQASEEILKVEQKYNKLRQPYFDKRSELFSKIPNFWSQAILNHPQLAVMFSEDDIDALSYLTKVEVKEYENIKSGYKIVFTFADNEYFKNKVLEKAFNTNENGEMETKSTKIEWHQGKSLV-KGDCKGRKRQVAPMIDSFFSWFEGCCDMMNDEIGELIKDDIWNNPMQYFLS 210          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Match: SMESG000031906.1 (SMESG000031906.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.038e-57
Identity = 100/216 (46.30%), Postives = 140/216 (64.81%), Query Frame = 1
Query:   46 MASAEKISKVDAQG--DNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQKYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDSXXXXXXXXXXGYVD------DFGEVIKDDLWNNPMQYY 669
            MASA KI K ++ G  D D  +  +IEKIDEVQ+ +D LNE+ASEEIL+VE+K+N+ RQP +++R+NLIK IP+FW  A  NHPQ   +IT+ DE++L+ L +L V+E +DIKSG+KII TF+SN YF NT +TK  +V E+   +    ++W  GK+   KS N+   ++A   +    +          D      + GEVIKDDLW NP+QYY
Sbjct:    1 MASAPKIQKTESNGKVDQDQVLNSLIEKIDEVQSDIDKLNEQASEEILEVEKKFNQKRQPLFQQRANLIKTIPNFWINALSNHPQLMTLITEHDEELLQSLTSLDVEEFDDIKSGFKIIMTFSSNEYFTNTTITKSIHVGESEIKTTCDTVDWKDGKNF-VKSLNESLNKAAAGSKGGSSSPISFMQWFTSDIANSMVELGEVIKDDLWPNPLQYY 215          
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Match: SMESG000022916.1 (SMESG000022916.1)

HSP 1 Score: 69.707 bits (169), Expect = 2.734e-13
Identity = 46/123 (37.40%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  244 IKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLENLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVN-----------ENGE--ASESTKIEWYPGKDVTAKSHNKEKKRSAEAMQDS 573
            IK IP FW + F N P  S  + + D  IL+ L ++      DI  G++I F FA+N YF NTVL++ F VN           E  E   S+  KIEW P K+VT K+  + KK   +  + S
Sbjct:  147 IKGIPDFWYIIFKNVPLLSERVEEYDWPILKSLIDVSSVMINDINPGFRINFYFAANEYFTNTVLSRTFYVNFELPSENPLLFEGPEIVMSKGCKIEWKPNKNVTVKNIKQMKKSRVKGEKRS 269          
The following BLAST results are available for this feature:
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SET1.965e-6652.05SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET9.345e-6655.67SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET1.021e-6555.67SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET1.156e-6555.67SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
SET1.349e-6555.96SET nuclear proto-oncogene [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spr-25.914e-4039.80Suppressor of presenilin-2 [Source:UniProtKB/Swis... [more]
spr-21.223e-3940.00Suppressor of presenilin-2 [Source:UniProtKB/Swis... [more]
nap-11.329e-940.79Nucleosome Assembly Protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Set5.971e-5749.78gene:FBgn0014879 transcript:FBtr0083062[more]
CG37081.318e-623.08gene:FBgn0040345 transcript:FBtr0331301[more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
seta4.135e-6652.27SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-... [more]
setb5.125e-6651.60SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
setb1.133e-6551.60SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
tspy6.646e-2931.41testis specific protein Y-linked [Source:ZFIN;Acc:... [more]
nap1l4b1.750e-832.38nucleosome assembly protein 1-like 4b [Source:ZFIN... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bach11.460e-6652.05BTB and CNC homology 1, basic leucine zipper trans... [more]
bach11.571e-6652.05BTB and CNC homology 1, basic leucine zipper trans... [more]
bach11.093e-6555.96BTB and CNC homology 1, basic leucine zipper trans... [more]
os93.019e-3638.50osteosarcoma amplified 9, endoplasmic reticulum le... [more]
nap1l18.195e-823.47nucleosome assembly protein 1 like 1 [Source:NCBI ... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Set7.455e-6655.96SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set1.140e-6555.96SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set4.103e-5658.67SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Set3.106e-4463.96SET nuclear oncogene [Source:MGI Symbol;Acc:MGI:18... [more]
Tspyl33.862e-3635.60TSPY-like 3 [Source:MGI Symbol;Acc:MGI:2139328][more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01105|SET_HUMAN6.479e-6555.96Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV... [more]
sp|Q9EQU5|SET_MOUSE7.977e-6555.96Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 S... [more]
sp|Q63945|SET_RAT9.082e-6555.96Protein SET OS=Rattus norvegicus OX=10116 GN=Set P... [more]
sp|P0DME0|SETLP_HUMAN4.579e-6054.40Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP P... [more]
sp|P53997|SET_DROME5.985e-5649.78Protein SET OS=Drosophila melanogaster OX=7227 GN=... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1B9G32.690e-6954.79Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A4S2M3191.410e-6754.09Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M8E32.270e-6754.09Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZFX42.270e-6754.09Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KT932.270e-6754.09Protein SET OS=Clonorchis sinensis OX=79923 GN=Set... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setb5.570e-6752.05SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
setb1.397e-6555.67SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
seta2.817e-6451.14SET nuclear proto-oncogene a [Source:ZFIN;Acc:ZDB-... [more]
tspy1.175e-3033.51testis-specific Y-encoded-like protein 1 [Source:N... [more]
tspy2.861e-3033.51testis-specific Y-encoded-like protein 1 [Source:N... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
setb2.974e-5647.89SET nuclear proto-oncogene b [Source:ZFIN;Acc:ZDB-... [more]
nap1l11.169e-836.59nucleosome assembly protein 1-like 1 [Source:ZFIN;... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NAP11.014e-1138.03Histone chaperone; involved in histone exchange by... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO442592.937e-5949.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431621.199e-828.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setb1.149e-6656.48protein SET [Source:NCBI gene;Acc:101171505][more]
seta2.972e-6655.96protein SET [Source:NCBI gene;Acc:101158031][more]
setb1.309e-6556.19protein SET [Source:NCBI gene;Acc:101171505][more]
tspy4.857e-3335.60testis-specific Y-encoded-like protein 1 [Source:N... [more]
nap1l4b4.486e-1024.50nucleosome assembly protein 1-like 4 [Source:NCBI ... [more]
back to top
BLAST of Testis-specific Y-encoded-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027817.16.551e-143100.00SMESG000027817.1[more]
SMESG000027807.16.551e-143100.00SMESG000027807.1[more]
SMESG000026284.13.445e-7556.40SMESG000026284.1[more]
SMESG000031906.11.038e-5746.30SMESG000031906.1[more]
SMESG000022916.12.734e-1337.40SMESG000022916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034697 ID=SMED30034697|Name=Testis-specific Y-encoded-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=918bp
GTTTGAAATATCAATTTCATTTAAATTTTAAAACACTTTAAGTAAATGGC
GTCGGCTGAGAAGATATCAAAAGTTGATGCACAGGGTGACAATGATGTCA
ATATCCAAGAGATAATTGAAAAGATAGACGAAGTTCAAAATCAAGTAGAT
GTTTTAAACGAAAAAGCGAGTGAAGAAATACTGAAAGTTGAACAAAAGTA
TAATGAAATTAGGCAGCCTTATTATGAGAAAAGATCTAATTTGATAAAGC
AAATTCCTCATTTTTGGGCTGTAGCTTTTATGAATCATCCTCAATTCTCA
GCTGTTATTACCGATGAAGACGAGAAGATATTGGAGTATTTAGAAAATCT
GGTAGTTAAAGAAAGTGAAGATATAAAATCTGGATATAAAATTATTTTCA
CATTTGCTTCCAACCCATATTTCAAAAATACTGTTTTGACCAAACAATTC
AATGTTAATGAAAATGGTGAGGCTTCAGAATCCACAAAAATTGAGTGGTA
TCCAGGCAAAGATGTCACAGCTAAAAGTCATAACAAAGAAAAAAAGCGCA
GTGCAGAAGCAATGCAAGATTCATTTTTTAATTTTTTCGATGACAATACT
ACTGGATATGTTGATGATTTTGGTGAAGTAATTAAGGATGATTTGTGGAA
TAATCCTATGCAATATTATTTGGCGTCGGAGCTTGATGAAGAAGAAGGTG
ATAATGACGAAGACTTATATGATGAGGAGGATGAAGATATTGAGGAAGCT
AATGAAGAATCGGCTGATTGAATATTTACAGTAGTTCGCATTTTGTTGTT
AAAATCATTATCAATGGATTATAAATAAATGTGTAAAATAAATTTTCGTA
TCTTATTACTATTTTCCTTCAAATGAATTCTGGTTTATTTTATTATTAAT
TTATTGAATAAATTCGAC
back to top

protein sequence of SMED30034697-orf-1

>SMED30034697-orf-1 ID=SMED30034697-orf-1|Name=SMED30034697-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MASAEKISKVDAQGDNDVNIQEIIEKIDEVQNQVDVLNEKASEEILKVEQ
KYNEIRQPYYEKRSNLIKQIPHFWAVAFMNHPQFSAVITDEDEKILEYLE
NLVVKESEDIKSGYKIIFTFASNPYFKNTVLTKQFNVNENGEASESTKIE
WYPGKDVTAKSHNKEKKRSAEAMQDSFFNFFDDNTTGYVDDFGEVIKDDL
WNNPMQYYLASELDEEEGDNDEDLYDEEDEDIEEANEESAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005730nucleolus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037231NAP-like_sf
IPR002164NAP_family
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 218..238
NoneNo IPR availableCOILSCoilCoilcoord: 20..47
NoneNo IPR availableGENE3DG3DSA:3.30.1120.90coord: 68..213
e-value: 1.3E-49
score: 170.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 211..241
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 212..241
NoneNo IPR availablePANTHERPTHR11875:SF49PROTEIN SETcoord: 12..239
IPR002164Nucleosome assembly protein (NAP)PFAMPF00956NAPcoord: 68..216
e-value: 7.2E-31
score: 107.3
IPR002164Nucleosome assembly protein (NAP)PANTHERPTHR11875TESTIS-SPECIFIC Y-ENCODED PROTEINcoord: 12..239
IPR037231NAP-like superfamilySUPERFAMILYSSF143113NAP-likecoord: 16..209