Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30034696
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Bos taurus GN=MPEG1 PE=2 SV=2 (E=1.68764e-94)
Length (bp)2009
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-2 ) is expressed during Stage 3 and Stage 4 in the embryonic digestive system and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 258.84 bits (660), Expect = 1.541e-92
Identity = 143/404 (35.40%), Postives = 210/404 (51.98%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHV  SV AGA L + D L+ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L+     K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S H A+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 102.449 bits (254), Expect = 1.541e-92
Identity = 49/142 (34.51%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 235.343 bits (599), Expect = 4.879e-84
Identity = 144/447 (32.21%), Postives = 222/447 (49.66%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVEL-----------FYVYSNENNDGMV--------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKF-GRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVK 1862
            L++ +V DYGTHVI SV AGA L + D LK +++S S+ +  +V+ASA  +    V   IGG      + ++ Y+ N   S I + GG  +     L+ W+++   NLV IDR+G PL+Y +     P     T+  + + ++ A  RYY  N+ PGC+++ S NF+  AN+D+  C+ P  N  FGG+YQ C  L+      C E  Q NP TG  SCP  ++   L           +  +++ ++ G +                    + T WC+   K+  ++GYLFGG+F     NP+T SSSCP  + + +F      IC+S D E+G + S+PF GFFSC  GNPL+  ++           C P +S HLA I   CQ+ YC++S    G    P+  PPF    +   I  N++          +++ +  MW   K
Sbjct:  192 LSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNGQS----------RCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPFTRPPVVGMIATNTVAVMTEGERSWVRVGETKMWRLAK 628          

HSP 2 Score: 97.0561 bits (240), Expect = 4.879e-84
Identity = 50/153 (32.68%), Postives = 88/153 (57.52%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            C   +   A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+ +S V+ +S+++  + +  S TS S+N + +  +    ++  FS E + +K +Q+KE S  +  Q+R  L+ +   PD  LD  F  +  ++   +E
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIE 182          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 214.542 bits (545), Expect = 6.566e-80
Identity = 144/476 (30.25%), Postives = 224/476 (47.06%), Query Frame = 3
Query:  624 LLRVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGL----SAKCKELNQLNPITGTSSCPDGFDPVEL--------FYVYSNENN-----------------------DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSC-PQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVKYVP----FARS-------KFGLIIF 1904
            L   L++ ++ DYGTHVI SV AGA L + D LK +++ K++ +  +V+ASA  +    V +      G   +  + Y+ N   S I + GG  +     L+ W+++   NLV IDR+G PL+Y +     P  S+  +  +   +  A  +YY  N+ PGC+++ S NF+  AN+D+  C+ P  N  FGG+YQ C  L    S  C E+ Q NP TG  SC   ++   L        +  Y  ++N                           ++T WC   QK    +GY+FGG++  +  NP T S +C P +F+     R   +C+S D     K+++PFGGFFSC  GNPL+  ++           C P +S HLA I   CQ+ YC++S    G +  P+  PP+ +  L      NS+      +G  + + +  MW     V     F RS        +GLI+ 
Sbjct:  188 LATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFDKVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNGES----------RCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTSPPLVGMTVTNSVVVMTDLNGSLVGVGQSRMWQPANPVEINQMFVRSGGKNAGVTYGLILL 653          

HSP 2 Score: 103.99 bits (258), Expect = 6.566e-80
Identity = 53/148 (35.81%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  139 VNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRV 582
            +N+CH  ++  A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+  + V+ +S+++  +    S TS SIN + +  +    ++G FS E + +K +Q+KE S  S  Q+R  L+ +   P+  LD  F  +V
Sbjct:   30 LNECHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQV 174          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 210.69 bits (535), Expect = 4.944e-77
Identity = 129/408 (31.62%), Postives = 193/408 (47.30%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVELFY--VYSNENN---------------------------DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQ-YFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            L++ ++ +YGTHVI S+ AGA L + D +K +++S +     +V+ASA ++    V    G       +    Y++N   S + + GG  +     ++ W+++   +LV IDR+G P++Y +     P     T+  +   ++ A  RYY+ N+ PGC D  S NF+  AN+++  C+ P  N  FGGVYQ C   S      C E  Q NP TG  +C   +    L    V    NN                               I+T+WC+ +Q    + GYLFGG+F  +  NP T S  CP  YF  +      +IC+S D E G  +S+PFGG FSC  GNP    +            C P YS HLA I   CQ+ YC++S    G +  P++ PPF
Sbjct:  189 LSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQY----------RCPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPF 586          

HSP 2 Score: 98.5969 bits (244), Expect = 4.944e-77
Identity = 57/189 (30.16%), Postives = 97/189 (51.32%), Query Frame = 1
Query:   40 FIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            +I+  FF      +  I P N ++           +C   ++  A  VLPG GWDNL N ++G+++ L+Y  C+++ D  +LIPDEV + P   S V+  S+ +  +    S TS SIN +A+  T    ++G FS E   +K +Q++  S  +  Q+R  L+ +   PD  LD  F  ++ ++   +E
Sbjct:    5 YIFLTFFVLFCKSDGFIRPSNGLR-----------ECRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLT---VLNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAIE 179          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 64.3142 bits (155), Expect = 8.988e-12
Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPE 315
            C   +   A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQ 88          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 258.07 bits (658), Expect = 1.996e-93
Identity = 144/401 (35.91%), Postives = 209/401 (52.12%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK--CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L++ +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   Y +  +   +Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+D+  C     NF FGGVYQ C  LS    C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  200 LAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 600          

HSP 2 Score: 105.916 bits (263), Expect = 1.996e-93
Identity = 53/145 (36.55%), Postives = 89/145 (61.38%), Query Frame = 1
Query:  175 FNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
              VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S+++  +  Y S TS SIN E    +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F   ++D+   LEK
Sbjct:   50 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEK 191          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 258.84 bits (660), Expect = 9.595e-93
Identity = 148/407 (36.36%), Postives = 208/407 (51.11%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMV-------------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINL 1766
            LA+L++ +YGTH+I SV AGA L + D +K +++  ++GN   VAASA  +    V  KI  G+      AT Y +N   SR+ + GG P+     +E W+K +  +LV +DR G PL++ I    +P F    +  +   ++ A   YY+ N+ PGC +I S NFD  AN D+G C     N  FGGVYQ C  LS       C + +Q NP+TG  SCP  + PV L      +   GM                          ++++WCA + +   ++G LFGG+FTD   NP+T   SCP  +  LK     K+CVS D ELG K S+PFGGFFSC+ GNPL    T+      +   C  G+S  LA I   CQ+SYC+K+         P   PP+  L
Sbjct:  193 LAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPLYGSFTSGDLEKSFLPKCPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          

HSP 2 Score: 102.834 bits (255), Expect = 9.595e-93
Identity = 49/143 (34.27%), Postives = 91/143 (63.64%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
            VLPG GWDNL N ++GQ++ L+Y NCK++ D  ++IPD+V   P+  SN++++S+++  +  Y S TS SIN+  +      +V+G FS E + +K  Q+++++  +  Q+R  ++ +   P++EL+  F   ++++   LEK
Sbjct:   45 VLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 1.688e-94
Identity = 145/404 (35.89%), Postives = 212/404 (52.48%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMV-------------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  S+ +   V ASA ++    V  K    Y +  T    Y  N  +SR+ +FGG P+     L+ W++ +  +LV +DR G PLY+ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C   S       C+ L Q NP+TG+ SCP G+ PV+L      E  + +                             FWCA + + + ++G LFGG+F+    NP+T + SCP  +  LK     K+C S D ELG + S+PFGGFFSC+ GNPL    T+        + C  G+S HLA+I   CQ+SYC+K+    G    P+  PP+
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIFCKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSLRKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPY 596          

HSP 2 Score: 102.834 bits (255), Expect = 1.688e-94
Identity = 48/142 (33.80%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N + G++++L+Y +C+++ D  +++PDE+   P+  SN++++S ++  +  Y S TS SIN+E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   PD+EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 6.160e-93
Identity = 144/404 (35.64%), Postives = 211/404 (52.23%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L      K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S HLA+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGVPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 103.99 bits (258), Expect = 6.160e-93
Identity = 49/142 (34.51%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL+ +F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 1.228e-92
Identity = 144/401 (35.91%), Postives = 209/401 (52.12%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK--CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L++ +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   Y +  +   +Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+D+  C     NF FGGVYQ C  LS    C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  193 LAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 593          

HSP 2 Score: 105.531 bits (262), Expect = 1.228e-92
Identity = 53/146 (36.30%), Postives = 89/146 (60.96%), Query Frame = 1
Query:  172 AFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
               VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S+++  +  Y S TS SIN E    +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F   ++D+   LEK
Sbjct:   42 VLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 7.264e-92
Identity = 143/404 (35.40%), Postives = 210/404 (51.98%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHV  SV AGA L + D L+ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L+     K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S H A+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 102.449 bits (254), Expect = 7.264e-92
Identity = 49/142 (34.51%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 8.228e-92
Identity = 143/401 (35.66%), Postives = 208/401 (51.87%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLS--AKCKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   + +       Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+++  C     NF FGG+YQ C  LS  A C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDIGAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 593          

HSP 2 Score: 106.686 bits (265), Expect = 8.228e-92
Identity = 63/196 (32.14%), Postives = 104/196 (53.06%), Query Frame = 1
Query:   22 SVASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
            S  +   IW +         A  E D  +++   P       C  T       VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S++   +  Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F N ++D+   LEK
Sbjct:    3 SFMAIALIWMMI--------ACAEADKPLRD---PGMTGFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|A7SEK6|A7SEK6_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 3.701e-98
Identity = 157/400 (39.25%), Postives = 218/400 (54.50%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNAT--EYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYG----LSAKCKELNQLNPITGTSSCPDGFDP------------------VELFYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN 1763
            LA ++VRD+GTH + SV AGA+L+K D L   F++ S  +   + ASA+ S     G    G Y  S    T  EY K    S   T+GG P+  NF + +WE  +   LV +DR+GDPL+Y IT  ++P   ++  F +  ++KNAI +YY  N+  GC  + S NF   AN+D+G CQ+P +N+ FGGVYQ C       S  C  L Q NP+T   +C  G++P                  V LF+   +        +T+WC        ++GYLFGG+++D   NP+T   SCP  F +LKFG T K+CVS D ELG + SLPFGGFFSC+ GNPL  KK          + C  G+S HL  IE NC+I YC+KSN    +    + RPP+++
Sbjct:  153 LAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGA--SGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLAFKKPPTG-----DKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYLS 545          

HSP 2 Score: 108.612 bits (270), Expect = 3.701e-98
Identity = 61/152 (40.13%), Postives = 92/152 (60.53%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            VLPG GWDNL N  +G +  ++Y  C+SS+D  FL+PD V + P   S V   ++   H++ Y S T+KSIN EA A+     VSGSFS E + VKK+Q+++K+  +  QLR+  +    QPDS L P F +R++++   L+  +   Y+ F
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQ-HNNTAYASF 152          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|Q6RYF8|Q6RYF8_HALRU (Macrophage expressed protein OS=Haliotis rufescens PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 4.322e-96
Identity = 145/419 (34.61%), Postives = 213/419 (50.84%), Query Frame = 3
Query:  630 RVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPY-GSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVE-------------------LFYVYSNEN--NDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADY----------------WTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            R  ++L+VRD+GTHV+ SV AGA L + D +   F++  +     + A A+ S      I +      S    T YEK+ +SS+I+T GG  +  SNF   DW   +   LV +DR+GDPL+++I   ++P   +  ++ +  L++  I  YY  N+  GC ++ S NF   AN+D+G C++P  N  FGGVYQ C   S       C  L+Q+NP TG  +CPDG++ VE                   LF+   ++N  +        WCA     +  +GYLFGG++T    NP+T   +CP  F +   G+   IC+S D ELGMK S+PFGGF SC+ GNPL       S  D                 W + C  GYS HLA ++  C+I+YC+ + +L       + RPPF
Sbjct:  197 RYDSELLVRDFGTHVVTSVDAGAALVQEDQVSSEFVNSRKFTKNQITAGASASFLGIFSIDVSYHSSTSNEVKTAYEKSRSSSQIDTLGGPMFKASNFTANDWTNEVDHELVAVDRSGDPLFFLINSASLPELPNSVLYQLQNLVEETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVYQTCSMSSGSNNGDLCSGLDQVNPKTGGHTCPDGYESVELHTGRLSDSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGPVSQDSGYLFGGLYTSQLNNPLTQGKTCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTTGNPLAMNPKPKSKGDMNSALPSLHSFFQGSKTWPKHCPKGYSQHLAYVDQGCEINYCLLAGSLSEVGLPKIRRPPF 615          

HSP 2 Score: 126.331 bits (316), Expect = 4.322e-96
Identity = 69/190 (36.32%), Postives = 106/190 (55.79%), Query Frame = 1
Query:   40 FIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQY-AFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
             + F+F  S +A     E  N +Q   FP K  V  C+  N +   F VLPG GWDNL N + G ++  +Y  C+++ D  FLIPD V+  P   S + + ++L+SH+S Y S T+  +NI+A     + +VSG+FS   + VK  Q+ +KS  +  QLRY  +    QPD+ L PTF +R++ +   L+
Sbjct:    1 MLCFVFGVSIVAGVIGGELLNTVQKPEFP-KGDVRACYGDNKKLERFEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRFLIPDTVNTIPLKASKLNVYAELISHWSNYTSTTAHGVNIDAGLKFGSVKVSGTFSSGYESVKSKQIGDKSYTTRVQLRYVRYSAKLQPDAALHPTFKSRLLSIAGSLQ 189          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|K1RDW7|K1RDW7_CRAGI (Uncharacterized protein OS=Crassostrea gigas GN=CGI_10027905 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 4.207e-94
Identity = 155/426 (36.38%), Postives = 222/426 (52.11%), Query Frame = 3
Query:  624 LLRVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGI-KIGGGYGNSETNAT--EYEKNCASSRINTFGGGPYG-SNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCY---GLSAK-CKELNQLNPITGTSSCPDGFDPVEL------------------FYVYSN--ENND---GMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTN--------------SPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINL 1766
            + R  + L+VRDYGTHVI SV AGAI+S+ D +K  F   S   S++     A +    + +  +G  Y +S +     +Y  N   S IN  GG  +  +NF L  W   L  +LV +D++G P+Y +I+ + +P      +F +   +K+A+  YY  N   GC D+ S NF   AN+D+G C++P+ N+KFGGVYQ C     LS   C  L Q NP+TG  SCP G++ V L                  F   S+  +NN+        +FWC         +G+ FGGI+T+   NP+T S  CP YF  LK G   ++CVS D ELG + S+PF G FSC  GNPL   + T+                ++ W + C  GYS HLA IE +C+I+YC+K+NA   K   P+  PPF++L
Sbjct:  203 MARYHSQLLVRDYGTHVISSVQAGAIISQLDQIKTTF---SNSYSMDRRQVVAAASASFMNVFNVGAEYKHSTSTEVIDQYLGNRTHSVINAIGGPVFQPNNFTLNQWASGLSGDLVAVDKSGYPIYELISAQTLPELPPSILFPLIQTVKSAVEEYYKFNIYRGCTDLDSPNFSFIANVDDGTCESPETNYKFGGVYQQCKQSGQLSQNLCNGLVQKNPLTGAQSCPSGYESVLLNEGTRSATESRRSCHHCGFLGLSHCCDNNNVYGSAKYQSFWCVAQDHVNQQSGFQFGGIYTNKIDNPLTQSRGCPLYFHPLKLGLGMQVCVSDDYELGFRYSVPFAGLFSCMTGNPLAVHQDTSFKNPDILQSLSSYPKASNNWPRGCPTGYSMHLATIENSCEINYCVKANAFSDKGLPPVRHPPFMDL 625          

HSP 2 Score: 116.701 bits (291), Expect = 4.207e-94
Identity = 51/149 (34.23%), Postives = 90/149 (60.40%), Query Frame = 1
Query:  175 FNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKN 621
            F VLPG GWDNL N+E G +++ +Y  C++++D  +LIPD V   P   S +++  +L  H++ + S TS S+N+EA     ++ +SG +S E + V+K+Q+ ++S  +  Q RY  +    QPD+ L+P F +R+ ++   ++    N
Sbjct:   54 FEVLPGLGWDNLQNKEAGMLVQYNYSECRTTDDGRYLIPDGVFTVPLKSSQLEVFGELFQHWNNFTSTTSSSVNVEAGLHLGSFGISGKYSHESESVRKHQIMDRSVTTRVQARYARYSALLQPDTPLNPAFRDRLRNIAYYMQTNKTN 202          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|F7GHV2|F7GHV2_MONDO (Uncharacterized protein OS=Monodelphis domestica GN=MPEG1 PE=4 SV=2)

HSP 1 Score: 270.396 bits (690), Expect = 2.217e-93
Identity = 148/404 (36.63%), Postives = 215/404 (53.22%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVINT-------------------------FWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            +A+L+V  YGTHVI SV AGAIL + D +K +F+   +    ++ ASA V+    +  K    + + +     Y  N  +SR+ + GG P+     LE W+KT+  +LV IDR+G PLY+ +    +P      +  ++  ++ A+ RYY+ N+ PGC +  S NF+  AN D+G C+    NF FGGVYQ C  LS       C EL Q NP+TG  SCP+ + PV L   +  E  + +  +                          FWC  N +   ++G+LFGG+F+    NPVT + SCP  +L L+     K+C+SQD ELG K ++PFGGFFSC +GNPL     TN+    + + C  G+S HLA+I   CQ+SYC+K+    G    P   PPF
Sbjct:  194 MAELLVLSYGTHVITSVDAGAILVQEDHIKSSFLEDGQSTRSSITASAGVAFHNIINFKAEDSHVSQDAFVKNYLSNRTNSRVASIGGVPFYPGITLEGWQKTIKNHLVAIDRSGLPLYFFVNSDTLPDLPAPLVKKLSKTVEAAVRRYYTFNTYPGCTNKDSPNFNFQANTDDGSCEGKMTNFTFGGVYQECTQLSGMEAVLLCPELEQKNPLTGEFSCPENYSPVLLHSHFKEEGYNFLECHRKCSLWVFCKKECEDVFRVARAEFRGFWCVANGQVPENSGFLFGGLFSGRSINPVTNAQSCPASYLPLRLLDGLKVCISQDYELGYKFAVPFGGFFSCDVGNPLVNSSHTNNQGGPYVKKCPAGFSQHLALISDGCQVSYCVKAGLFTGDSLPPARLPPF 597          

HSP 2 Score: 102.449 bits (254), Expect = 2.217e-93
Identity = 51/154 (33.12%), Postives = 89/154 (57.79%), Query Frame = 1
Query:  145 DCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            +C  + +     VLPG GWDNL N ++G++L L Y NC+++ D  ++IPDE+   P   SN++L+S+++  +  Y S TS SIN E +  +     +G FS E + +K +Q+K+++  +  Q+R  ++     P S+L   F   ++D+   LE
Sbjct:   34 ECRKSLNLSVLEVLPGGGWDNLRNVDMGRVLDLVYSNCQTTEDGQYIIPDEILTIPRKQSNLELNSEIIESWMNYQSTTSSSINTEISLFS---MANGKFSIEFQKMKTHQVKQQAVTTRVQVRNLVYTAKINPISQLSRGFKKELMDISDRLE 184          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|Q6RYF9|Q6RYF9_HALCO (Macrophage expressed protein OS=Haliotis corrugata GN=mpeg1 PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 2.706e-93
Identity = 143/419 (34.13%), Postives = 213/419 (50.84%), Query Frame = 3
Query:  630 RVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPY-GSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVE-------------------LFYVYSNEN--NDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADY----------------WTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            R  ++L+VRD+GTHV+ SV AGA L + D +   F++  +     + A A+ S+     I +      S      YE++ +SS+I+T GG  +  SNF   DW   +   LV +DR+GDPL+++I   ++P   +  ++ +  L++  I  YY  N+  GC ++ S NF   AN+D+G C++P  N  FGGVYQ C   S       C  L+Q+NP TG  +CPDG++ VE                   LF+   ++N  +        WCA     +  +GYLFGG++T    NP+T   +CP  F +   G+   IC+S D ELGMK S+PFGGF SC+ GNPL       S  D                 W + C  GYS HLA ++  C+I+YC+ + +L       + RPPF
Sbjct:  197 RYDSELLVRDFGTHVVTSVDAGAALVQEDQVSSEFVNSRKFTKNQITAGASASLFGIFSIDVSYHSSTSNEVKKAYEQSRSSSQIDTLGGPMFKASNFTANDWTNEVDHELVAVDRSGDPLFFLINSASLPELPNSVLYQLQNLVEETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVYQTCSMSSGSNNGDLCSGLDQVNPKTGGHTCPDGYESVELHTGRLSDSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGPVSQDSGYLFGGLYTSQLNNPLTQGKTCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTTGNPLAMNPKPKSKGDMNSALPSLHSFFQGSKTWPKHCPKGYSQHLAYVDQGCEINYCLLAGSLSEVGLPKIRRPPF 615          

HSP 2 Score: 120.168 bits (300), Expect = 2.706e-93
Identity = 65/190 (34.21%), Postives = 104/190 (54.74%), Query Frame = 1
Query:   40 FIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQY-AFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
             + F+   S +A  +  E  + ++   FP K  V  C+  N +   F VLPG GWDNL N + G ++  +Y  C+++ D  +LIPD V+  P   S + + ++L+SH+S Y S T+  +N++A     + QVSG FS   + VK  Q+ +KS  +  QLRY  +    QPD+ L PTF  R++ +   L+
Sbjct:    1 MLGFVLVVSIVASVSGGELLDSVKKPEFP-KGDVRACYGDNKKLERFEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRYLIPDTVNTIPLKASKLNVYAELISHWSSYTSTTAHGVNVDAGLKYDSVQVSGKFSSGYESVKSKQIGDKSYTTRVQLRYVRYSAKLQPDASLHPTFKTRLLSIAGSLQ 189          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.541e-9235.40macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 4
Match NameE-valueIdentityDescription
mpeg1.14.879e-8432.21macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.36.566e-8030.25macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.24.944e-7731.62macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.18.988e-1244.64macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 2
Match NameE-valueIdentityDescription
Mpeg11.996e-9335.91macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
Pfpl9.595e-9336.36pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJC3|MPEG1_BOVIN1.688e-9435.89Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|Q5RBP9|MPEG1_PONAB6.160e-9335.64Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|A1L314|MPEG1_MOUSE1.228e-9235.91Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
sp|Q2M385|MPEG1_HUMAN7.264e-9235.40Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q9WV57|MPEG1_RAT8.228e-9235.66Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A7SEK6|A7SEK6_NEMVE3.701e-9839.25Predicted protein (Fragment) OS=Nematostella vecte... [more]
tr|Q6RYF8|Q6RYF8_HALRU4.322e-9634.61Macrophage expressed protein OS=Haliotis rufescens... [more]
tr|K1RDW7|K1RDW7_CRAGI4.207e-9436.38Uncharacterized protein OS=Crassostrea gigas GN=CG... [more]
tr|F7GHV2|F7GHV2_MONDO2.217e-9336.63Uncharacterized protein OS=Monodelphis domestica G... [more]
tr|Q6RYF9|Q6RYF9_HALCO2.706e-9334.13Macrophage expressed protein OS=Haliotis corrugata... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 40..59
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.542
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 31..50
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.847
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 12..155
e-value: 4.8E-14
score: 52.8
IPR020864Membrane attack complex component/perforin (MACPF) domainPROSITEPS51412MACPF_2coord: 1..159
score: 14.235

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020864MACPF
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000003Stage 3
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000058embryonic digestive system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034696 ID=SMED30034696|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2009bp
AGCGAAAATATGACTCGTTTTTCTGTTGCCAGTGCAACATTTATTTGGTT
TTTATTTTTCGGTTCCACACTAGCGGATGAAGCAGTCATTGAGCCGGATA
ACGTAATTCAGAACTCGAATTTTCCATCCAAACGTGTTGTAAATGATTGC
CACCTGACTAATGATCAGTATGCATTCAATGTCTTGCCGGGGTCCGGTTG
GGATAATCTTGCCAATCAAGAGTTAGGCCAGATTCTGAAATTATCCTATA
AAAACTGCAAATCTTCCAATGATGCCAGCTTCCTAATTCCCGATGAGGTT
TCAATGTCACCAGAAATGTTGTCTAATGTTCAATTGGATTCCGACCTAGT
CTCACATTTTTCAAAATACGATTCAATGACTTCCAAGTCTATTAACATTG
AAGCAAACGCCGCAACGCCAAATTATCAAGTCAGTGGATCGTTTTCTTTT
GAAAAGAAAGATGTTAAGAAAAATCAAATGAAAGAAAAATCCGAAATTTC
TCATACGCAACTGAGATACGAACTTCACCACCTTGCCTTTCAGCCAGACA
GTGAATTGGATCCTACCTTTCTCAATAGGGTCATTGACATGGGAATAGTT
TTGGAAAAAGAAAGTAAAAATACTTACTCAGAGTTTTGGCTGATTTGATC
GTAAGAGACTACGGAACTCATGTAATACGGTCTGTTGTCGCTGGAGCTAT
TCTTTCTAAAACTGATGTTCTCAAAGGCAATTTTATGTCCAAATCCAGGG
GAAATTCTATAAATGTTGCGGCCTCTGCCGCTGTAAGCATGAGAATGGCT
GTGGGAATTAAGATTGGAGGAGGTTATGGCAATTCTGAAACCAATGCCAC
GGAATATGAAAAGAATTGCGCAAGTTCAAGAATTAACACCTTTGGTGGAG
GACCATATGGTTCTAATTTCAAATTAGAAGATTGGGAAAAGACCCTTCCT
ACTAACCTTGTTACTATAGATCGTACTGGTGATCCTTTATATTACGTAAT
AACAAAAAGAAACGTACCGTATTTCAGTGACAAAACAATATTTAACATCA
ACACTTTGATTAAAAATGCAATCAACAGGTATTACTCAGCTAATTCTCGC
CCTGGATGCATGGATATTAAATCTGATAATTTTGATGAAAATGCTAACAT
TGACAATGGCATATGCCAAAATCCAGACGATAATTTCAAATTCGGAGGAG
TTTATCAATTTTGTTATGGGCTGAGTGCTAAATGTAAGGAACTGAACCAA
CTCAACCCAATCACTGGAACATCCTCATGTCCAGATGGATTTGACCCTGT
TGAGCTATTTTATGTATATAGTAATGAGAATAACGATGGTATGGTCATCA
ACACGTTTTGGTGTGCTCCTAATCAAAAATCAACTCATTCAAATGGATAT
TTATTTGGCGGGATTTTTACCGATGCATATCCGAACCCTGTTACTGGATC
TTCTAGTTGTCCACAATATTTTCTATCTTTGAAATTTGGACGTACCGCAA
AGATTTGCGTTTCACAGGATATCGAACTTGGAATGAAAAATAGTCTGCCT
TTTGGAGGGTTTTTCAGTTGTTCCATGGGGAATCCCTTGACACAGAAGAA
GACGACTAATTCTCCCGCTGACTATTGGACCCAATCATGCGCACCCGGTT
ATTCTGCACATTTGGCGGTCATCGAAATTAATTGTCAGATTTCATATTGT
ATCAAGAGTAACGCATTAAAAGGCAAAGAAGAAATTCCTCTTTATCGGCC
ACCATTCATTAATTTAGACGATGGAATTAAGTATAATTCTATAAAGAAAT
TTCAAACTACTTCCGGGATAGAATTGAAACTTTCCAAGGACGGAATGTGG
AATAAAGTGAAATATGTTCCTTTCGCAAGATCTAAATTTGGTTTAATTAT
TTTTTCCGAGGTTACCCTAATCTTGGTAATTATTGTTGTGGTTTTAATGG
TTTGTTGGTTTAAATCCCGTTAAAAGAAAAATTGTTTTAAATAAAGACAG
ATCGGAAGA
back to top

protein sequence of SMED30034696-orf-1

>SMED30034696-orf-1 ID=SMED30034696-orf-1|Name=SMED30034696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
SENMTRFSVASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDC
HLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEV
SMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSF
EKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIV
LEKESKNTYSEFWLI*
back to top

protein sequence of SMED30034696-orf-2

>SMED30034696-orf-2 ID=SMED30034696-orf-2|Name=SMED30034696-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MSKSRGNSINVAASAAVSMRMAVGIKIGGGYGNSETNATEYEKNCASSRI
NTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDK
TIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDN
FKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVELFYVYSNENN
DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLK
FGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQ
SCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKY
NSIKKFQTTSGIELKLSKDGMWNKVKYVPFARSKFGLIIFSEVTLILVII
VVVLMVCWFKSR*
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-2