Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30034696
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2 (E=1.71878e-94)
Length (bp)2009
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-2 ) is expressed during Stage 3 and Stage 4 in the embryonic digestive system and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30034696

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30034696SMESG000042502.1 Contig44775newmark_estsPMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
reproductive organSMED30034696SMESG000042502.1 Contig44775uc_Smed_v2PMID:28434803whole organismadult hermaphroditeRNA-sequencing evidence
embryonic pharynxSMED30034696 SMED30034696smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic pharynxSMED30034696 SMED30034696smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 258.84 bits (660), Expect = 1.684e-92
Identity = 143/404 (35.40%), Postives = 210/404 (51.98%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHV  SV AGA L + D L+ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L+     K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S H A+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 102.449 bits (254), Expect = 1.684e-92
Identity = 49/142 (34.51%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 235.343 bits (599), Expect = 5.786e-84
Identity = 144/447 (32.21%), Postives = 222/447 (49.66%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVEL-----------FYVYSNENNDGMV--------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKF-GRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVK 1862
            L++ +V DYGTHVI SV AGA L + D LK +++S S+ +  +V+ASA  +    V   IGG      + ++ Y+ N   S I + GG  +     L+ W+++   NLV IDR+G PL+Y +     P     T+  + + ++ A  RYY  N+ PGC+++ S NF+  AN+D+  C+ P  N  FGG+YQ C  L+      C E  Q NP TG  SCP  ++   L           +  +++ ++ G +                    + T WC+   K+  ++GYLFGG+F     NP+T SSSCP  + + +F      IC+S D E+G + S+PF GFFSC  GNPL+  ++           C P +S HLA I   CQ+ YC++S    G    P+  PPF    +   I  N++          +++ +  MW   K
Sbjct:  192 LSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNGQS----------RCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPFTRPPVVGMIATNTVAVMTEGERSWVRVGETKMWRLAK 628          

HSP 2 Score: 97.0561 bits (240), Expect = 5.786e-84
Identity = 50/153 (32.68%), Postives = 88/153 (57.52%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            C   +   A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+ +S V+ +S+++  + +  S TS S+N + +  +    ++  FS E + +K +Q+KE S  +  Q+R  L+ +   PD  LD  F  +  ++   +E
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIE 182          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 235.343 bits (599), Expect = 5.786e-84
Identity = 144/447 (32.21%), Postives = 222/447 (49.66%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVEL-----------FYVYSNENNDGMV--------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKF-GRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVK 1862
            L++ +V DYGTHVI SV AGA L + D LK +++S S+ +  +V+ASA  +    V   IGG      + ++ Y+ N   S I + GG  +     L+ W+++   NLV IDR+G PL+Y +     P     T+  + + ++ A  RYY  N+ PGC+++ S NF+  AN+D+  C+ P  N  FGG+YQ C  L+      C E  Q NP TG  SCP  ++   L           +  +++ ++ G +                    + T WC+   K+  ++GYLFGG+F     NP+T SSSCP  + + +F      IC+S D E+G + S+PF GFFSC  GNPL+  ++           C P +S HLA I   CQ+ YC++S    G    P+  PPF    +   I  N++          +++ +  MW   K
Sbjct:  192 LSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLSNGQS----------RCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPFTRPPVVGMIATNTVAVMTEGERSWVRVGETKMWRLAK 628          

HSP 2 Score: 97.0561 bits (240), Expect = 5.786e-84
Identity = 50/153 (32.68%), Postives = 88/153 (57.52%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            C   +   A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+ +S V+ +S+++  + +  S TS S+N + +  +    ++  FS E + +K +Q+KE S  +  Q+R  L+ +   PD  LD  F  +  ++   +E
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIE 182          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 214.542 bits (545), Expect = 7.787e-80
Identity = 144/476 (30.25%), Postives = 224/476 (47.06%), Query Frame = 3
Query:  624 LLRVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGL----SAKCKELNQLNPITGTSSCPDGFDPVEL--------FYVYSNENN-----------------------DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSC-PQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVKYVP----FARS-------KFGLIIF 1904
            L   L++ ++ DYGTHVI SV AGA L + D LK +++ K++ +  +V+ASA  +    V +      G   +  + Y+ N   S I + GG  +     L+ W+++   NLV IDR+G PL+Y +     P  S+  +  +   +  A  +YY  N+ PGC+++ S NF+  AN+D+  C+ P  N  FGG+YQ C  L    S  C E+ Q NP TG  SC   ++   L        +  Y  ++N                           ++T WC   QK    +GY+FGG++  +  NP T S +C P +F+     R   +C+S D     K+++PFGGFFSC  GNPL+  ++           C P +S HLA I   CQ+ YC++S    G +  P+  PP+ +  L      NS+      +G  + + +  MW     V     F RS        +GLI+ 
Sbjct:  188 LATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFDKVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQDNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLSNGES----------RCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPYTSPPLVGMTVTNSVVVMTDLNGSLVGVGQSRMWQPANPVEINQMFVRSGGKNAGVTYGLILL 653          

HSP 2 Score: 103.99 bits (258), Expect = 7.787e-80
Identity = 53/148 (35.81%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  139 VNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRV 582
            +N+CH  ++  A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+  + V+ +S+++  +    S TS SIN + +  +    ++G FS E + +K +Q+KE S  S  Q+R  L+ +   P+  LD  F  +V
Sbjct:   30 LNECHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQV 174          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 210.69 bits (535), Expect = 5.863e-77
Identity = 129/408 (31.62%), Postives = 193/408 (47.30%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVELFY--VYSNENN---------------------------DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQ-YFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            L++ ++ +YGTHVI S+ AGA L + D +K +++S +     +V+ASA ++    V    G       +    Y++N   S + + GG  +     ++ W+++   +LV IDR+G P++Y +     P     T+  +   ++ A  RYY+ N+ PGC D  S NF+  AN+++  C+ P  N  FGGVYQ C   S      C E  Q NP TG  +C   +    L    V    NN                               I+T+WC+ +Q    + GYLFGG+F  +  NP T S  CP  YF  +      +IC+S D E G  +S+PFGG FSC  GNP    +            C P YS HLA I   CQ+ YC++S    G +  P++ PPF
Sbjct:  189 LSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQY----------RCPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPF 586          

HSP 2 Score: 98.5969 bits (244), Expect = 5.863e-77
Identity = 57/189 (30.16%), Postives = 97/189 (51.32%), Query Frame = 1
Query:   40 FIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            +I+  FF      +  I P N ++           +C   ++  A  VLPG GWDNL N ++G+++ L+Y  C+++ D  +LIPDEV + P   S V+  S+ +  +    S TS SIN +A+  T    ++G FS E   +K +Q++  S  +  Q+R  L+ +   PD  LD  F  ++ ++   +E
Sbjct:    5 YIFLTFFVLFCKSDGFIRPSNGLR-----------ECRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLT---VLNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAIE 179          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 64.3142 bits (155), Expect = 2.223e-12
Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPE 315
            C   +   A  VLPG GWDNL N ++G+++ LSY  C+++ D  +LIPDEV + P+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQ 88          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 258.07 bits (658), Expect = 2.240e-93
Identity = 144/401 (35.91%), Postives = 209/401 (52.12%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK--CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L++ +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   Y +  +   +Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+D+  C     NF FGGVYQ C  LS    C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  200 LAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 600          

HSP 2 Score: 105.916 bits (263), Expect = 2.240e-93
Identity = 53/145 (36.55%), Postives = 89/145 (61.38%), Query Frame = 1
Query:  175 FNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
              VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S+++  +  Y S TS SIN E    +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F   ++D+   LEK
Sbjct:   50 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEK 191          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 258.84 bits (660), Expect = 1.077e-92
Identity = 148/407 (36.36%), Postives = 208/407 (51.11%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMV-------------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINL 1766
            LA+L++ +YGTH+I SV AGA L + D +K +++  ++GN   VAASA  +    V  KI  G+      AT Y +N   SR+ + GG P+     +E W+K +  +LV +DR G PL++ I    +P F    +  +   ++ A   YY+ N+ PGC +I S NFD  AN D+G C     N  FGGVYQ C  LS       C + +Q NP+TG  SCP  + PV L      +   GM                          ++++WCA + +   ++G LFGG+FTD   NP+T   SCP  +  LK     K+CVS D ELG K S+PFGGFFSC+ GNPL    T+      +   C  G+S  LA I   CQ+SYC+K+         P   PP+  L
Sbjct:  193 LAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECRDKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPLYGSFTSGDLEKSFLPKCPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          

HSP 2 Score: 102.834 bits (255), Expect = 1.077e-92
Identity = 49/143 (34.27%), Postives = 91/143 (63.64%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
            VLPG GWDNL N ++GQ++ L+Y NCK++ D  ++IPD+V   P+  SN++++S+++  +  Y S TS SIN+  +      +V+G FS E + +K  Q+++++  +  Q+R  ++ +   P++EL+  F   ++++   LEK
Sbjct:   45 VLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 267.314 bits (682), Expect = 1.719e-94
Identity = 145/404 (35.89%), Postives = 212/404 (52.48%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMV-------------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  S+ +   V ASA ++    V  K    Y +  T    Y  N  +SR+ +FGG P+     L+ W++ +  +LV +DR G PLY+ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C   S       C+ L Q NP+TG+ SCP G+ PV+L      E  + +                             FWCA + + + ++G LFGG+F+    NP+T + SCP  +  LK     K+C S D ELG + S+PFGGFFSC+ GNPL    T+        + C  G+S HLA+I   CQ+SYC+K+    G    P+  PP+
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHEEGYNHLECSRKCTLYIFCKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSATSKDLGAPSLRKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPY 596          

HSP 2 Score: 102.834 bits (255), Expect = 1.719e-94
Identity = 48/142 (33.80%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N + G++++L+Y +C+++ D  +++PDE+   P+  SN++++S ++  +  Y S TS SIN+E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   PD+EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 6.274e-93
Identity = 144/404 (35.64%), Postives = 211/404 (52.23%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L      K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S HLA+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGVPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 103.99 bits (258), Expect = 6.274e-93
Identity = 49/142 (34.51%), Postives = 92/142 (64.79%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL+ +F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 1.250e-92
Identity = 144/401 (35.91%), Postives = 209/401 (52.12%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK--CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L++ +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   Y +  +   +Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+D+  C     NF FGGVYQ C  LS    C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  193 LAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 593          

HSP 2 Score: 105.531 bits (262), Expect = 1.250e-92
Identity = 53/146 (36.30%), Postives = 89/146 (60.96%), Query Frame = 1
Query:  172 AFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
               VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S+++  +  Y S TS SIN E    +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F   ++D+   LEK
Sbjct:   42 VLEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 7.398e-92
Identity = 143/404 (35.40%), Postives = 210/404 (51.98%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVIN-------------------------TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHV  SV AGA L + D L+ +F+  S+ +   V ASA ++ +  V  K    Y +       Y  N  +SR+ + GG P+     L+ W++ +  +LV IDR+G PL++ I    +P      +  ++  ++ A+ RYY+ N+ PGC D+ S NF+  AN D+G C+    NF FGGVYQ C  LS       C++L Q NP+TG  SCP G+ PV L      E  + +  +                          FWC  + +   ++G LFGG+F+    NP+T + SCP  +  L+     K+CVSQD ELG + ++PFGGFFSC++GNPL     +        + C  G+S H A+I   CQ+SYC+KS    G    P   PPF
Sbjct:  193 LAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          

HSP 2 Score: 102.449 bits (254), Expect = 7.398e-92
Identity = 49/142 (34.51%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            VLPG GWDNL N ++G++++L+Y NC+++ D  ++IPDE+   P+  SN++++S+++  ++ Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P  EL   F   ++D+   LE
Sbjct:   45 VLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLE 183          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus OX=10116 GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 8.380e-92
Identity = 143/401 (35.66%), Postives = 208/401 (51.87%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLS--AKCKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGM-------------------------VINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            LA+L+V +YGTHVI SV AGA L + D ++ +F+  ++ +   V ASA ++    V  K+   + +       Y  N  +SR+ +FGG P+     LE W+K +  +LV IDR G PL++ I    +P      +  ++  ++ A+  YY+ N+ PGC ++ S NF+  AN+++  C     NF FGG+YQ C  LS  A C+ L Q N +TG  SCP G+ PV L      E    +                             +WC    +   ++G LFGG+FTD   NP+T + SCP  ++ L    + K+CVS D ELG K S+PFGGFFSC MGNPL    T         + C  G+S HLAVI   CQ+SYC+K+    G   +P+  PP+
Sbjct:  193 LAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHEEGYSRLECKKKCTLKIFCKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDIGAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPY 593          

HSP 2 Score: 106.686 bits (265), Expect = 8.380e-92
Identity = 63/196 (32.14%), Postives = 104/196 (53.06%), Query Frame = 1
Query:   22 SVASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEK 609
            S  +   IW +         A  E D  +++   P       C  T       VLPG GWDNL N ++G+++ L+Y NCK++ D  ++IPDEV   P+  SN++++S++   +  Y S TS SIN E +  +   +V+G FS E + +K  Q+K+++  +  Q+R  ++ +   P SEL   F N ++D+   LEK
Sbjct:    3 SFMAIALIWMMI--------ACAEADKPLRD---PGMTGFQTCKDTLKLPVLEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQLEK 184          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23441982 (tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=Mpeg1 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 1.945e-103
Identity = 151/421 (35.87%), Postives = 229/421 (54.39%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCY----GLSAKCKELNQLNPITGTSSCPDGFDPVEL---------------FYVYSNENNDGMVIN--TFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTN-----------------SPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKY 1784
            LA ++VRD+GTH + SV+AGA L+K D L   F++    +   + A+A+ S     G          +    +Y KN A S + TFGG P+  NF + +WE  +   LV +DR+GDPL++ IT  +VP  S++ +F + ++++ AI +YY  N+  GC  + S +F   AN+D+G C++P +N+ FGGVYQ C       S  C    Q NP+T   +C +G++PV +               ++++ + +      N  T+WC        + GYLFGG++++   NPVT   SCP  F +L+FG T  +CVS D ELG + S+PFGGFFSC+ GNPL  KK+++                 S +  W ++C  GYS HL  IE NC+I++C+KSN    K    + RPP+ N     KY
Sbjct:  208 LAQVLVRDFGTHYVTSVMAGAALAKVDHLTKKFVADFDEDKSKITAAASASFFGVFGASASYTQTTDKKVLDQYTKNTAYSTVYTFGGPPFRVNFTINEWEDQMADELVAVDRSGDPLHFAITHGSVPELSEELVFKLASVVEKAIKQYYEHNTIKGCTKMDSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEPVMVHQGRTPQTCHRECHGWWIFKSCDTYCGFANYYTYWCVAKGAVPPNTGYLFGGLYSNVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGFQQSVPFGGFFSCNTGNPLGVKKSSSRAKGSNGHSSLELFVKQSGSSVWPKTCPIGYSQHLGAIEENCEINFCVKSNVFNSKGFPIIKRPPYSNAPKIYKY 628          

HSP 2 Score: 130.954 bits (328), Expect = 1.945e-103
Identity = 64/164 (39.02%), Postives = 103/164 (62.80%), Query Frame = 1
Query:  145 DCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            +C L +  Y F VLPG GWDNL N  +G +  ++Y  CK+S+D  +LIPD+V + P   S V + +++  H++ Y S T+KSIN EA+       VSGS+S E + VKK+Q+++KS  +  QLR++L+ +  QPD+ L P F +R++++   L+  +   Y+ F
Sbjct:   45 NCPLASGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSKCKTSDDGKYLIPDDVFLYPVKESKVHVFAEMYDHWNNYSSTTTKSINAEASGTFGFGSVSGSYSSEFESVKKHQVEDKSVTTRAQLRHDLYTVKLQPDAPLQPAFKSRLLEIASHLQ-HNNTAYASF 207          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23535608 (tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expressed gene 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10885 PE=4 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 4.136e-98
Identity = 169/461 (36.66%), Postives = 234/461 (50.76%), Query Frame = 3
Query:  624 LLRVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYG-SNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSA-----KCKELNQLNPITGTSSCPDGFDPVEL------------------FYVYSNENNDGMVINT-----FWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLT-------QKKTTNSPA------------DYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGM-WNKV 1859
            + R  + L+VRD+GTHVI SV AGA L + D +K  +      +   V ASA+ S     GIK G  +  S     +Y  N   S  +T GG  +   NF L DW +++  NLV +DR GDPL++VIT   +P      ++ +   +K+AIN YY  N   GC +  S NF   AN+D+G CQ+  +N+ FGGVYQ C  LS       C +L Q+NP+TG  SCP  ++ V +                  F  +S    D     T     FWC    K    +GYLFGG+FT    NP+TG  +CP YF +LK   + ++CVS D ELG + S+PF GFFSC  GNPL        + K +N+               +W + C  GYS H+AV+   C+ISYCIK+NAL G+    + RPPF+ +        I  F   S +   +S+DG+ W  V
Sbjct:  204 MARYESQLLVRDFGTHVITSVDAGAALVQQDQIKTTYARSYSMDKSKVMASASASFGSVFGIKTGYDHSTSNEMIDQYLGNRTHSETDTIGGSVFQPQNFSLNDWAESVAENLVAVDRAGDPLHFVITPMALPELPSSVVYELIMHVKDAINLYYKHNIYKGCTNADSPNFSFQANVDDGTCQSLSNNYTFGGVYQTC-SLSGNIRSNTCADLRQMNPLTGDDSCPPNYEAVMIDKGIKRTPNTVRRCHSCGFLGFSTCCGDYAASQTASYTGFWCVTTGKVPADSGYLFGGLFTSTIGNPLTGGRTCPPYFYALKVSSSLRVCVSDDYELGYRYSVPFAGFFSCRTGNPLKLTSDEEDRHKRSNTDMFVLETFLKSAGPSHWPRGCPTGYSEHMAVVANGCEISYCIKANALSGEGLPTIVRPPFMEI-------PITGFSDNSSV--MISEDGLTWTDV 654          

HSP 2 Score: 112.849 bits (281), Expect = 4.136e-98
Identity = 49/149 (32.89%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  175 FNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKN 621
            + VLPG GWDNL N+  GQ++  +Y  C++++D  +L+PD ++  P   S ++  ++L +H+  Y S TS ++N EA     ++ + GSFS E   V+  QM ++S  +  Q+RY  +    QPD+  +P F  R++ +   + K   N
Sbjct:   55 YEVLPGGGWDNLRNKHGGQVIYYNYSLCQTTDDGQYLLPDGINTVPLKKSKLETFAELFTHWQNYTSTTSSTVNAEAGFHIEHFGIGGSFSHETGSVRSRQMMDESVTTRVQMRYVRYSAKLQPDTAFNPKFKARLLTIATQIAKNQTN 203          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17533042 (tr|A7SEK6|A7SEK6_NEMVE Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g115372 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 8.605e-98
Identity = 157/400 (39.25%), Postives = 218/400 (54.50%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNAT--EYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYG----LSAKCKELNQLNPITGTSSCPDGFDP------------------VELFYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN 1763
            LA ++VRD+GTH + SV AGA+L+K D L   F++ S  +   + ASA+ S     G    G Y  S    T  EY K    S   T+GG P+  NF + +WE  +   LV +DR+GDPL+Y IT  ++P   ++  F +  ++KNAI +YY  N+  GC  + S NF   AN+D+G CQ+P +N+ FGGVYQ C       S  C  L Q NP+T   +C  G++P                  V LF+   +        +T+WC        ++GYLFGG+++D   NP+T   SCP  F +LKFG T K+CVS D ELG + SLPFGGFFSC+ GNPL  KK          + C  G+S HL  IE NC+I YC+KSN    +    + RPP+++
Sbjct:  153 LAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGA--SGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLAFKKPPTG-----DKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYLS 545          

HSP 2 Score: 108.612 bits (270), Expect = 8.605e-98
Identity = 61/152 (40.13%), Postives = 92/152 (60.53%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            VLPG GWDNL N  +G +  ++Y  C+SS+D  FL+PD V + P   S V   ++   H++ Y S T+KSIN EA A+     VSGSFS E + VKK+Q+++K+  +  QLR+  +    QPDS L P F +R++++   L+  +   Y+ F
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQ-HNNTAYASF 152          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17596605 (tr|Q6RYF8|Q6RYF8_HALRU Macrophage expressed protein OS=Haliotis rufescens OX=6454 PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.005e-95
Identity = 145/419 (34.61%), Postives = 213/419 (50.84%), Query Frame = 3
Query:  630 RVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPY-GSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK-----CKELNQLNPITGTSSCPDGFDPVE-------------------LFYVYSNEN--NDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADY----------------WTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            R  ++L+VRD+GTHV+ SV AGA L + D +   F++  +     + A A+ S      I +      S    T YEK+ +SS+I+T GG  +  SNF   DW   +   LV +DR+GDPL+++I   ++P   +  ++ +  L++  I  YY  N+  GC ++ S NF   AN+D+G C++P  N  FGGVYQ C   S       C  L+Q+NP TG  +CPDG++ VE                   LF+   ++N  +        WCA     +  +GYLFGG++T    NP+T   +CP  F +   G+   IC+S D ELGMK S+PFGGF SC+ GNPL       S  D                 W + C  GYS HLA ++  C+I+YC+ + +L       + RPPF
Sbjct:  197 RYDSELLVRDFGTHVVTSVDAGAALVQEDQVSSEFVNSRKFTKNQITAGASASFLGIFSIDVSYHSSTSNEVKTAYEKSRSSSQIDTLGGPMFKASNFTANDWTNEVDHELVAVDRSGDPLFFLINSASLPELPNSVLYQLQNLVEETILHYYEFNTYRGCTELDSPNFSPAANLDDGTCKSPYTNLTFGGVYQTCSMSSGSNNGDLCSGLDQVNPKTGGHTCPDGYESVELHTGRLSDSKSVHSCHSCWLFFKCCHDNYYHSEATYIMHWCAATGPVSQDSGYLFGGLYTSQLNNPLTQGKTCPVNFYTRTLGKDLHICISDDYELGMKYSMPFGGFISCTTGNPLAMNPKPKSKGDMNSALPSLHSFFQGSKTWPKHCPKGYSQHLAYVDQGCEINYCLLAGSLSEVGLPKIRRPPF 615          

HSP 2 Score: 126.331 bits (316), Expect = 1.005e-95
Identity = 69/190 (36.32%), Postives = 106/190 (55.79%), Query Frame = 1
Query:   40 FIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQY-AFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
             + F+F  S +A     E  N +Q   FP K  V  C+  N +   F VLPG GWDNL N + G ++  +Y  C+++ D  FLIPD V+  P   S + + ++L+SH+S Y S T+  +NI+A     + +VSG+FS   + VK  Q+ +KS  +  QLRY  +    QPD+ L PTF +R++ +   L+
Sbjct:    1 MLCFVFGVSIVAGVIGGELLNTVQKPEFP-KGDVRACYGDNKKLERFEVLPGQGWDNLRNVDAGLVVVYNYSRCRTTEDGRFLIPDTVNTIPLKASKLNVYAELISHWSNYTSTTAHGVNIDAGLKFGSVKVSGTFSSGYESVKSKQIGDKSYTTRVQLRYVRYSAKLQPDAALHPTFKSRLLSIAGSLQ 189          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|24192121 (tr|A0A3M6UEL2|A0A3M6UEL2_9CNID MACPF domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00004721 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 2.465e-95
Identity = 165/449 (36.75%), Postives = 229/449 (51.00%), Query Frame = 3
Query:  639 ADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGN--SETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYG-----LSAKCKELNQLNPITGTSSCPDGFDPVELFYVYSNEN------------------------------------NDGMV-INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLT-------QKKTTNSPADY----------WTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKF 1802
            A L+VR+YGTH+I SV AGA L +   +K N + K +  S +    AA +      +K G G+G+  S  N  ++EK+  +SR+ T+GG PY S F +++WE +L   LV IDR+GDPLYYVI    +P   + T+F +  +++ A   YY  N+  GC D  S  F+ +AN+++G C     NF FGGVYQ CY          C EL   NP+TG  SCP+G++ VEL    S E                                     +  MV I  +WCA       ++G LFGG++T   PNPVTG+ SCP  F +L FG  + +CVS D ELG + SL FGGFFSCS GNPL        QK    +P               QSC  GY+ HL  ++  C+I+YC+K+N+L       + RPP+ N   G+   + K  
Sbjct:  204 AQLLVREYGTHIITSVDAGAALVQETHIKENVL-KDKSLSAHDLKVAATATFFR-SLKFGAGFGHNVSNENVHKFEKSRTASRVLTYGGPPYRSKFSVQNWENSLTNELVAIDRSGDPLYYVINSATLPSLPEPTVFRLAKIVQRAARLYYKVNTVAGCTDETSPRFNFDANVNDGSCHATQTNFTFGGVYQKCYASRFNSAGNLCDELQHKNPLTGDFSCPEGYEAVELLKPQSGERPVVTKSYHHTHCRKLCRPCGFFLLQDCCHTSCQNIFHYSMVYIAPYWCAAAMTVGENSGMLFGGVYTSHDPNPVTGAQSCPHRFYALPFGSHSHVCVSDDYELGYQFSLRFGGFFSCSSGNPLAVPNKNHQQKSGKTTPKTSPKGNLAGIVNGPQSCPRGYTQHLLSVDNECEINYCVKANSLAKLSRTAVRRPPY-NARPGVSPKATKTL 649          

HSP 2 Score: 102.834 bits (255), Expect = 2.465e-95
Identity = 53/153 (34.64%), Postives = 88/153 (57.52%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            C   +D     VLPG GWDNL N E+GQ+L  +Y  CK++ D  +L+PD   + P   S V + S++   ++ Y S T+ SIN+ A+ +     VSGSF+ + K  K+ Q+ +K+  +  QLR+ ++ +   P+S L P F +R++ +   L+
Sbjct:   45 CFFFHDVNTLEVLPGFGWDNLLNIEMGQVLATNYSRCKTTADGKYLLPDNAFVIPVKRSKVDMSSEVFDRWNSYTSTTAHSINLHASYSV----VSGSFAEDFKYNKEKQVGDKAVTTRVQLRHFMYVVKTHPESSLHPVFKSRLMQIAAELQ 193          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: ENSAMXT00000015822.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:8259512:8262317:1 gene:ENSAMXG00000015374.2 transcript:ENSAMXT00000015822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.18 bits (583), Expect = 1.927e-74
Identity = 153/456 (33.55%), Postives = 221/456 (48.46%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSD---KTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGF-----------DPVELFYVYSNENNDGMV--------------------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTA-KICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN--LDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVKYVPFAR 1880
            L++ +V DYGTHVI SV AGA L + D LK +++S ++ +  +V+ASA  +    V   IG     + +    Y  N   S   + GG  +     L+ W+++   NLV IDR+G PL+Y +   N   FSD    T+  +  L+  AI RYY  N+RPGC+   S NFD  AN+D+  C+ P  N  FGGVYQ C  L+      C+EL   NP TG+ SC   +            P + +   ++ ++ G +                    INT+WCA N  +   +GYLFGGIF  ++ NP+T S SCP  F +  F     KIC+S D E   K S+PFGGFFSC   N L   ++           C P +S HLA I   CQI +C++S    G E  P++ PPF    +   +  N++          +++    MW   K    A+
Sbjct:  135 LSEKLVLDYGTHVITSVDAGATLEEEDYLKSSYVSDTQSSQSSVSASAGANFFNKVQFDIGSKESQTTSETRNYLGNVTYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFL---NPSVFSDLPLPTVNKLALLVSQAIERYYKVNTRPGCVKPDSRNFDFQANVDDASCEGPSTNLSFGGVYQQCTPLTPDGDVICQELASTNPATGSYSCKQPYIATLLRSETQERPYDQYVCNTHCHDCGFLGLFTCCDQVCGNVYHVRRAQINTYWCATNGATPEFSGYLFGGIFGPSFQNPLTKSRSCPSNFFAQTFLSNGFKICLSSDYETATKFSVPFGGFFSCQSTNLLAGGQS----------HCPPQFSQHLATITDGCQILFCVQSGIFTGGELKPIHLPPFTRPPVISILATNTVAVMTEGDQAWVRVKDTKMWKVAKTADIAK 577          

HSP 2 Score: 71.2478 bits (173), Expect = 1.927e-74
Identity = 38/128 (29.69%), Postives = 75/128 (58.59%), Query Frame = 1
Query:  223 LGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            +G+++ +SY  C+++ D  +LIPDEV + P+ +S V+++S+++S + +  S TS SIN + +  +    ++  FS E + +K +Q+   S  +  Q+R  L+ +   PD  LD  F  +V ++   +E
Sbjct:    1 MGRVMNMSYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQRSSTSGSINADGSFFS---VLNCKFSAENQRMKTHQVNYNSVTARVQVRNHLYTVKAYPDFSLDSRFAQQVEEIADAIE 125          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 218.394 bits (555), Expect = 7.455e-72
Identity = 146/445 (32.81%), Postives = 212/445 (47.64%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLS----AKCKELNQLNPITGTSSCPDGF-----------DPVELFYVYSN-------------ENNDGMV-------INTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTA-KICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVK 1862
            L++ +V DYGTHVI SV  GA L + D LK +++S ++ +  +V+ASA  +    V   IG       +    Y+ N   S   + GG  +     L+ W+++   NLV IDR+G PL+Y +     P     T+  +   +  AI RYY  N+ PGC+   S NF+  AN+D+  C+ P+ N  FGGVYQ C  L+    A C+EL   NP TG+ SC   +            P + +  + +             EN  G V       I T+WCA N  +   +GYLFGG+F  +  NP+T S SCP  F +  F  +  KIC+S D E   + S+PFGGFFSC   N L   ++           C P +S HL  I   CQI +C++S    G E +P+  PPF           +     T+ + +    D  W +VK
Sbjct:  135 LSEKMVLDYGTHVITSVDTGATLVEEDYLKSSYVSDAQSSQSSVSASAGANFFDKVKFDIGTKDSQGTSETRNYQGNITYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFPDLPLPTVNKLAVSVSQAIERYYKVNTHPGCVKPDSKNFNFQANVDDASCEGPNTNLSFGGVYQQCTPLNSYGDAICQELASKNPATGSYSCQQPYIATLLRSETQERPYDQYVCHRHCYGCGFLWLDTCCENICGNVYHVRRAQIKTYWCATNGATPEFSGYLFGGLFGPSLQNPLTKSRSCPPNFFTQTFLSSGFKICLSNDYEAATRFSVPFGGFFSCQSTNQLAGSQS----------RCPPQFSQHLVAISDGCQILFCVQSGIFTGGELLPIRLPPFTR-------PPVISMIATNTVAVMTEGDQAWVRVK 562          

HSP 2 Score: 73.559 bits (179), Expect = 7.455e-72
Identity = 39/128 (30.47%), Postives = 75/128 (58.59%), Query Frame = 1
Query:  223 LGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            +G+++ +SY  C+++ D  +LIPDEV + P+ +S V+++S+++S + +  S TS SIN + +  +    V+  FS E + +K +Q+K  S  +  Q+R  L+ +   PD  LD  F  +  ++   +E
Sbjct:    1 MGRVMNISYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQKSSTSSSINADVSFFS---VVNAKFSTENQRMKTHQVKGNSVTARVQVRNHLYTVKAYPDFTLDSRFARQAEEIADAIE 125          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO37879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK6])

HSP 1 Score: 280.411 bits (716), Expect = 1.781e-101
Identity = 157/400 (39.25%), Postives = 218/400 (54.50%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNAT--EYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYG----LSAKCKELNQLNPITGTSSCPDGFDP------------------VELFYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFIN 1763
            LA ++VRD+GTH + SV AGA+L+K D L   F++ S  +   + ASA+ S     G    G Y  S    T  EY K    S   T+GG P+  NF + +WE  +   LV +DR+GDPL+Y IT  ++P   ++  F +  ++KNAI +YY  N+  GC  + S NF   AN+D+G CQ+P +N+ FGGVYQ C       S  C  L Q NP+T   +C  G++P                  V LF+   +        +T+WC        ++GYLFGG+++D   NP+T   SCP  F +LKFG T K+CVS D ELG + SLPFGGFFSC+ GNPL  KK          + C  G+S HL  IE NC+I YC+KSN    +    + RPP+++
Sbjct:  153 LAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGA--SGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLAFKKPPTG-----DKGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQGLPIVRRPPYLS 545          

HSP 2 Score: 108.612 bits (270), Expect = 1.781e-101
Identity = 61/152 (40.13%), Postives = 92/152 (60.53%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            VLPG GWDNL N  +G +  ++Y  C+SS+D  FL+PD V + P   S V   ++   H++ Y S T+KSIN EA A+     VSGSFS E + VKK+Q+++K+  +  QLR+  +    QPDS L P F +R++++   L+  +   Y+ F
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQ-HNNTAYASF 152          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO28266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Y8])

HSP 1 Score: 83.9593 bits (206), Expect = 1.268e-19
Identity = 48/104 (46.15%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  181 VLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKS 492
            VLPG GWDNL N  +G +  ++Y  C+SS+D  FLIPD V + P   S V   ++   H++ Y S T+KSIN EA A+     VSGSFS E + VKK+Q+++K+
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLIPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKT 105          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: MPEG1 (macrophage-expressed gene 1 protein [Source:NCBI gene;Acc:101169041])

HSP 1 Score: 254.988 bits (650), Expect = 4.458e-88
Identity = 152/444 (34.23%), Postives = 227/444 (51.13%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDP--------------------------VELFYVYSNENND-----GMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKF-GRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGMWNKV 1859
            L++ +V D+GTHVI SV AGA LS+ D L+ +++S S  +S ++ ASA ++    +   I   Y    +    Y+ N   S I + GG P+     L+ W+++   NLV IDR+G PL+Y+I    +      T+  +   +  AI RYY  N+RPGC+D+ + N++  AN+D+  C+ P  N  FGGVYQ C  LS+     C+EL Q NP TG  SC   + P                          + LF  +  +  D        I T+WC+ N K+  S+GYLFGGI++ + PNP+T + SCP  ++SL+F     +ICVSQD EL  + S+PFGG FSC   NPL   +          + C PGYS HL  +   C+I YC++S    G + +P++ PPF           +   Q T+ + +    D  W +V
Sbjct:  220 LSEKMVVDFGTHVITSVDAGASLSQEDYLRSSYVSNSVSDSSSIKASAGLNFFDKLKFDISSDYTQKSSTLQNYQSNITYSIIQSHGGTPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINTNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCKGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPNTGDFSCRSPYTPTLLRSEVRQKGYTTYDCYDIRYSCGFLGLFTCHRKQCQDNYHVRSARILTYWCSVNGKAPESSGYLFGGIYSPSSPNPITNAKSCPANYISLRFLSDGQRICVSQDYELATRFSVPFGGLFSCESVNPLANNQ----------RRCPPGYSQHLGTVSDGCEILYCVQSGLFTGGKLLPIHLPPFTKA-------PLVSMQATNTVMVMTEGDNSWVRV 646          

HSP 2 Score: 90.8929 bits (224), Expect = 4.458e-88
Identity = 58/193 (30.05%), Postives = 100/193 (51.81%), Query Frame = 1
Query:   28 ASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            AS     FLFF +  ++  V  P N ++       R   +  LT    A  VLPG GWDNL N ++G+++  SY  C+++ D  +LIPDEV + P   + V+ +S+++S +      T+ SIN + +       ++  FS E   +K +Q+K+ S  +  Q+R  ++ +   PD  LD  F ++V ++   +E
Sbjct:   31 ASLLLCAFLFFHTCFSN-PVSRPTNWLRQC-----RASTNLSLT----ALEVLPGGGWDNLRNMDMGRVMNFSYFQCQTTEDGLYLIPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSFLP---VLNAKFSVEITRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIADAIE 210          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: ENSORLT00000006104.2 (pep primary_assembly:ASM223467v1:9:9652430:9669002:1 gene:ENSORLG00000027013.1 transcript:ENSORLT00000006104.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 257.684 bits (657), Expect = 6.730e-86
Identity = 147/410 (35.85%), Postives = 213/410 (51.95%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAK----CKELNQLNPITGTSSCPDGFDPVEL-----------------------FYVYS--------NENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKF-GRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPF 1757
            L++ +V D+GTHVI SV AGA LS+ D L  +++S S  + I + A      ++     I   Y    +    Y+ N   S I + GG P+     L+ W+++   NLV IDR+G PL+Y+I    +      T+  +   +  AI RYY  N+RPGC+D+ + N++  AN+D+  C+ P  N  FGGVYQ C  LS+     C+EL Q NPITG  SC   + P+ L                        Y+Y+        N +     I T+WC+ N  +  ++GYLFGGI++ + PNP+T + SCP  ++SLKF     +ICVSQD EL    S+PFGG FSC   NPL   +          + C PGYS HL  +   C+I YC++S    G E +P++ PPF
Sbjct:  192 LSEKMVLDFGTHVITSVDAGASLSQEDYLHSSYVSVSDRSLIKLQAGLNFYDKLK--FDISSNYTQKSSTLQNYQSNITYSIIQSHGGAPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINSNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCEGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPITGDFSCRYPYTPLLLRSEVRQEGYTTRDCYDIIYSCGFLYLYTCQREQCQDNYSVRSARILTYWCSVNGTAPENSGYLFGGIYSPSSPNPITNAKSCPANYISLKFLSDGQRICVSQDYELANNFSVPFGGLFSCESVNPLANNQ----------RRCPPGYSQHLGTVSNGCEILYCVQSGLFTGGELLPIHLPPF 589          

HSP 2 Score: 81.2629 bits (199), Expect = 6.730e-86
Identity = 55/193 (28.50%), Postives = 97/193 (50.26%), Query Frame = 1
Query:   28 ASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLE 606
            AS     FLFF +  ++  V  P N ++       R   +  L     A  VLPG GWDNL N ++G+++   Y  C+++ D  +L PDEV + P   + V+ +S+++S +      T+ SIN + +       ++  FS E   +K +Q+K+ S  +  Q+R  ++ +   PD  LD  F ++V ++   +E
Sbjct:    3 ASLLLCVFLFFPTCFSN-PVSRPTNWLRQC-----RASTNLSLK----ALEVLPGGGWDNLRNMDMGRVMNFGYFQCQTTKDGLYLNPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSDLP---VLNAKFSSEIIRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIVDAIE 182          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020344.1 (SMESG000020344.1)

HSP 1 Score: 416.387 bits (1069), Expect = 8.793e-169
Identity = 207/407 (50.86%), Postives = 274/407 (67.32%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVELFYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGMWNK 1856
            LADLIVR++GTHVI SV AGA+LSK D+LK  ++  S+  + +V+ +A+ S+    G K G  + N +T   EY  NCAS+RI T GGGP+GS+F LE+WEKTL TNLV IDR G+PLY VITK N+P FSDKTI+ IN L+K AI +YYS N+R GCMD  S +FDENAN+++G+C    + + FGGVYQ C   S KC   NQ NP TG  SCP  F+P++LF +      D   I   WCAP   S+  NGYLFGG++T+ YPN VT + +CPQY+  +++G + KIC++QD ELG KNSLPFGGF+SC  GNPL      N     +  +C  GYS HLA I  NC  SYC+K+NA+K K   PLYRPPF++L        + +  T++G++L L++DG+W +
Sbjct:  168 LADLIVREFGTHVITSVDAGAVLSKIDILKQKYVLDSQVQNSDVSVAASFSLGQICGFKFGSNFKNDDTKIEEYNNNCASTRIKTIGGGPFGSDFSLEEWEKTLDTNLVAIDRIGEPLYNVITKHNIPEFSDKTIYEINLLVKTAIEKYYSTNTRLGCMDFNSHSFDENANVNSGLCNETGNTYPFGGVYQTCQN-SDKCDTYNQKNPATGDYSCPKAFNPIKLFEL------DNPSITFVWCAPRSSSSAINGYLFGGMYTEQYPNLVTNNHNCPQYYFPVQYGISGKICITQDKELGGKNSLPFGGFYSCKTGNPLAL-AIYNGTQTNFPLTCGSGYSTHLASIFNNCHYSYCVKNNAIKTKAATPLYRPPFVDLQMDSNIEVVSELTTSAGMKLVLAEDGIWKE 566          

HSP 2 Score: 197.978 bits (502), Expect = 8.793e-169
Identity = 90/167 (53.89%), Postives = 126/167 (75.45%), Query Frame = 1
Query:  136 VVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            + + C LTN++Y FNVLPGSGWDNL+N+E  Q+LK+SY  CK+SND  FLIPD+  + P+M S VQLDS+L+SHFSKY S TSKSIN EA+  T  Y +SGSFS E++DVK+NQ+  KS IS +QLRY+L+ ++   D+ELD  F  R++++G+++E +  + YS +
Sbjct:    1 MAHGCQLTNNEYPFNVLPGSGWDNLSNREQAQVLKISYDKCKASNDGRFLIPDQTKLVPKMKSIVQLDSNLISHFSKYPSTTSKSINAEASGETKKYSISGSFSNEREDVKRNQLNSKSSISQSQLRYDLYKISHIVDAELDTKFHQRILNIGVLIETKKDSLYSAY 167          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000071519.1 (SMESG000071519.1)

HSP 1 Score: 394.815 bits (1013), Expect = 6.199e-166
Identity = 199/442 (45.02%), Postives = 290/442 (65.61%), Query Frame = 3
Query:  630 RVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVEL--------------FYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPAD--YWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVKYVPFARSKFGLIIFS 1907
            + LADLIVRD+GTHVIRSV AGA L KTDVLK  +++K +G++  +AA+A+ SM   +G+ I G Y +   +  EY  N AS+++ T GG P+GSNFKLEDWEK+L +NLV IDR G+PL+Y IT R++P F DKT+  I TLIKNA+NRYY+AN+R GCM+++S+NF+++ANID G C+ P   +  GG +Q C G   +C+ +   NPIT + +CP  +  VEL              F+   N + +      +WCA  + +T S G LFGG +++ YPNP+T + +CPQY+   +FG    IC++ +    M++ LPFGGF+SC +GNPL+ K   N+  D  YW++ CA GYS+H+A++   CQISYCIK+NAL  +E+ PL+RPPF++L  G         +T +G++L + ++G W++ K      S + +IIFS
Sbjct:  197 QYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSKYVNKFKGDTTTIAAAASFSMTKVLGVTIKGNYFSDTASLDEYNNNSASTKVETVGGRPFGSNFKLEDWEKSLDSNLVAIDRRGNPLFYAITPRSLPEFDDKTVNKIVTLIKNAVNRYYAANTRVGCMNMESENFNDDANIDGGNCETPKSYYTLGGTFQTCKGPDYQCENVAGKNPITNSYACPANYKTVELESGLSKCEKVCVRTFWFSYNCHYECSYYALYWCAATKATTKSEGSLFGGFYSNTYPNPITNAYNCPQYYYPSRFGMVGTICLAFNRAETMEHHLPFGGFYSCKVGNPLSDKFVDNTTQDPKYWSEGCATGYSSHVAIVNRGCQISYCIKNNALSKREQPPLFRPPFVDLGFGPNATITTSLETPTGLKLSVDENGKWSENK--KSKSSNYNIIIFS 636          

HSP 2 Score: 210.305 bits (534), Expect = 6.199e-166
Identity = 100/171 (58.48%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  112 NSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNT 624
            N + PS+R V+ C LTN QYAF++LPGSGWDNL N+ELGQ+L++SYK C +SND SFLIPD   + P   S V+L SD+  HFS + S TSKSIN +A+ ATP+YQ+SGSFS+EKKDVK +Q+KEKS +S  QLR+E + ++FQPDS+ D  F NR++D+G +L KE K+T
Sbjct:   24 NRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLTSNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALL-KEGKDT 193          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020345.1 (SMESG000020345.1)

HSP 1 Score: 349.362 bits (895), Expect = 3.067e-165
Identity = 174/325 (53.54%), Postives = 234/325 (72.00%), Query Frame = 3
Query:  630 RVLADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVELFY-VYSNE------------NNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFF 1565
            + LADLIVRDYGTHVIRSV AGAILSK D+LK  ++SK +G+   ++ +A+ S+  A+G+KIGG   N+E+   EY KNCASS+INT GGGPYGSNF+L +WEKT+  NLV IDR GDPL++VITKR++P F D T++ I  LIK+AI RYY  N+R GCMDIKSDNFD NAN++NGICQ+   ++ FGGVYQ C G S  C+ L Q NP TG++SCP G++   +++ +YS +            NN    I+++WCAP+ K    + YLFGG ++  +PNP+T S +CPQ F++L+FG ++ +CV+ D  LG K SLPFGGF+
Sbjct:  173 QYLADLIVRDYGTHVIRSVDAGAILSKVDILKAEYLSKHKGSQTTISLAASGSLNSAIGLKIGGSNKNNESEVREYNKNCASSKINTIGGGPYGSNFQLAEWEKTIQKNLVPIDRIGDPLFHVITKRSLPEFDDITVYKIGNLIKDAITRYYKINTRSGCMDIKSDNFDVNANVNNGICQDSKISYVFGGVYQTCEGNS--CENLIQTNPATGSTSCPAGYNATLVYHGLYSEQTICTYYVFSTVCNNFQTYISSYWCAPDPKKNPESVYLFGGFYSKVFPNPITNSFTCPQSFIALRFGHSSWVCVTSDSVLGRKFSLPFGGFY 495          

HSP 2 Score: 253.447 bits (646), Expect = 3.067e-165
Identity = 112/173 (64.74%), Postives = 141/173 (81.50%), Query Frame = 1
Query:  118 NFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNTYSEF 636
            N PS R+V+ CHLT  QY FNVLPGSGWDNLAN+E GQ+ K+SY NC  SND  FLIPD + ++P M S VQ+DSD+VSHFSKY S TSKSIN+E +A+TPNY++SGSFS+EKKD+K+NQMKEKS IS  QLRYEL+H+AFQPDS+LDP F NR+I +G+++E +    YS++
Sbjct:    2 NLPSSRIVHKCHLTKTQYPFNVLPGSGWDNLANKESGQVYKISYDNCSGSNDGRFLIPDSIIITPYMKSKVQMDSDMVSHFSKYTSTTSKSINLEVSASTPNYEISGSFSWEKKDIKENQMKEKSSISKVQLRYELYHVAFQPDSKLDPIFKNRIIQLGVLMETQKNYLYSQY 174          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044682.1 (SMESG000044682.1)

HSP 1 Score: 285.804 bits (730), Expect = 5.879e-117
Identity = 171/447 (38.26%), Postives = 232/447 (51.90%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGN--SETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVEL-------------FYVYSNENNDGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLKFGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPA----------DYWTQSCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKYNSIKKFQTTSGIELKLSKDGMWNKVKYVPFARSKFGLII 1901
            LAD+IVRDYGTHVIR++ AGAILSKTD L   ++ K   +S     S + S       KI G Y    S+TN  E+  N   + I+T GG  +G+N  L DWE ++  NLV IDR G+PLYY IT R +P     T+  +  L+K AI RYY AN R GC+DI S NF+ +ANID+G C++P  NF FGG YQ C G    C    Q+NP+TG  SCP GF  ++L             ++ + + +       TFWC P     + NGY FGGI             SCP  ++ LK   + +ICV+ D +     ++ FGGFFSCS GNPL ++     P            YW ++CA GY AH+  IE  CQISYC ++N +       + +PPFI+ +       +  F+   G  +     G W   K     R K  ++I
Sbjct:  198 LADMIVRDYGTHVIRAIDAGAILSKTDALNSRYVKKYASDS--STISVSASASFLGMFKISGRYQTKTSQTNIDEFNHNADKTHIDTVGGAIFGANMSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQTTVHKVTELLKKAILRYYMANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCGG--PACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQFGGI----------RQGSCPIGYIPLKVALSTEICVTVDADPFNPYAIKFGGFFSCSAGNPLAKEYVNKKPKLPSNSKMEGLLYWPKTCAKGYVAHIVSIEQGCQISYCTETNKVSLGPLPLIIKPPFISTNYNPNSTKVFLFKNKKGETIIKDDLGYW---KIEQLERQKRDILI 627          

HSP 2 Score: 155.992 bits (393), Expect = 5.879e-117
Identity = 71/156 (45.51%), Postives = 110/156 (70.51%), Query Frame = 1
Query:  148 CHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDM-GIVLEKE 612
            CHL ++Q  F+VLPGSGWDNLAN  +G+IL L++  C  SND  +LIP+++++ P+  S V++ S++  HFS Y SM+S+SIN++A     ++++ GSFS E   +K +QM+ KS ++  QLRY +    F+PD+ L PTF NR+ID+ G+V+E +
Sbjct:   35 CHLRSNQLTFDVLPGSGWDNLANVGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPQKTSQVEISSEIFRHFSNYTSMSSQSINLDAEGLFGHWKIGGSFSTENTKIKSDQMETKSILTRVQLRYLVFQSMFEPDTPLYPTFKNRIIDIAGLVIENK 190          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000067839.1 (SMESG000067839.1)

HSP 1 Score: 220.32 bits (560), Expect = 5.806e-112
Identity = 106/207 (51.21%), Postives = 151/207 (72.95%), Query Frame = 3
Query:  636 LADLIVRDYGTHVIRSVVAGAILSKTDVLKGNFMSKSRGNSINXXXXXXXXXXXXXGIKIGGGYGNSETNATEYEKNCASSRINTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDKTIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDNFKFGGVYQFCYGLSAKCKELNQLN 1256
            LADLIVRD+GTHVIRSV AGA L KTDVLK N++   +G++  +AA+A+ SM   + + + G Y    T+  E+  N AS+++ TFGG P+GSNF+LE+WEKTL TNLV IDR G+PL Y IT +N+P F ++ +F I TLIK A+NRYY+AN+R GCM+++S+NF+++AN+D G C++P   + FGG +Q C G   +C+ + + N
Sbjct:  203 LADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSINEFNNNSASTKVETFGGRPFGSNFRLEEWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGTCEHPKSYYNFGGTFQNCSGNVDQCESITEKN 409          

HSP 2 Score: 204.912 bits (520), Expect = 5.806e-112
Identity = 103/196 (52.55%), Postives = 139/196 (70.92%), Query Frame = 1
Query:   37 TFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDCHLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEVSMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSFEKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIVLEKESKNT 624
            + I F+F    L+    IEP       + PS R V++C LT++QY  NVLPGSGWDNL N+ELGQ+L++SYK C  SND SFLIPD V ++P   S V+L SD+  HFS   S T+ SIN +A+ +TP+Y++SGSFSFEK  +K +Q+KEKS IS +QLR+EL+ +AFQP S+LD  F NR++D+G +L KE K+T
Sbjct:    8 SIILFIFVYGVLSVSCEIEP-----YRDQPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALL-KEGKDT 197          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.684e-9235.40macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpeg1.15.786e-8432.21macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.15.786e-8432.21macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.37.787e-8030.25macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.25.863e-7731.62macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.12.223e-1244.64macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mpeg12.240e-9335.91macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
Pfpl1.077e-9236.36pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJC3|MPEG1_BOVIN1.719e-9435.89Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|Q5RBP9|MPEG1_PONAB6.274e-9335.64Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|A1L314|MPEG1_MOUSE1.250e-9235.91Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
sp|Q2M385|MPEG1_HUMAN7.398e-9235.40Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q9WV57|MPEG1_RAT8.380e-9235.66Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234419821.945e-10335.87tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expresse... [more]
gnl|BL_ORD_ID|235356084.136e-9836.66tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expresse... [more]
gnl|BL_ORD_ID|175330428.605e-9839.25tr|A7SEK6|A7SEK6_NEMVE Predicted protein (Fragment... [more]
gnl|BL_ORD_ID|175966051.005e-9534.61tr|Q6RYF8|Q6RYF8_HALRU Macrophage expressed protei... [more]
gnl|BL_ORD_ID|241921212.465e-9536.75tr|A0A3M6UEL2|A0A3M6UEL2_9CNID MACPF domain-contai... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000015822.21.927e-7433.55pep primary_assembly:Astyanax_mexicanus-2.0:6:8259... [more]
MPEG17.455e-7232.81macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378791.781e-10139.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282661.268e-1946.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG14.458e-8834.23macrophage-expressed gene 1 protein [Source:NCBI g... [more]
ENSORLT00000006104.26.730e-8635.85pep primary_assembly:ASM223467v1:9:9652430:9669002... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020344.18.793e-16950.86SMESG000020344.1[more]
SMESG000071519.16.199e-16645.02SMESG000071519.1[more]
SMESG000020345.13.067e-16553.54SMESG000020345.1[more]
SMESG000044682.15.879e-11738.26SMESG000044682.1[more]
SMESG000067839.15.806e-11251.21SMESG000067839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034696 ID=SMED30034696|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2009bp
AGCGAAAATATGACTCGTTTTTCTGTTGCCAGTGCAACATTTATTTGGTT
TTTATTTTTCGGTTCCACACTAGCGGATGAAGCAGTCATTGAGCCGGATA
ACGTAATTCAGAACTCGAATTTTCCATCCAAACGTGTTGTAAATGATTGC
CACCTGACTAATGATCAGTATGCATTCAATGTCTTGCCGGGGTCCGGTTG
GGATAATCTTGCCAATCAAGAGTTAGGCCAGATTCTGAAATTATCCTATA
AAAACTGCAAATCTTCCAATGATGCCAGCTTCCTAATTCCCGATGAGGTT
TCAATGTCACCAGAAATGTTGTCTAATGTTCAATTGGATTCCGACCTAGT
CTCACATTTTTCAAAATACGATTCAATGACTTCCAAGTCTATTAACATTG
AAGCAAACGCCGCAACGCCAAATTATCAAGTCAGTGGATCGTTTTCTTTT
GAAAAGAAAGATGTTAAGAAAAATCAAATGAAAGAAAAATCCGAAATTTC
TCATACGCAACTGAGATACGAACTTCACCACCTTGCCTTTCAGCCAGACA
GTGAATTGGATCCTACCTTTCTCAATAGGGTCATTGACATGGGAATAGTT
TTGGAAAAAGAAAGTAAAAATACTTACTCAGAGTTTTGGCTGATTTGATC
GTAAGAGACTACGGAACTCATGTAATACGGTCTGTTGTCGCTGGAGCTAT
TCTTTCTAAAACTGATGTTCTCAAAGGCAATTTTATGTCCAAATCCAGGG
GAAATTCTATAAATGTTGCGGCCTCTGCCGCTGTAAGCATGAGAATGGCT
GTGGGAATTAAGATTGGAGGAGGTTATGGCAATTCTGAAACCAATGCCAC
GGAATATGAAAAGAATTGCGCAAGTTCAAGAATTAACACCTTTGGTGGAG
GACCATATGGTTCTAATTTCAAATTAGAAGATTGGGAAAAGACCCTTCCT
ACTAACCTTGTTACTATAGATCGTACTGGTGATCCTTTATATTACGTAAT
AACAAAAAGAAACGTACCGTATTTCAGTGACAAAACAATATTTAACATCA
ACACTTTGATTAAAAATGCAATCAACAGGTATTACTCAGCTAATTCTCGC
CCTGGATGCATGGATATTAAATCTGATAATTTTGATGAAAATGCTAACAT
TGACAATGGCATATGCCAAAATCCAGACGATAATTTCAAATTCGGAGGAG
TTTATCAATTTTGTTATGGGCTGAGTGCTAAATGTAAGGAACTGAACCAA
CTCAACCCAATCACTGGAACATCCTCATGTCCAGATGGATTTGACCCTGT
TGAGCTATTTTATGTATATAGTAATGAGAATAACGATGGTATGGTCATCA
ACACGTTTTGGTGTGCTCCTAATCAAAAATCAACTCATTCAAATGGATAT
TTATTTGGCGGGATTTTTACCGATGCATATCCGAACCCTGTTACTGGATC
TTCTAGTTGTCCACAATATTTTCTATCTTTGAAATTTGGACGTACCGCAA
AGATTTGCGTTTCACAGGATATCGAACTTGGAATGAAAAATAGTCTGCCT
TTTGGAGGGTTTTTCAGTTGTTCCATGGGGAATCCCTTGACACAGAAGAA
GACGACTAATTCTCCCGCTGACTATTGGACCCAATCATGCGCACCCGGTT
ATTCTGCACATTTGGCGGTCATCGAAATTAATTGTCAGATTTCATATTGT
ATCAAGAGTAACGCATTAAAAGGCAAAGAAGAAATTCCTCTTTATCGGCC
ACCATTCATTAATTTAGACGATGGAATTAAGTATAATTCTATAAAGAAAT
TTCAAACTACTTCCGGGATAGAATTGAAACTTTCCAAGGACGGAATGTGG
AATAAAGTGAAATATGTTCCTTTCGCAAGATCTAAATTTGGTTTAATTAT
TTTTTCCGAGGTTACCCTAATCTTGGTAATTATTGTTGTGGTTTTAATGG
TTTGTTGGTTTAAATCCCGTTAAAAGAAAAATTGTTTTAAATAAAGACAG
ATCGGAAGA
back to top

protein sequence of SMED30034696-orf-1

>SMED30034696-orf-1 ID=SMED30034696-orf-1|Name=SMED30034696-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
SENMTRFSVASATFIWFLFFGSTLADEAVIEPDNVIQNSNFPSKRVVNDC
HLTNDQYAFNVLPGSGWDNLANQELGQILKLSYKNCKSSNDASFLIPDEV
SMSPEMLSNVQLDSDLVSHFSKYDSMTSKSINIEANAATPNYQVSGSFSF
EKKDVKKNQMKEKSEISHTQLRYELHHLAFQPDSELDPTFLNRVIDMGIV
LEKESKNTYSEFWLI*
back to top

protein sequence of SMED30034696-orf-2

>SMED30034696-orf-2 ID=SMED30034696-orf-2|Name=SMED30034696-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MSKSRGNSINVAASAAVSMRMAVGIKIGGGYGNSETNATEYEKNCASSRI
NTFGGGPYGSNFKLEDWEKTLPTNLVTIDRTGDPLYYVITKRNVPYFSDK
TIFNINTLIKNAINRYYSANSRPGCMDIKSDNFDENANIDNGICQNPDDN
FKFGGVYQFCYGLSAKCKELNQLNPITGTSSCPDGFDPVELFYVYSNENN
DGMVINTFWCAPNQKSTHSNGYLFGGIFTDAYPNPVTGSSSCPQYFLSLK
FGRTAKICVSQDIELGMKNSLPFGGFFSCSMGNPLTQKKTTNSPADYWTQ
SCAPGYSAHLAVIEINCQISYCIKSNALKGKEEIPLYRPPFINLDDGIKY
NSIKKFQTTSGIELKLSKDGMWNKVKYVPFARSKFGLIIFSEVTLILVII
VVVLMVCWFKSR*
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0035915pore formation in membrane of other organism
GO:0042742defense response to bacterium
GO:0045087innate immune response
GO:0050829defense response to Gram-negative bacterium
GO:0050830defense response to Gram-positive bacterium
Vocabulary: cellular component
TermDefinition
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045335phagocytic vesicle
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
Vocabulary: INTERPRO
TermDefinition
IPR039707MPEG1
IPR020864MACPF
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000004Stage 4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31463:SF4MACROPHAGE-EXPRESSED GENE 1 PROTEINcoord: 42..215
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.847
IPR039707Macrophage-expressed gene 1 proteinPANTHERPTHR31463FAMILY NOT NAMEDcoord: 42..215