Transportin-3

Overview
NameTransportin-3
Smed IDSMED30034693
Length (bp)3071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transportin-3 (SMED30034693) t-SNE clustered cells

Violin plots show distribution of expression levels for Transportin-3 (SMED30034693) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transportin-3 (SMED30034693) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transportin-3 (SMED30034693) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034693

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30034693SMESG000033219.1 SmedASXL_016834SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transportin-3 vs. Ensembl Human
Match: TNPO3 (transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103])

HSP 1 Score: 298.13 bits (762), Expect = 1.041e-85
Identity = 264/1000 (26.40%), Postives = 465/1000 (46.50%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQLAPIF-EQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE    +   + ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ                          L+    +L   L  P +  GL++     L + P + +   + ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVRLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQHFNG----------------------LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 922          
BLAST of Transportin-3 vs. Ensembl Human
Match: TNPO3 (transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103])

HSP 1 Score: 291.967 bits (746), Expect = 3.168e-83
Identity = 266/1030 (25.83%), Postives = 471/1030 (45.73%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQLAPIF-EQLITIMTCHCAVTE-----SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQS-ENAAWTEQLL-----------TQVILPCLGQAQPSFKDV------------------AFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE    +   + ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD  +   NA     LL            + + P L +  P+  +V                  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ                          L+    +L   L  P +  GL++     L + P + +   + ELC + V  + +L+  +  + +     DP V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPKKPFSNAVCRHSLLFGQNITSEISNCEYLPPVLRENNPTLVEVLEGVVRLPETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQHFNG----------------------LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISS---DPTVFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 956          
BLAST of Transportin-3 vs. Ensembl Human
Match: TNPO3 (transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103])

HSP 1 Score: 291.967 bits (746), Expect = 3.168e-83
Identity = 266/1030 (25.83%), Postives = 471/1030 (45.73%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQLAPIF-EQLITIMTCHCAVTE-----SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQS-ENAAWTEQLL-----------TQVILPCLGQAQPSFKDV------------------AFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE    +   + ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD  +   NA     LL            + + P L +  P+  +V                  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ                          L+    +L   L  P +  GL++     L + P + +   + ELC + V  + +L+  +  + +     DP V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPKKPFSNAVCRHSLLFGQNITSEISNCEYLPPVLRENNPTLVEVLEGVVRLPETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQHFNG----------------------LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISS---DPTVFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 956          
BLAST of Transportin-3 vs. Ensembl Human
Match: TNPO3 (transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103])

HSP 1 Score: 253.832 bits (647), Expect = 1.423e-70
Identity = 241/939 (25.67%), Postives = 425/939 (45.26%), Query Frame = 1
Query:  238 MRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQLAPIF-EQLITIMTCHCAVTE-----SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            M+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE    +   + ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ                          L+    +L   L  P +  GL++     L + P + +   + ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    1 MKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVRLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQHFNG----------------------LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 856          
BLAST of Transportin-3 vs. Ensembl Human
Match: TNPO3 (transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103])

HSP 1 Score: 182.185 bits (461), Expect = 1.382e-46
Identity = 117/334 (35.03%), Postives = 195/334 (58.38%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAG 1038
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAG 332          

HSP 2 Score: 134.806 bits (338), Expect = 1.735e-31
Identity = 101/374 (27.01%), Postives = 174/374 (46.52%), Query Frame = 1
Query: 1876 ELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:  519 ELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 858          
BLAST of Transportin-3 vs. Ensembl Celegans
Match: tsr-1 (pep chromosome:WBcel235:II:2460866:2473370:-1 gene:WBGene00006647.1 transcript:F53G2.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tsr-1)

HSP 1 Score: 79.337 bits (194), Expect = 8.608e-15
Identity = 58/208 (27.88%), Postives = 96/208 (46.15%), Query Frame = 1
Query: 2056 SDQNEAAIQAATQPYLTAYYQVMEYLWP--------------VLADLIDCFISDGRVLERVVRILRYSLRC----FQTL---TKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVE 2616
            S  NEA    AT+P L  +     Y+W               V+   ID  +   R  E   R++ +S+R     F+ L   + P +E +   ++  Y   + S +LY+  ++VDE+G  D  + GL+QM    +   F +L G+G   +P+T +DLFRL  R   R +  F +    ++  LF  AV +I   + DA     +F++E
Sbjct:  506 SKANEAWASLATRPML--WIDRCAYVWTSGSKQPPAEIPWFTVIQQCIDALLKSTRKFEGTPRLIEHSIRSCRLIFRALGAQSMPFVEPVVTMMIETYPKHRHSSYLYLASVIVDEYGQLDKMRPGLLQMLDTLARHTFPLLVGQGAINHPDTVDDLFRLAQRFTMRATSIFFTDPVSEL--LFICAVLNIRLDHPDANRSVNKFIME 709          
BLAST of Transportin-3 vs. Ensembl Celegans
Match: tsr-1 (pep chromosome:WBcel235:II:2460842:2473370:-1 gene:WBGene00006647.1 transcript:F53G2.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tsr-1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.581e-14
Identity = 57/219 (26.03%), Postives = 96/219 (43.84%), Query Frame = 1
Query: 1960 PCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVE 2616
            P +WID  + +F               + +  S Q  A I     P+ T   Q ++ L          F    R++E  +R  R   R     + P +E +   ++  Y   + S +LY+  ++VDE+G  D  + GL+QM    +   F +L G+G   +P+T +DLFRL  R   R +  F +    ++  LF  AV +I   + DA     +F++E
Sbjct:  517 PMLWIDRCACVFKD-------------VWTSGSKQPPAEI-----PWFTVIQQCIDALLKSTRK----FEGTPRLIEHSIRSCRLIFRALGAQSMPFVEPVVTMMIETYPKHRHSSYLYLASVIVDEYGQLDKMRPGLLQMLDTLARHTFPLLVGQGAINHPDTVDDLFRLAQRFTMRATSIFFTDPVSEL--LFICAVLNIRLDHPDANRSVNKFIME 711          
BLAST of Transportin-3 vs. Ensembl Fly
Match: Tnpo-SR (gene:FBgn0031456 transcript:FBtr0077715)

HSP 1 Score: 257.299 bits (656), Expect = 1.256e-71
Identity = 245/990 (24.75%), Postives = 439/990 (44.34%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVL---EQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFC-----NDIHTIPQLVQQFQI--NTYQLEAAYQI-CAYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGT-NRECCALVLDILIDVTDSRNFRLDETRSQL-APIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQS--ISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSD-----QNEAAIQAATQPYLTAYYQ-----VMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGE-GLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAH----IPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQ---DSQVLEGLETFAKLF 2982
            A+ +L + Q+S Y+W+IAD+LL+  +DL  +YF AQTMRNKIQ  F ELP  +H SL++SL+ H+  ++  T+  ++TQLSLA+ADL   M  W+  +++++ T +     I  LL+VLK +PEE  +R LRLG NR+ E+  +LD  +  V++ L    Q   L+   V        ++W +I+ F    + N  +    + +L  P   S  L   A +C            D  + P+   + Q+      LE  Y +  A+   D  ++Y +IF  +  A    +L     D        + L ++LL  G  + E   +   +   +++    R ++  + L  P  E+LI+ +  H  +        E+  N   FR  V  +++ +   V     F++M   L        Q   + +   EA L ++ ++ K +  +++E        + + IL    Q   + +  A  + GELC W       ++ ++  +  + L+ K   +       A   AL S+   C+++               +CH                            I GLVE+ ++ ++         QIN D    L+K  S  ++R+PR+   P +  + +      + ++V      P  G +++D         AI   T P +    +     ++   W +++ ++D + SD R++ER  R++RY +R  +     L+E + +++V  Y+    SCFLYVG ILVDEF     C  GL++M  AF  P F +LQ E GL  NP+T +D FRL  R +  C P  L   SL +  +F  A+ +    + +A +  ++F +        N+ +      P+ V          + +L +A ++             ++ D+ ++L  ++ +   +     L  AL+ +      G V ATQ Q+ +  S++L+      + + L+TF +LF
Sbjct:   28 ANKWLQDFQKSIYSWTIADELLHQKRDLHANYFAAQTMRNKIQNSFSELPPHTHESLRDSLITHIGQIDEQTDNVIVTQLSLAVADLALLMASWREPINDLLVTLAPHQCAIWPLLEVLKVLPEEIDSRYLRLGANRREEVHKQLDASAECVLKFLCMCLQREDLDQQRVWNAALRTYSAWLVIHAFPVSHVYNNALTQLAFRLLSLPE-TSGKLHDNATECVCALLSCINTRQDGASDPESSFEAQLFGAVCMLETPYHLSVAHEDTDKTINYCRIFTSLCDAFFYDLLA----DAQKPHYSLKGLDLVLLCVGHFDYEVAEITFHLWYKLSEDLFQRNEDKLTVLFRPHIERLISALFRHSQMESDHDGLIEENNNFFDFRRKVSDLIKDVAFIVGSGACFKQMFHIL--------QAPETTWESTEAALFIMQNVAKNILPDENE----VIPKVVEAILNMSEQTHIAVRYTAILLIGELCDWIENHPESLEAVLNFLL-YALQQKNGLA------PAAAIALTSICSACRQK--------------MVCH----------------------------ISGLVEIARSLDSF--------QINNDVAIGLLKGISLILTRLPREQLQPALR-EIVGFQLQPLAQLVDSTGSTPQKG-ERTDPVYWIDRACAIIRHTNPDVPDNVEHPTVAILNDAWQLISRVMDKYQSDLRIMERTCRLIRYGIRMVRKQAMMLVEPLIKQMVVLYSVQHHSCFLYVGSILVDEFAKSSECIGGLLEMLQAFIEPTFGLLQMENGLKNNPDTVDDFFRLASRYLD-CCPHQLLQSSL-ITPIFQCALIACSLDHREANSSVMKFFINLLVWGRSNNHSRNTECRPLVVELASQHGGALVMNLIQASVFQLH--------SYMLVDVAEVLHELKQVVGNERMQPFLAQALEALPKKNSGGYVTATQQQLDEFSSTVLRADTTKAISQALKTFTRLF 931          
BLAST of Transportin-3 vs. Ensembl Fly
Match: Tnpo-SR (gene:FBgn0031456 transcript:FBtr0335126)

HSP 1 Score: 257.299 bits (656), Expect = 1.256e-71
Identity = 245/990 (24.75%), Postives = 439/990 (44.34%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVL---EQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFC-----NDIHTIPQLVQQFQI--NTYQLEAAYQI-CAYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGT-NRECCALVLDILIDVTDSRNFRLDETRSQL-APIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQS--ISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSD-----QNEAAIQAATQPYLTAYYQ-----VMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGE-GLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAH----IPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQ---DSQVLEGLETFAKLF 2982
            A+ +L + Q+S Y+W+IAD+LL+  +DL  +YF AQTMRNKIQ  F ELP  +H SL++SL+ H+  ++  T+  ++TQLSLA+ADL   M  W+  +++++ T +     I  LL+VLK +PEE  +R LRLG NR+ E+  +LD  +  V++ L    Q   L+   V        ++W +I+ F    + N  +    + +L  P   S  L   A +C            D  + P+   + Q+      LE  Y +  A+   D  ++Y +IF  +  A    +L     D        + L ++LL  G  + E   +   +   +++    R ++  + L  P  E+LI+ +  H  +        E+  N   FR  V  +++ +   V     F++M   L        Q   + +   EA L ++ ++ K +  +++E        + + IL    Q   + +  A  + GELC W       ++ ++  +  + L+ K   +       A   AL S+   C+++               +CH                            I GLVE+ ++ ++         QIN D    L+K  S  ++R+PR+   P +  + +      + ++V      P  G +++D         AI   T P +    +     ++   W +++ ++D + SD R++ER  R++RY +R  +     L+E + +++V  Y+    SCFLYVG ILVDEF     C  GL++M  AF  P F +LQ E GL  NP+T +D FRL  R +  C P  L   SL +  +F  A+ +    + +A +  ++F +        N+ +      P+ V          + +L +A ++             ++ D+ ++L  ++ +   +     L  AL+ +      G V ATQ Q+ +  S++L+      + + L+TF +LF
Sbjct:   28 ANKWLQDFQKSIYSWTIADELLHQKRDLHANYFAAQTMRNKIQNSFSELPPHTHESLRDSLITHIGQIDEQTDNVIVTQLSLAVADLALLMASWREPINDLLVTLAPHQCAIWPLLEVLKVLPEEIDSRYLRLGANRREEVHKQLDASAECVLKFLCMCLQREDLDQQRVWNAALRTYSAWLVIHAFPVSHVYNNALTQLAFRLLSLPE-TSGKLHDNATECVCALLSCINTRQDGASDPESSFEAQLFGAVCMLETPYHLSVAHEDTDKTINYCRIFTSLCDAFFYDLLA----DAQKPHYSLKGLDLVLLCVGHFDYEVAEITFHLWYKLSEDLFQRNEDKLTVLFRPHIERLISALFRHSQMESDHDGLIEENNNFFDFRRKVSDLIKDVAFIVGSGACFKQMFHIL--------QAPETTWESTEAALFIMQNVAKNILPDENE----VIPKVVEAILNMSEQTHIAVRYTAILLIGELCDWIENHPESLEAVLNFLL-YALQQKNGLA------PAAAIALTSICSACRQK--------------MVCH----------------------------ISGLVEIARSLDSF--------QINNDVAIGLLKGISLILTRLPREQLQPALR-EIVGFQLQPLAQLVDSTGSTPQKG-ERTDPVYWIDRACAIIRHTNPDVPDNVEHPTVAILNDAWQLISRVMDKYQSDLRIMERTCRLIRYGIRMVRKQAMMLVEPLIKQMVVLYSVQHHSCFLYVGSILVDEFAKSSECIGGLLEMLQAFIEPTFGLLQMENGLKNNPDTVDDFFRLASRYLD-CCPHQLLQSSL-ITPIFQCALIACSLDHREANSSVMKFFINLLVWGRSNNHSRNTECRPLVVELASQHGGALVMNLIQASVFQLH--------SYMLVDVAEVLHELKQVVGNERMQPFLAQALEALPKKNSGGYVTATQQQLDEFSSTVLRADTTKAISQALKTFTRLF 931          
BLAST of Transportin-3 vs. Ensembl Fly
Match: CG10950 (gene:FBgn0034205 transcript:FBtr0086990)

HSP 1 Score: 80.4925 bits (197), Expect = 3.997e-15
Identity = 61/224 (27.23%), Postives = 108/224 (48.21%), Query Frame = 1
Query:   85 IDILHHVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNK--DLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNP-TVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNN--DIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSP 741
            ID ++ + SGN++ A+ +L   Q+SN  W IA+++L      D+    F A ++  KI+  F  L     +SLK SL+ HL       +  +++ QL++ ++ L     QW   L + +   S+  + +  LL+VLK IPEE    +L +   +   +   L+ +S  +++VLE  L   +  D  L KC     SW   ++     +L  ++      IL +P
Sbjct:   11 IDAVNMLSSGNISLANEYLAAFQKSNDTWIIAEEILSYRPPHDMHILTFAAMSLAKKIKTSFYSLQKFQLMSLKNSLIDHLKYAAMMRDSNSLIVQLAVGISALGLMFSQWDYELQDFVRKLSENPQYVMALLEVLKVIPEETRPSNLPVEAKKLNSVIDTLEQQSPYILDVLEGLLQRPDLPDDALPKCLAVCASWTKFSMLSPDQVLQRKLFIMAEFILATP 234          
BLAST of Transportin-3 vs. Ensembl Fly
Match: cdm (gene:FBgn0261532 transcript:FBtr0083619)

HSP 1 Score: 68.9366 bits (167), Expect = 2.304e-11
Identity = 53/212 (25.00%), Postives = 103/212 (48.58%), Query Frame = 1
Query:   79 ESIDILHHVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPT-VLTQLSLALADLFCHMV-QWKNGLDEIITTY-SQKAETIP------ILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIV--------LIKCFECLNSWF 663
            E++   +   S N      +LT+ + S  AW  + QL+ + K     +FGA T+ +K+  H+ E+P E+   LK+ +++ +  V  +  P  VL +L ++L     HM+ +W   ++E+I T+ +Q+   +       I+L+VL  IPEE   + +   V R   +  E+  +   V+  +E+ L L  + V        + +  +C+ +W 
Sbjct:   11 EAVVSFYRSNSQNQAITHEWLTDAEASPQAWQFSWQLMQLGKSQEVQFFGAITLHSKLMKHWHEVPPENREELKQKILESI--VRFAGGPKIVLNRLCISLGAYIVHMLGEWPGAIEEVINTFQNQRMPNVSADVQLWIMLEVLTAIPEE--AQVIHTSVKRVV-LRAEIAKRVQLVIHTVERYLKLQMNRVWDAEAYSNMNRAVKCVGTWI 217          
BLAST of Transportin-3 vs. Ensembl Fly
Match: cdm (gene:FBgn0261532 transcript:FBtr0336472)

HSP 1 Score: 68.9366 bits (167), Expect = 2.304e-11
Identity = 53/212 (25.00%), Postives = 103/212 (48.58%), Query Frame = 1
Query:   79 ESIDILHHVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPT-VLTQLSLALADLFCHMV-QWKNGLDEIITTY-SQKAETIP------ILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIV--------LIKCFECLNSWF 663
            E++   +   S N      +LT+ + S  AW  + QL+ + K     +FGA T+ +K+  H+ E+P E+   LK+ +++ +  V  +  P  VL +L ++L     HM+ +W   ++E+I T+ +Q+   +       I+L+VL  IPEE   + +   V R   +  E+  +   V+  +E+ L L  + V        + +  +C+ +W 
Sbjct:   11 EAVVSFYRSNSQNQAITHEWLTDAEASPQAWQFSWQLMQLGKSQEVQFFGAITLHSKLMKHWHEVPPENREELKQKILESI--VRFAGGPKIVLNRLCISLGAYIVHMLGEWPGAIEEVINTFQNQRMPNVSADVQLWIMLEVLTAIPEE--AQVIHTSVKRVV-LRAEIAKRVQLVIHTVERYLKLQMNRVWDAEAYSNMNRAVKCVGTWI 217          
BLAST of Transportin-3 vs. Ensembl Zebrafish
Match: tnpo3 (transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708])

HSP 1 Score: 309.686 bits (792), Expect = 4.312e-90
Identity = 272/1006 (27.04%), Postives = 464/1006 (46.12%), Query Frame = 1
Query:   58 PTVEATLESIDILHH-VKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQ--SLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTI-------PQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQL---------APIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT+    +++  L+H         AS +L ELQ+S YAW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH +L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  +I  YS    ++  L+++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L      S +++ +LIK F CL SWF + +  +  + N +++  ++ +L+     S +L +AA  C     C+ ++ I       P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L + +  P        GD RTL++LL+ AG  +         +++++ +  +RL E   ++          P  ++L+  +  HC +        ED  +   FR  V  +++ +   V     F ++   L +    +P      +   EAVL ++ S+ K VD     N    E L   V+LP       + +  +  + GE+         ++D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ +              V   +               + L + P E +A  + +LC + V  + +L+   S S       DP VW+D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   SD R++ER  R LR+++RC    +  LL+ +  ++V+ Y     SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R VQR SP  L   S+ V+ +   A+ +    + DA    ++F+ +  +    ND +    VR R +G    +    L   LI  C +     T  D+ E + ++++  R       F   L++ L  +      G V  T  Q+    K  +S  +  QV   +  F +L+
Sbjct:    6 PTLPLVYQAVQALYHDPDPAGKERASVWLGELQRSMYAWEISDQLLQLKQDIESCYFAAQTMKMKIQTSFYELPPDSHTALRDSLLSHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLIEKYSNDVSSMTFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSTTVVTLLVTCAEKSGHDEKMLIKVFRCLGSWFNLGVLDNNFMANNQLLMILFQVLRDET--STNLHEAASDCV----CSALYAIENVAIHLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEMTVRTP----GQGMGDLRTLELLLICAGHPQY-------EVVEISFNFWYRLGEHLYKINDPALHNVFRPYIQRLLHSLARHCQLDPDHEGVPEDTDDFGEFRMRVSDLVKDVIFLVGSMECFAQLYSTLRE---GNPP-----WEVTEAVLFIMASIAKNVDPEN--NPTLMEVLEQIVLLP--ETVHLAVRYTSIELVGEMSEVIDRNPSMLDTVLNFLMKGLREKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFQGLLDIARSLDSFALSTDAAVGLLKGTA------------LVLARLPLEKIAECLNDLCAVQVMALKKLLAQDSSS---GKSSDPTVWLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNAHQSDNRIVERCCRCLRFAVRCVGKGSASLLQPLVTQMVSVYQLYPHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCMPTFQLLEQPNGLRNHPDTVDDLFRLATRFVQR-SPVTLLSSSIIVH-IIQCAIAATTLDHRDANCSVMKFIRDLIHTGVTNDHEDDFEVRKRLIGQAMEQHGQQLVNQLINTCCFCLPPYTLPDVAEVLWEIMVFDRP-----TFCRWLETTLKGLPKETAGGAVTVTHKQLTDFHKQVTSAEECKQVCWAIREFTRLY 921          
BLAST of Transportin-3 vs. Ensembl Zebrafish
Match: tnpo3 (transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708])

HSP 1 Score: 309.301 bits (791), Expect = 7.450e-90
Identity = 272/1006 (27.04%), Postives = 465/1006 (46.22%), Query Frame = 1
Query:   58 PTVEATLESIDILHH-VKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQ--SLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTI-------PQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQL---------APIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT+    +++  L+H         AS +L ELQ+S YAW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH +L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  +I  YS    ++  L+++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L      S +++ +LIK F CL SWF + +  +  + N +++  ++ +L+  +  S +L +AA  C     C+ ++ I       P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L + +  P        GD RTL++LL+ AG  +         +++++ +  +RL E   ++          P  ++L+  +  HC +        ED  +   FR  V  +++ +   V     F ++   L +    +P      +   EAVL ++ S+ K VD     N    E L   V+LP       + +  +  + GE+         ++D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ +              V   +               + L + P E +A  + +LC + V  + +L+   S S       DP VW+D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   SD R++ER  R LR+++RC    +  LL+ +  ++V+ Y     SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R VQR SP  L   S+ V+ +   A+ +    + DA    ++F+ +  +    ND +    VR R +G    +    L   LI  C +     T  D+ E + ++++  R       F   L++ L  +      G V  T  Q+    K  +S  +  QV   +  F +L+
Sbjct:    6 PTLPLVYQAVQALYHDPDPAGKERASVWLGELQRSMYAWEISDQLLQLKQDIESCYFAAQTMKMKIQTSFYELPPDSHTALRDSLLSHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLIEKYSNDVSSMTFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSTTVVTLLVTCAEKSGHDEKMLIKVFRCLGSWFNLGVLDNNFMANNQLLMILFQVLQR-DETSTNLHEAASDCV----CSALYAIENVAIHLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEMTVRTP----GQGMGDLRTLELLLICAGHPQY-------EVVEISFNFWYRLGEHLYKINDPALHNVFRPYIQRLLHSLARHCQLDPDHEGVPEDTDDFGEFRMRVSDLVKDVIFLVGSMECFAQLYSTLRE---GNPP-----WEVTEAVLFIMASIAKNVDPEN--NPTLMEVLEQIVLLP--ETVHLAVRYTSIELVGEMSEVIDRNPSMLDTVLNFLMKGLREKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFQGLLDIARSLDSFALSTDAAVGLLKGTA------------LVLARLPLEKIAECLNDLCAVQVMALKKLLAQDSSS---GKSSDPTVWLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNAHQSDNRIVERCCRCLRFAVRCVGKGSASLLQPLVTQMVSVYQLYPHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCMPTFQLLEQPNGLRNHPDTVDDLFRLATRFVQR-SPVTLLSSSIIVH-IIQCAIAATTLDHRDANCSVMKFIRDLIHTGVTNDHEDDFEVRKRLIGQAMEQHGQQLVNQLINTCCFCLPPYTLPDVAEVLWEIMVFDRP-----TFCRWLETTLKGLPKETAGGAVTVTHKQLTDFHKQVTSAEECKQVCWAIREFTRLY 922          
BLAST of Transportin-3 vs. Ensembl Zebrafish
Match: tnpo3 (transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708])

HSP 1 Score: 307.375 bits (786), Expect = 2.283e-89
Identity = 266/979 (27.17%), Postives = 454/979 (46.37%), Query Frame = 1
Query:   58 PTVEATLESIDILHH-VKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQ--SLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTI-------PQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQL---------APIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI 2910
            PT+    +++  L+H         AS +L ELQ+S YAW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH +L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  +I  YS    ++  L+++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L      S +++ +LIK F CL SWF + +  +  + N +++  ++ +L+  +  S +L +AA  C     C+ ++ I       P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L + +  P        GD RTL++LL+ AG  +         +++++ +  +RL E   ++          P  ++L+  +  HC +        ED  +   FR  V  +++ +   V     F ++   L +    +P      +   EAVL ++ S+ K VD     N    E L   V+LP       + +  +  + GE+         ++D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ +              V   +               + L + P E +A  + +LC + V  + +L+   S S       DP VW+D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   SD R++ER  R LR+++RC    +  LL+ +  ++V+ Y     SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R VQR SP  L   S+ V+ +   A+ +    + DA    ++F+ +  +    ND +    VR R +G    +    L   LI  C +     T  D+ E + ++++  R       F   L++ L  +      G V  T  Q+
Sbjct:    6 PTLPLVYQAVQALYHDPDPAGKERASVWLGELQRSMYAWEISDQLLQLKQDIESCYFAAQTMKMKIQTSFYELPPDSHTALRDSLLSHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLIEKYSNDVSSMTFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSTTVVTLLVTCAEKSGHDEKMLIKVFRCLGSWFNLGVLDNNFMANNQLLMILFQVLQR-DETSTNLHEAASDCV----CSALYAIENVAIHLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEMTVRTP----GQGMGDLRTLELLLICAGHPQY-------EVVEISFNFWYRLGEHLYKINDPALHNVFRPYIQRLLHSLARHCQLDPDHEGVPEDTDDFGEFRMRVSDLVKDVIFLVGSMECFAQLYSTLRE---GNPP-----WEVTEAVLFIMASIAKNVDPEN--NPTLMEVLEQIVLLP--ETVHLAVRYTSIELVGEMSEVIDRNPSMLDTVLNFLMKGLREKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFQGLLDIARSLDSFALSTDAAVGLLKGTA------------LVLARLPLEKIAECLNDLCAVQVMALKKLLAQDSSS---GKSSDPTVWLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNAHQSDNRIVERCCRCLRFAVRCVGKGSASLLQPLVTQMVSVYQLYPHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCMPTFQLLEQPNGLRNHPDTVDDLFRLATRFVQR-SPVTLLSSSIIVH-IIQCAIAATTLDHRDANCSVMKFIRDLIHTGVTNDHEDDFEVRKRLIGQAMEQHGQQLVNQLINTCCFCLPPYTLPDVAEVLWEIMVFDRP-----TFCRWLETTLKGLPKETAGGAVTVTHKQL 895          
BLAST of Transportin-3 vs. Ensembl Zebrafish
Match: ipo13 (importin 13 [Source:ZFIN;Acc:ZDB-GENE-070706-1])

HSP 1 Score: 76.6406 bits (187), Expect = 1.102e-13
Identity = 121/522 (23.18%), Postives = 224/522 (42.91%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-----QFQINTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P E + SLK  L   +    S +   VLT+L +ALA L  +M+   W   + E++  + +    +        LL++L  +PEEF  ++ RL   RK ++ G L  +  +V  +L+Q L   +   L+K    +CL+SW L+++  ++   +  ++   +  L  P +   A E++     Q  +  + N  +  +PQ++Q     +  +    +E ++ IC        +H+   L+  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++  H A   +++E    ++ SD     EQ R++ VDI    +   +MLG          L +LL ++ Q   + +   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   29 NKNLAQKWLMQAQVSPQAWQFCWVLLRPDKVPEIQYFGASALHTKISRYWSDIPAEQYDSLKSQLFSQIARFASGSK-IVLTRLCVALASLALNMMPEAWPGAVSEMVRMFQEDGGDVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALGSEWTAVYPLLQQLLRQPDSPSLVKARVLKCLSSWVLLDVPLNE---SEGLVEASFTALADPELFDTAVEAIVNTISQPDSQRYVNTLLKLVPQVLQLQEQLRDAVQNGDMETSHGICRIAVSLGENHSRALLEQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDIMSFEAEKQAVYLQVYRPVYFQLVDVL-LHKAQFPTDEE--YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTNTEQT--TTWQHTEALLYGFQSIAETIDVNYSDVIPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 514          
BLAST of Transportin-3 vs. Ensembl Zebrafish
Match: si:ch73-182a11.2 (si:ch73-182a11.2 [Source:ZFIN;Acc:ZDB-GENE-130530-816])

HSP 1 Score: 65.855 bits (159), Expect = 2.254e-10
Identity = 123/547 (22.49%), Postives = 215/547 (39.31%), Query Frame = 1
Query:   61 TVEATLESIDILHHVKS-GNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETIP--ILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNN--DIVLIKCFECLNSWFLINL-FHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCAT---------DFFCNDIHTIPQLV---QQFQ--INTYQLEAAYQICAYSHA---DYC------LDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQL-----APIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE------------VVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            TVEA   ++  L++    G  N A  +L+E Q S  AW     LL   K     +FGA T+  KI  H+ ELP     SL+  LM  +    +     VLT+L +ALA L  H++   W   + +I+  +       P   L  +          +S R+  +R++++   L     SV  +L+Q L   +    V  +   C++SW  +++   D +     ++   + +LK   I     F AAV+             F  + +  +PQ++   +Q +  +    +E ++ IC  + A    +C      +D+ + F     AL+ +++ C     +A+PG Y            +    +L L     + D     LD  R  L      P++ QL+ ++         ED     A+ +D     EQ R + VDI              + R +   L  LL +S    PS++   E +L    S+ + VD + S+       L     +P +        +      G L  W S+  P++
Sbjct:    7 TVEAVERALQQLYYDPDMGKKNVAQKWLSEAQASPQAWQFCWDLLRPEKVPEIQFFGASTLHAKISRHWSELPAGQLDSLRSQLMAQVGQFAAGPK-MVLTRLCVALASLILHILPETWPTAVPDILCAFQTGEGDGPSRCLALLELLAVLPEELQSSRIVTSRRSQLRSALAAHWSSVCRLLQQLLQQPDAPGRVRERVLRCVSSWITLDVCLQDSE----GILESCFTLLKESEI-----FDAAVETIVCIISQPDCQRFVDSLLKVVPQVLALQEQLKKAVQDGDMETSHGICRIAVALGETHCRTLLEQVDHWQGF----QALVSMIMSC-----TATPGHY----------PVDETSSSLTLTFWYTLQDDIT-SLDAERQTLYLQIYRPLYFQLVDVLLQKACFPRDED---FTAWSAD---DKEQFRTYRVDISDTLMYTYELLGPELLRNLYDKLGTLLTNS--THPSSWQDVETLLFGFQSIAETVDVSYSDVIPGLIGL-----IPLITANNIQLAETIMFTIGSLAEWLSDHSPML 510          
BLAST of Transportin-3 vs. Ensembl Xenopus
Match: TNPO3 (transportin 3 [Source:NCBI gene;Acc:100490799])

HSP 1 Score: 283.493 bits (724), Expect = 6.931e-80
Identity = 279/1018 (27.41%), Postives = 473/1018 (46.46%), Query Frame = 1
Query:   46 MMTLPTVEATLESIDILHHVKSGNVND-ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQ--SLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTI-------PQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLA---------PIFEQLITIMTCHCAVTE-----SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVK---NQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            M   P ++   +++  L+H    +  + AS +L ELQ+S YAW IADQLL +++D+ + YF AQTM+ KIQ  F ELP +SHVSL++SL+ H+ N+    +P +LTQL+LA+ADL   M  WK  +  ++ +YS    ++P LL++L  +PEE  +RSLR+G NR+ EI  +L   S +VV +L      + +N+ +LIK F+CL SWF + +     + N R++  ++ +L+     + +L +AA  C     C+ ++ I       P   Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P  D     GD RTL++LL+ AG  +         +++++ +  +RL E   ++          P  ++L+  +  HC +        E+  +   FR  V  +++ +   V     F       SQL  +     P  +   EAVL ++ ++ K +D     N    E L   V LP       + +  +  + GE+          +D ++     +L++  F  S+     S    A+Q++   C+   A                    L F    L+    +L      P +  GL++     L + P E ++  + ELC + V+++ RL+    N  +S       DP +++D ++ IF         ++  P        +N   I    +   T        +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  VP F +L Q  GL  +P+T +DLFRL  R VQRC    L   S  V  +   A+ +    + DA    ++FL +  +    ND + +  +R   +  +  +    L   LI+ C +     T  D+ E + + ++  R       F   L+++L N+      G    T  Q+    K  +S  +  QV   L  F +LF
Sbjct:  108 MEGKPGLQTVYQAVQALYHDPDPSGKERASLWLGELQRSVYAWEIADQLLQIHQDVESCYFAAQTMKVKIQTSFYELPSDSHVSLRDSLLSHIQNLK-DMSPVILTQLALAIADLALLMASWKGCVQTLVESYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRAEIIEDLAYYSSTVVSLLLSCAEKAGDNEKMLIKIFKCLGSWFNLGVLDSNFMANNRLLLLLFQVLQQDRTPT-NLHEAASDCV----CSALYAIENVESNLPLATQLFQ-GVLTLETAYHMAVAREDIDKVLNYCRIFTELCETFLEKIVTTPCRD----LGDLRTLELLLICAGHPQY-------EVVEISFNFWYRLGEHLYKMTDAVIHGIFKPFIQRLLHALARHCQLEPDHEGVPEETDDFGEFRLRVSDLVKDLIYLVGSMECF-------SQLYSTLKDGNPP-WEVTEAVLFIMAAIAKSIDPEN--NPTLVEVLEGVVRLP--ESVHIAVRYTSIELVGEMSEVVDRNPQFLDPVL----AYLMKGLFQPSL----ASPSAKAIQNICSVCRDHMA--------------------LHFNG--LLEIARSLDSFTLHPDAAVGLLKGTALVLARLPLEKISECLSELCSVQVNSLKRLLSQDPNNGLSS------DPTLFLDRLAVIF---------RHTNPI-----EVRNLRIIHIPPELPTTQ-------IWPVLSETMNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVEVYHIHQHSCFLYLGSILVDEYGMEEGCQQGLLDMLQALCVPTFQLLEQQNGLRNHPDTVDDLFRLFTRFVQRCPIVLLR--SQVVIHVLRWAIAASTLDHRDANCSVMKFLRDLIHTGVSNDHEENFEIRKDLIQQVLTQVGQQLVSQLIHACCFCLPPYTLPDVAEVLWEAMVFNRP-----TFCRWLEASLKNLPKDMAVGAATVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 1031          
BLAST of Transportin-3 vs. Ensembl Xenopus
Match: TNPO3 (transportin 3 [Source:NCBI gene;Acc:100490799])

HSP 1 Score: 118.627 bits (296), Expect = 1.992e-27
Identity = 102/386 (26.42%), Postives = 174/386 (45.08%), Query Frame = 1
Query: 1852 ETLARRVWELCQINVDTVNRLVK---NQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQ-PYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            E ++  + ELC + V+++ RL+    N  +S       DP +++D ++ IF         ++  P        +N   I    + P   A+++                 +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  VP F +L Q  GL  +P+T +DLFRL  R VQRC    L   S  V  +   A+ +    + DA    ++FL +  +    ND + +  +R   +  +  +    L   LI+ C +     T  D+ E + + ++  R       F   L+++L N+      G    T  Q+    K  +S  +  QV   L  F +LF
Sbjct:  126 EKISECLSELCSVQVNSLKRLLSQDPNNGLSS------DPTLFLDRLAVIF---------RHTNPI-----EVRNLRIIHIPPELPTTQAHHR-----------------ADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVEVYHIHQHSCFLYLGSILVDEYGMEEGCQQGLLDMLQALCVPTFQLLEQQNGLRNHPDTVDDLFRLFTRFVQRCPIVLLR--SQVVIHVLRWAIAASTLDHRDANCSVMKFLRDLIHTGVSNDHEENFEIRKDLIQQVLTQVGQQLVSQLIHACCFCLPPYTLPDVAEVLWEAMVFNRP-----TFCRWLEASLKNLPKDMAVGAATVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 467          
BLAST of Transportin-3 vs. Ensembl Xenopus
Match: klf10 (Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE-854761])

HSP 1 Score: 68.9366 bits (167), Expect = 3.836e-11
Identity = 126/523 (24.09%), Postives = 215/523 (41.11%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQK------AETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNN--DIVLIKCFECLNSWFLINLFHDKDLLNCRVIS-CIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQ---LVQQFQ--INTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW  + QLL   K     YFGA  +  KI  ++ ++P E + SLK  L   + +V +S +  VLT+L +ALA L  +M+   W + + +++  + ++            LL++L  +PEEF  ++ RL   RK  +   L  +   V  +L Q L  ++    V  K  +C +SW  + +     L  C  ++   +  L+ P +   A E+L     Q     + N  +  IPQ   L  Q    +    LE ++ IC        +H+   LD    +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++         E+     ++ SD     EQ R++ VDI    +   +MLG          L +LL SS   Q +++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   37 NKNMAQKWLMQAQISPQAWQFSWQLLNGGKVPEIQYFGASALHIKISRYWGDIPAEQYESLKSQLFAQI-SVFASGSKIVLTRLCVALASLALNMMPDTWPHAVSDMVRVFQKEDGQTDGGSRCLALLELLTVLPEEF--QTSRLPPYRKGIVRSSLAQECTCVFPLLRQLLEQSDTPGFVKQKVLKCFSSWAQLEI----PLTECEELTLAAFSALRDPELFDSAVEALVNTISQPDAQRYVNTLLKLIPQALSLQDQLHQAVQNGDLETSHGICRIVVALGENHSRAFLDQVDHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYSLQDDIFSFEAEKQAVYLQVYRPVYFQLVDVLLQKAQFPADEE---YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSD--QSTSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 522          
BLAST of Transportin-3 vs. Ensembl Xenopus
Match: klf10 (Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE-854761])

HSP 1 Score: 68.5514 bits (166), Expect = 4.777e-11
Identity = 126/523 (24.09%), Postives = 215/523 (41.11%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQK------AETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNN--DIVLIKCFECLNSWFLINLFHDKDLLNCRVIS-CIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQ---LVQQFQ--INTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW  + QLL   K     YFGA  +  KI  ++ ++P E + SLK  L   + +V +S +  VLT+L +ALA L  +M+   W + + +++  + ++            LL++L  +PEEF  ++ RL   RK  +   L  +   V  +L Q L  ++    V  K  +C +SW  + +     L  C  ++   +  L+ P +   A E+L     Q     + N  +  IPQ   L  Q    +    LE ++ IC        +H+   LD    +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++         E+     ++ SD     EQ R++ VDI    +   +MLG          L +LL SS   Q +++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   36 NKNMAQKWLMQAQISPQAWQFSWQLLNGGKVPEIQYFGASALHIKISRYWGDIPAEQYESLKSQLFAQI-SVFASGSKIVLTRLCVALASLALNMMPDTWPHAVSDMVRVFQKEDGQTDGGSRCLALLELLTVLPEEF--QTSRLPPYRKGIVRSSLAQECTCVFPLLRQLLEQSDTPGFVKQKVLKCFSSWAQLEI----PLTECEELTLAAFSALRDPELFDSAVEALVNTISQPDAQRYVNTLLKLIPQALSLQDQLHQAVQNGDLETSHGICRIVVALGENHSRAFLDQVDHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYSLQDDIFSFEAEKQAVYLQVYRPVYFQLVDVLLQKAQFPADEE---YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSD--QSTSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 521          
BLAST of Transportin-3 vs. Ensembl Xenopus
Match: klf10 (Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE-854761])

HSP 1 Score: 68.5514 bits (166), Expect = 5.683e-11
Identity = 126/523 (24.09%), Postives = 215/523 (41.11%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQK------AETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNN--DIVLIKCFECLNSWFLINLFHDKDLLNCRVIS-CIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQ---LVQQFQ--INTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW  + QLL   K     YFGA  +  KI  ++ ++P E + SLK  L   + +V +S +  VLT+L +ALA L  +M+   W + + +++  + ++            LL++L  +PEEF  ++ RL   RK  +   L  +   V  +L Q L  ++    V  K  +C +SW  + +     L  C  ++   +  L+ P +   A E+L     Q     + N  +  IPQ   L  Q    +    LE ++ IC        +H+   LD    +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++         E+     ++ SD     EQ R++ VDI    +   +MLG          L +LL SS   Q +++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   32 NKNMAQKWLMQAQISPQAWQFSWQLLNGGKVPEIQYFGASALHIKISRYWGDIPAEQYESLKSQLFAQI-SVFASGSKIVLTRLCVALASLALNMMPDTWPHAVSDMVRVFQKEDGQTDGGSRCLALLELLTVLPEEF--QTSRLPPYRKGIVRSSLAQECTCVFPLLRQLLEQSDTPGFVKQKVLKCFSSWAQLEI----PLTECEELTLAAFSALRDPELFDSAVEALVNTISQPDAQRYVNTLLKLIPQALSLQDQLHQAVQNGDLETSHGICRIVVALGENHSRAFLDQVDHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYSLQDDIFSFEAEKQAVYLQVYRPVYFQLVDVLLQKAQFPADEE---YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSD--QSTSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 517          
BLAST of Transportin-3 vs. Ensembl Mouse
Match: Tnpo3 (transportin 3 [Source:MGI Symbol;Acc:MGI:1196412])

HSP 1 Score: 302.753 bits (774), Expect = 1.595e-87
Identity = 263/994 (26.46%), Postives = 464/994 (46.68%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDET-RSQLAPIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE   S      ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ + H         +  V   +     L         + L +  E L+    ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA +  +RFL +  +    ND +    +R   +G + ++    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHSIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVHLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFNGLLEIAHSLDSFMLSPEAAVGLLKGTALVL-------ARLPLDKITECLS----ELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANSSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMSQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 922          
BLAST of Transportin-3 vs. Ensembl Mouse
Match: Tnpo3 (transportin 3 [Source:MGI Symbol;Acc:MGI:1196412])

HSP 1 Score: 300.442 bits (768), Expect = 1.033e-86
Identity = 263/1000 (26.30%), Postives = 464/1000 (46.40%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDET-RSQLAPIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-------DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE   S      ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ + H         +  V   +     L         + L +  E L+    ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA +  +RFL +  +    ND       +    +R   +G + ++    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHSIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVHLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFNGLLEIAHSLDSFMLSPEAAVGLLKGTALVL-------ARLPLDKITECLS----ELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANSSVMRFLRDLIHTGVANDLSVFLQHEEDFELRKELIGQVMSQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 928          
BLAST of Transportin-3 vs. Ensembl Mouse
Match: Tnpo3 (transportin 3 [Source:MGI Symbol;Acc:MGI:1196412])

HSP 1 Score: 90.5077 bits (223), Expect = 1.125e-19
Identity = 71/252 (28.17%), Postives = 116/252 (46.03%), Query Frame = 1
Query: 2260 IAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-------DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA +  +RFL +  +    ND       +    +R   +G + ++    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    2 LVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANSSVMRFLRDLIHTGVANDLSVFLQHEEDFELRKELIGQVMSQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 246          
BLAST of Transportin-3 vs. Ensembl Mouse
Match: Ipo13 (importin 13 [Source:MGI Symbol;Acc:MGI:2385205])

HSP 1 Score: 66.6254 bits (161), Expect = 1.483e-10
Identity = 126/525 (24.00%), Postives = 220/525 (41.90%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETIPI--------LLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSL--NNDIVLIKCFECLNSWFLINLFHDKDLLNCR-VISCIYDILKSPNI---ASESLFKAAVQCATDFFCNDIHTIPQLVQQFQ------INTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDET---RSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW  + QLL  +K     YFGA  +  KI  ++ ++P + + SLK  L   +    S +   VLT+L +ALA L   M+   W   + +++  +  +AE  P+        LL++L  +PEEF  ++ RL   RK  +   L  +  +V  +LEQ L    +   V  K  +C +SW  + +     L +C  +I   +  L+   +   + E++  A  Q     + N +  +  LV   Q      +    +E ++ IC        +H+   LD  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    +    P++ QL+ ++  H A   S++E     + SD     EQ R++ VDI    +   +MLG          L +LL SS   +P ++   EA+L    S+ + +D N S+       L     +P +  +     D      G L  W ++  P+M
Sbjct:   41 NKNLAQKWLMQAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSK-IVLTRLCVALASLALSMMPDAWPCAVADMVRLF--QAEDSPVDSQGRCLALLELLTVLPEEF--QTSRLPQYRKGLVRTSLAVECGTVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEV----PLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVL-LHKAQFPSDEEYGF--WSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSE--EPYSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGL-----IPRISISNVQLADTVMFTIGALSEWLADH-PVM 526          
BLAST of Transportin-3 vs. UniProt/SwissProt
Match: sp|Q6P2B1|TNPO3_MOUSE (Transportin-3 OS=Mus musculus OX=10090 GN=Tnpo3 PE=1 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.116e-86
Identity = 263/994 (26.46%), Postives = 464/994 (46.68%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDET-RSQLAPIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE   S      ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ + H         +  V   +     L         + L +  E L+    ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA +  +RFL +  +    ND +    +R   +G + ++    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHSIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVHLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFNGLLEIAHSLDSFMLSPEAAVGLLKGTALVL-------ARLPLDKITECLS----ELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANSSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMSQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 922          
BLAST of Transportin-3 vs. UniProt/SwissProt
Match: sp|Q9Y5L0|TNPO3_HUMAN (Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=1 SV=3)

HSP 1 Score: 298.13 bits (762), Expect = 4.997e-85
Identity = 264/1000 (26.40%), Postives = 465/1000 (46.50%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVNDASNF-LTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHT-IPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQLAPIF-EQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVE-----LGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            PT++   +++  L+H    +  + ++F L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP +SH SL++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  YS    ++P LL++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  +  ++ +L+K F CL SWF + +     + N ++++ ++++L+    +S +L +AA  C     +   ++ T +P  +Q FQ     LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  + E   +  +    + +      DE    +   + ++L+  +  HC +        E+  +   FR  V  +++ +   +     F ++   L +    +P      +   EAVL ++ ++ K VD     N    E L   V LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ                          L+    +L   L  P +  GL++     L + P + +   + ELC + V  + +L+  +  + +  DP    V++D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y   + SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R +QR     L   S  V  +   A+ S    + DA    +RFL +  +    ND +    +R   +G +  +    L   L++ C +     T  D+ E + +++   R       F   L+++L  +      G V  T  Q+    K  +S  +  QV   L  F +LF
Sbjct:    6 PTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMKIQTSFYELPTDSHASLRDSLLTHIQNLKD-LSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFNLGVLDSNFMANNKLLALLFEVLQQDKTSS-NLHEAASDCVCSALYAIENVETNLPLAMQLFQ-GVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEKIVCTP----GQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECFAQLYSTLKE---GNPP-----WEVTEAVLFIMAAIAKSVDPEN--NPTLVEVLEGVVRLP--ETVHTAVRYTSIELVGEMSEVVDRNPQFLDPVLGYLMKGLCEKPL--------ASAAAKAIHNICSVCRDHMAQHFNG----------------------LLEIARSLDSFLLSPEAAVGLLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISSDPT---VFLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLR--SQVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRP-----TFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLF 922          
BLAST of Transportin-3 vs. UniProt/SwissProt
Match: sp|Q8GUL2|MOS14_ARATH (Transportin MOS14 OS=Arabidopsis thaliana OX=3702 GN=MOS14 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.701e-12
Identity = 59/217 (27.19%), Postives = 103/217 (47.47%), Query Frame = 1
Query:   70 ATLESIDILHHVKSGNVN-DASNFLTELQQSNYAWSIADQLLY-MNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHM--VQWKNG--LDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNC 702
            A  E+++ L+H     V   A  +L   Q +  AW +AD LL+  + +L T  F +QT+R+K+Q  F+ELP  +   L++SL   L   +    P V TQ+S+A+A L  H+    W +G  +  +        E +P  L++L  +PEE  N  +    +R+ +   EL  +  + + +L   L ++   +  +  E   SW  +       +L C
Sbjct:    6 AVKEALNALYHHPDDTVRVHADRWLQNFQGTLDAWQVADNLLHDSSSNLETLIFCSQTLRSKVQRDFEELPPGAFQKLRQSLTTLLKKFHKGP-PKVRTQISIAVAALAVHVPAADWGDGGIISWLRDEMHMHPEYVPGFLELLTVLPEETFNYKIAARPDRRRQFEKELTSQMEAALSILSACLKISE--LKEQVLEAFASWLRLRHGIPGTVLAC 219          
BLAST of Transportin-3 vs. UniProt/SwissProt
Match: sp|Q9USZ2|YNR7_SCHPO (Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 8.920e-11
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKD---LVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSN 510
            A+N+L E Q+S  AW I   +L  N+D   +    F AQT+R KI   F +LP E+H+  + SL++       S  P +L  L++ +A +  HM +W N + ++    S K  +   +L  L  +PEE S+
Sbjct:   23 ANNYLEEFQKSPAAWQICFSIL--NQDDSSIEAKLFAAQTLRQKIVYDFHQLPKETHIEFRNSLLQLFLAAKDSPRP-LLVSLAVCMAAIALHMTEWHNVIADVFQACSSKDPSGRCVLQFLSVLPEEASD 150          
BLAST of Transportin-3 vs. UniProt/SwissProt
Match: sp|O94829|IPO13_HUMAN (Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 1.020e-9
Identity = 126/525 (24.00%), Postives = 220/525 (41.90%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETIPI--------LLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSL--NNDIVLIKCFECLNSWFLINLFHDKDLLNCR-VISCIYDILKSPNI---ASESLFKAAVQCATDFFCNDIHTIPQLVQQFQ------INTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDET---RSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW  + QLL  +K     YFGA  +  KI  ++ ++P + + SLK  L   +    S +   VLT+L +ALA L   M+   W   + +++  +  +AE  P+        LL++L  +PEEF  ++ RL   RK  +   L  +  +V  +LEQ L    +   V  K  +C +SW  + +     L +C  +I   +  L+   +   + E++  A  Q     + N +  +  LV   Q      +    +E ++ IC        +H+   LD  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    +    P++ QL+ ++  H A   S++E     + SD     EQ R++ VDI    +   +MLG          L +LL SS   +P ++   EA+L    S+ + +D N S+       L     +P +  +     D      G L  W ++  P+M
Sbjct:   41 NKNLAQKWLMQAQVSPQAWHFSWQLLQPDKVPEIQYFGASALHIKISRYWSDIPTDQYESLKAQLFTQITRFASGSK-IVLTRLCVALASLALSMMPDAWPCAVADMVRLF--QAEDSPVDGQGRCLALLELLTVLPEEF--QTSRLPQYRKGLVRTSLAVECGAVFPLLEQLLQQPSSPSCVRQKVLKCFSSWVQLEV----PLQDCEALIQAAFAALQDSELFDSSVEAIVNAISQPDAQRYVNTLLKLIPLVLGLQEQLRQAVQNGDMETSHGICRIAVALGENHSRALLDQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDILSFEAEKQAVYQQVYRPVYFQLVDVL-LHKAQFPSDEEYGF--WSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTSSE--EPYSWQHTEALLYGFQSIAETIDVNYSDVVPGLIGL-----IPRISISNVQLADTVMFTIGALSEWLADH-PVM 526          
BLAST of Transportin-3 vs. TrEMBL
Match: A0A4S2MGB2 (Xpo1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000209 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 5.610e-116
Identity = 326/1121 (29.08%), Postives = 528/1121 (47.10%), Query Frame = 1
Query:   64 VEATLESIDILH-HVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWF-LINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQ--CATDFFCNDIH-TIPQLVQQFQINTYQLEAAYQICAYS----------------HADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQML-----LLTAGTNRECCALVLDILIDVTD--------SRNFRLDETR-------------SQLAPIFEQLITIMTCHC----AVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQL--LVSSPQMQPSN---YNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQP-SFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFL-----LESKFDSSIDELQMSAFNSALQSLAVFCKRQNA----QILKP-----------DRWA-LIIRLCHRFTELTF-PNKLLVNFYEALGR-CLCIPHSIEGLVELGQNP--ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLS----MPRMVTGKNGRPFIGSDQSDQNEAA--IQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAY-AHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSI------PGTNID-------------------AKTLALRFLVESFNCANQNDDAHIPVRVRTV----GWLQAEGLTHLW---RALIYLCRWKSDEVTGGDLVE------------------------DMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQ---VLEGLETFAKLF 2982
            VE  L +ID L+ +  +     AS +L+E Q+S YAW I+DQLLYMN+DL + YFGAQT+R KIQ +F ELP  SH  LK SL++H+  +N+ T+  +  QL LA+ADLFCHMVQW+NG+ +II   S    +   L+D+LKFIPEE ++ +LRLG NR+  +  +L+     V+E+L          +L + F CL SW+    +  ++D     ++  ++ IL++P    E  + AA Q   A  + C   + T   L+   Q N Y+L    Q CA +                + D C   A IF  +A  L P ++  P    S +PGD RTL  L     L+    +RE  A+    L  + D        +    +D +              + L P F +++  +T  C    A  ES DE  L  FR DV  +M+ I   V  E +F ++   + QL  L  S   Q +     ++AEA L M+ ++ K +  +  E   +   L++ ++LP L  A P   ++V   ++ EL  WA+    +   ++ ++   +     +E+       +L +SA  SAL SLA   +   +     +  P           D W  L+ R+ +    L + P     NF+  +GR  +    S  G V+   N   +    R+ ++C ++++ +++L+             DP VW+D ++A+F +    + R+  G   +   G+      E     Q+A      +   V E +WPV+A ++  + S  R +E   R++R+ +RCF    + LL +IA+KIV AY    + S FLY+  +LVDEFG+   C+ GL++++ A   P   +L G  L +NP+T EDL+RL  RLVQRC   FL+   +D N L ++AVRS+      PG N D                   A   A RFL++  +   Q  +   P +V  +    G L            R L++L   +    +G +LV+                        ++ D+L  +  +T  + FL  L++A+ ++ + R DG+V+AT  QI   + S+++ S+   +L+ L  FA LF
Sbjct:    9 VETVLRAIDALYLNPDTSFKEQASKWLSEFQKSLYAWEISDQLLYMNRDLNSCYFGAQTIRIKIQCYFTELPTSSHEGLKNSLLEHVKKLNAETSVPIANQLCLAVADLFCHMVQWQNGIKDIIEKLSGCDASSGYLIDILKFIPEEMTSSTLRLGSNRRHSLMAQLETNKRQVIELLSLRAKTPEMPMLTRIFNCLASWWDNTGVMTEQDAPVSPLLETVFCILRNPASTPEQAYDAATQWILALLYQCRSFNGTSDGLLTWLQRNIYELLKVLQDCATAIASASSQTLQQEQLDLYKDRCTCLAHIFASLARTLRPALVRQPSAAGSGAPGDLRTLDCLLGVLELVPPLGSRELSAITFHALHSLADDAIRHRSLAAQSNMDSSAGNNSANSGGLRPIAALVPYFTRVVVALTRFCPNNTADLESTDE--LRDFRDDVHDLMQDILGLVGAETIFVELYNHVQQLQMLAVSSNAQVTALEVLHEAEACLFMMTTVAKRLSPHDPE--GYLSNLISGLVLPGLSAACPFPLQEVGCILYMELSHWAACHPQLRRQIVAQLIGIVEKAAGVEASNLQPGQKLAVSAALSALGSLASVYRATPSGGPNGLTSPGSESLRTGLLDDHWQDLVQRVAYNLPRLAWVPVYDATNFFAGIGRGMISSIGSGGGGVDFDPNSSRQAFPSRLAQICSVSLECLDKLMMENIAITGTDTTTDPRVWLDYLAALFRTFGCFLRRLDDGGKQQLGTGTQSIGIREVGSLAQSAQTCLSESLRLVREVIWPVVARVLTFYSSRARHMEHTCRLIRFIVRCFSVHLRDLLPEIAEKIVVAYRTGGQHSSFLYLASVLVDEFGEQPDCRFGLVRVYEALGGPTLKLLDGPALSQNPHTVEDLYRLCTRLVQRCPVAFLTSEEVDFNELCNVAVRSLGLYCTGPGANDDITDTPSSNGDSQINNSSSSASAAAARFLIDLLSFTGQASEV-TPTQVAQIISSGGQLATPSCPSAMAAQRVLVWLI--QPAAASGSELVQCGGQRLVSAVIQACCLGISEERFPELADILHQLNVMTKNELFLTWLNTAVTSLPILRADGLVHATMDQINDFKESIMKSSRSSTILQALSVFAVLF 1122          
BLAST of Transportin-3 vs. TrEMBL
Match: A0A074ZUY0 (Xpo1 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02454 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 5.872e-116
Identity = 330/1126 (29.31%), Postives = 523/1126 (46.45%), Query Frame = 1
Query:   64 VEATLESIDILH-HVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWF-LINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQ--CATDFFCNDIH-TIPQLVQQFQINTYQLEAAYQICAYS----------------HADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQML-----LLTAGTNRECCALVLDILIDVTD------------------------SRNFRLDETRSQLAPIFEQLITIMTCHC----AVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQL--LVSSPQMQPSN---YNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQP-SFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFL-----LESKFDSSIDELQMSAFNSALQSLAVFCKRQNA----QILKP-----------DRWA-LIIRLCHRFTELTF-PNKLLVNFYEALGR-CLCIPHSIEGLVELGQNP--ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLS----MPRMVTGKNGRPFIGSDQSDQNEAA--IQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAY-AHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSI------PGTNID-------------------AKTLALRFLVESFNCANQNDDAHIPVRV----------------------RTVGWLQAE-----------GLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQ---VLEGLETFAKLF 2982
            VE  L +ID L+ +  +     AS +L+E Q+S YAW I+DQLLYMN+DL + YFGAQT+R KIQ +F ELP  SH  LK SL++H+  +N+ T+  +  QL LA+ADLFCHMVQW+NG+ +II   S    +   L+D+LKFIPEE ++ +LRLG NR+  +  +L+     V+E+L          +L + F CL SW+    +  ++D     ++  ++ IL++P    E  + AA Q   A  + C   + T   L+   Q N Y L    Q CA +                + D C   A IF  +A  L P ++  P    S +PGD RTL  L     L+    +RE  A+    L  + D                        S N       + L P F +++  +T  C    A  ES DE  L  FR DV  +M+ I   V  E +F ++   + QL  L  S   Q +     ++AEA L M+ ++ K +  +  E   +   L++ ++LP L  A P   ++V   ++ EL  WA+    +   ++ ++   +     +E+       +L +SA  SAL SLA   +   +     +  P           D W  L+ R+ +    L + P     NF+  +GR  +    S  G V+   N   +    R+ ++C ++++ +++L+             DP VW+D ++A+F +    + R+  G   +   G+      EA    Q+A      +   V E +WPV+A ++  + S  R +E   R++R+ +RCF    + LL +IA+KIV AY    + S FLY+  +LVDEFG+   C+ GL++++ A   P   +L G  L +NP+T EDL+RL  RLVQRC   FL+   +D N L ++AVRS+      PG N D                   A   A RFL++  +   Q  +   P +V                      R + WL              G   L  A+I  C     E    +   +M D+L  +  +T  + FL  L++A+ ++ + R DG+V+AT  QI   + S+++ S+   +L+ L  FA LF
Sbjct:    9 VETVLRAIDALYLNPDTSFKEQASKWLSEFQKSLYAWEISDQLLYMNRDLNSCYFGAQTIRIKIQCYFTELPTSSHEGLKNSLLEHVKKLNAETSVPIANQLCLAVADLFCHMVQWQNGIKDIIEKLSGCDASSGYLIDILKFIPEEMTSSTLRLGSNRRHSLMAQLETNKRQVIELLSLRAKTPEMPMLTRIFNCLASWWDNTGVMTEQDAPVSPLLETVFCILRNPASTPEQAYDAATQWVLALLYQCRSFNGTSGGLLTWLQRNIYDLLKVLQDCATAVASASNQTLQQEQLDLYKDRCTCLAHIFASLARTLRPALVRQPSSAGSGAPGDLRTLDCLLGVLELVPPLGSRELSAITFHALHSLADDAIRHRSLAASSAQSSMDSSAGNNSANSGGLRPIAALVPYFTRVVVALTRFCPNNTADLESTDE--LRDFRDDVHDLMQDILGLVGAETIFVELYNHVQQLQMLAVSSNAQVTALEVLHEAEACLFMMTTVAKRLSPHDPE--GYLSNLISGLVLPGLSAACPFPLQEVGCILYMELSHWAACHPQLRRQIVAQLIGIVEKAAGVEAPNLQPGQKLAVSAALSALGSLASVYRATPSGGPNGLTSPGSESLRTGLLDDHWQDLVQRVAYNLPRLAWVPVYDATNFFSGIGRGMISSIGSGGGGVDFDPNSSRQAFPSRLAQICGVSLECLDKLMTENIAITGTDTTTDPRVWLDYLAALFRTFGCFLRRLDDGGKQQLGTGTQSIGIREAGSLAQSAQTCLSESLRLVREVIWPVVARVLTFYSSRARHMEHTCRLIRFIVRCFSVHLRDLLPEIAEKIVVAYRTGGQHSSFLYLASVLVDEFGEQPDCRFGLVRVYEALGGPTLKMLDGPALSQNPHTVEDLYRLCTRLVQRCPVAFLTSEEVDFNELCNVAVRSLGLYCTGPGANDDITDTPSSNGDSQNNNSSSSASAAAARFLIDLLSFTGQASEV-TPTQVAQIISSGGQLATPSCPSAMAAQRVLVWLIQPVAANGPEMIQCGGQRLVSAVIQACCLGISE----ERFPEMADILHQLNVMTKNELFLTWLNTAVTSLPILRADGLVHATMDQINDFKESIMKSSRSSTILQALSVFAVLF 1125          
BLAST of Transportin-3 vs. TrEMBL
Match: A0A564YSP5 (Xpo1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9170 PE=4 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 1.224e-113
Identity = 315/1114 (28.28%), Postives = 523/1114 (46.95%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVND-ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTIP-------QLVQQFQINTYQLEAAYQICAY--------SHADYCLDYAK----IFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCAL--------VLDILID--VTDSRNFRLDETR--------SQLAP------IFEQLITIMTCHCAVTESED---EPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSN-YNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLG-QAQPSFKDVAFTMFGELCRW----ASEREPIMDCMIQ--EMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILK---------PDRWA-LIIRLCHRFTELT-FPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPE----TLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMP-------------RMVTGKNGRPFIGSDQSDQNEA-AIQAATQPYLTAYYQV-MEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAV--------------------------------RSIPGTNIDAKTLALRFLVE--SFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGG-----------------DLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSML---QDSQVLEGLETFAKLF 2982
            PT+E  L++ID L+     +V + AS +L E Q+S YAW IAD+LLY+N+DL +SYFGAQT+R KIQ++F ELP  SH  LK+SL+ H+  +   T  ++  QL LALADL+C MV WK+G+ +I+ + S    +   LLD+L+FI EE ++++LRLG+NR+  +  +L+     V + L   +   + ++L K F+CL SW+  +    +  +   ++   + +L+     S+S  +   + A+D+  + +   P       +++   Q N Y L+  +Q C          S A+  +  A     IF E+ + +   +++ P    S +PGD +TL  L+      R  C +         LD L +  V +  ++  +  R         +L P       F +++ ++T  C V +S+D      +  FR DV+ +M  I   V  +VVF ++   + QL   +     S+   +AEA L M+ +L + +  +  E       L+T  +LPCL  +  PS ++V   +F EL  W       R  I++ +IQ  E A  L ES F+    ++   A  +AL  L   C+ + A   K          ++W  LI R+ +        PN     FYE + R L    +I  L   G +P      L  R+ +L  +N+  +N+L++     ++     DP +W+D I+A+F   P             RM +  N       DQ  Q E  ++  + Q  L     V +  +WPVL+  ++ + S   V+ER  R++R+ +R F    + +L DIA K+V +Y   + SCFLY+ G+L D FGD   C+ GL+ +F   + P  + L G  L E P   EDL+RL VRLVQRC+  FL+  ++D+  L + A+                                RS P     A      FL E  +F   +  D     +  + +  L+ E      R + ++   K +E+ GG                 DL  +++ LL+G++ +   D FL  +D AL+ + + R DG+V AT+ Q+   +  ++   +D  +   L+ F  LF
Sbjct:    3 PTLETALQAIDALYVNPENSVKEGASKWLCEFQKSVYAWEIADKLLYLNRDLNSSYFGAQTIRIKIQMYFAELPPSSHEGLKDSLLNHVKKITKETPKSITNQLCLALADLYCQMVHWKDGITDIVNSLSSNDVSSLYLLDILRFIAEEMNSKTLRLGLNRRHALKADLEQHKNLVSDFLVFKMKDADPLILSKIFKCLTSWWDHSGIMTESDVRAELLEGAFYVLQH----SDSCPEETCEDASDWIVSLVTYCPTTTGYHCEMLSVLQANIYALQEVFQRCCVQATKTMDESVAEGFVKRASLIGVIFAELTNTVRNALVKKPTAPGSGAPGDLQTLDCLISVLEAPRPVCCIQSVRQTFQALDCLAENAVENGYHYNSEHKRISGDNPPAGELNPRILINSYFTRVVFVLTRLC-VNDSDDLETADEVREFREDVYTIMSTIVDLVGADVVFGELFNRIMQLQEMNNAGNASHLLREAEACLFMMTTLARRLSFHDPE--GHIASLITSFVLPCLASKPSPSMQEVICILFSELAVWIVVHPEIRRQIVEQLIQIIESAADLTESNFERGQKQVVCEAL-AALGKLCQSCRARRASSDKDCTPCDGIIDEQWNDLIYRVTYTIPLFARVPNTEAQTFYEGVTRALMT--TIAYLPRDGIDPRPARLALPERLAQLLSVNIQCINKLMEQNQPIKLKDKNTDPAIWLDLIAAVFRITPIFLPRLDDAYRRSRMNSTSNSSE---GDQHRQAEVDSLSESAQTCLNGCLNVFISMVWPVLSRCLEVYSSKNHVMERCCRVIRFVVRTFSVNLRDVLPDIANKLVQSYQQDQHSCFLYLTGVLTDVFGDLPECRHGLVSLFETLAPPTLNSLSG-SLAEQPYVVEDLYRLCVRLVQRCATTFLANPNVDIYALLNTALESLTLFTLNQISAGSGEDSDGEKEEPNPGDSRRSDPKATQSATGAVAHFLQEVLTFTSESSEDTPAAILSGQELSQLRDESALAARRLMFWV--LKPEEMCGGQRLTTTCIHSCCNGLSDDLFPEVSSLLLGLKMMVPRDLFLAWMDRALEGLPVVRADGLVQATEQQLADFKEGIMIATRDHSITRALDAFVVLF 1100          
BLAST of Transportin-3 vs. TrEMBL
Match: A0A158QC44 (Xpo1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS947 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 7.155e-111
Identity = 309/1096 (28.19%), Postives = 512/1096 (46.72%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVND-ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTIP-------QLVQQFQINTYQLEAAYQICAYSHADYCLD-------------YAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCAL--------VLDILID--VTDSRNFRLDETR--------SQLAP------IFEQLITIMTCHCAVTESED---EPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSN-YNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLG-QAQPSFKDVAFTMFGELCRW----ASEREPIMDCMIQ--EMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILK---------PDRWA-LIIRLCHRFTELT-FPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPE----TLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMP-------------RMVTGKNGRPFIGSDQSDQNEA-AIQAATQPYLTAYYQV-MEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAV--------------------------------RSIPGTNIDAKTLALRFLVE--SFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGG-----------------DLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSML 2934
            PT+E  L++ID L+     +V + AS +L E Q+S YAW IAD+LLY+N+DL +SYFGAQT+R KIQ++F ELP  SH  LK+SL+ H+  +   T  ++  QL LALADL+C MV WK+G+ +I+ + S    +   LLD+L+FI EE ++++LRLG+NR+  +  +L+     V + L   +   + ++L K F+CL SW+  +    +  +   ++   + +L+     S+S  +   + A+D+  + +   P       +++   Q N Y L+  +Q C    A   +D                IF E+ + +   +++ P    S +PGD +TL  L+      R  C +         LD L +  V +  ++  +  R         +L P       F +++ ++T  C V +S+D      +  FR DV+ +M  I   V  +VVF ++   + QL   +     S+   +AEA L M+ +L + +  +  E       L+T  +LPCL  +  PS ++V   +F EL  W       R  I++ +IQ  E A  L ES F+   + L      +AL  L   C+ + A   K          ++W  LI R+ +        PN     FYE + R L    +I  L   G +P      L  R+ +L  +N+  +N+L++     ++     DP +W+D I+A+F   P             RM +  N       DQ  Q E  ++  + Q  L     V +  +WPVL+  ++ + S   V+ER  R++R+ +R F    + +L DIA K+V +Y   + SCFLY+ G+L D FGD   C+ GL+ +F   + P  + L G  L E P   EDL+RL VRLVQRC+  FL+  ++D+  L + A+                                RS P     A      FL E  +F   +  D     +  + +  L+ E      R + ++   K +E+ GG                 DL  +++ LL+G++ +   D FL  +D AL+ + + R DG+V AT+ Q+   +  ++
Sbjct:    3 PTLETALQAIDALYVNPENSVKEGASKWLCEFQKSVYAWEIADKLLYLNRDLNSSYFGAQTIRIKIQMYFAELPPSSHEGLKDSLLNHVKKITKETPKSITNQLCLALADLYCQMVHWKDGITDIVNSLSSNDVSSLYLLDILRFIAEEMNSKTLRLGLNRRHALKADLEQHKNLVSDFLVFKMKDADPLILSKIFKCLTSWWDHSGIMTESDVRAELLEGAFYVLQH----SDSCPEETCEDASDWIVSLVTYCPTTTGYHCEMLSVLQANIYALQEVFQRCCV-QATKTMDESVAEGFVKRASLIGVIFAELTNTVRNALVKKPTAPGSGAPGDLQTLDCLISVLEAPRPVCCIQSVRQTFQALDCLAENAVENGYHYNSEHKRISGDNPPAGELNPRILINSYFTRVVFVLTRLC-VNDSDDLETADEVREFREDVYTIMSTIVDLVGADVVFGELFNRIMQLQEMNNAGNASHLLREAEACLFMMTTLARRLSFHDPE--GHIASLITSFVLPCLASKPSPSMQEVICILFSELAVWIVVHPEIRRQIVEQLIQIIESAADLTESNFEVVCEAL------AALGKLCQSCRARRASSDKDCTPCDGIIDEQWNDLIYRVTYTIPLFARVPNTEAQTFYEGVTRALMT--TIAYLPRDGIDPRPARLALPERLAQLLSVNIQCINKLMEQNQPIKLKDKNTDPAIWLDLIAAVFRITPIFLPRLDDAYRRSRMNSTSNSSE---GDQHRQAEVDSLSESAQTCLNGCLNVFISMVWPVLSRCLEVYSSKNHVMERCCRVIRFVVRTFSVNLRDVLPDIANKLVQSYQQDQHSCFLYLTGVLTDVFGDLPECRHGLVSLFETLAPPTLNSLSG-SLAEQPYVVEDLYRLCVRLVQRCATTFLANPNVDIYALLNTALESLTLFTLNQISAGSGEDSDGEKEEPNPGDSRRSDPKATQSATGAVAHFLQEVLTFTSESSEDTPAAILSGQELSQLRDESALAARRLMFWV--LKPEEMCGGQRLTTTCIHSCCNGLSDDLFPEVSSLLLGLKMMVPRDLFLAWMDRALEGLPVVRADGLVQATEQQLADFKEGIM 1076          
BLAST of Transportin-3 vs. TrEMBL
Match: A0A4S2MFY7 (Xpo1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000209 PE=4 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 3.245e-110
Identity = 288/935 (30.80%), Postives = 454/935 (48.56%), Query Frame = 1
Query:   64 VEATLESIDILH-HVKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWF-LINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQ--CATDFFCNDIH-TIPQLVQQFQINTYQLEAAYQICAYS----------------HADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQML-----LLTAGTNRECCALVLDILIDVTD---------------------SRNFRLDETRSQLAPIFEQLITIMTCHC----AVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQL--LVSSPQMQPSN---YNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQP-SFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFL-----LESKFDSSIDELQMSAFNSALQSLAVFCKRQNA----QILKP-----------DRWA-LIIRLCHRFTELTF-PNKLLVNFYEALGR-CLCIPHSIEGLVELGQNP--ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLS----MPRMVTGKNGRPFIGSDQSDQNEAA--IQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAY-AHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSI------PGTNID 2583
            VE  L +ID L+ +  +     AS +L+E Q+S YAW I+DQLLYMN+DL + YFGAQT+R KIQ +F ELP  SH  LK SL++H+  +N+ T+  +  QL LA+ADLFCHMVQW+NG+ +II   S    +   L+D+LKFIPEE ++ +LRLG NR+  +  +L+     V+E+L          +L + F CL SW+    +  ++D     ++  ++ IL++P    E  + AA Q   A  + C   + T   L+   Q N Y+L    Q CA +                + D C   A IF  +A  L P ++  P    S +PGD RTL  L     L+    +RE  A+    L  + D                     S N       + L P F +++  +T  C    A  ES DE  L  FR DV  +M+ I   V  E +F ++   + QL  L  S   Q +     ++AEA L M+ ++ K +  +  E   +   L++ ++LP L  A P   ++V   ++ EL  WA+    +   ++ ++   +     +E+       +L +SA  SAL SLA   +   +     +  P           D W  L+ R+ +    L + P     NF+  +GR  +    S  G V+   N   +    R+ ++C ++++ +++L+             DP VW+D ++A+F +    + R+  G   +   G+      E     Q+A      +   V E +WPV+A ++  + S  R +E   R++R+ +RCF    + LL +IA+KIV AY    + S FLY+  +LVDEFG+   C+ GL++++ A   P   +L G  L +NP+T EDL+RL  RLVQRC   FL+   +D N L ++AVRS+      PG N D
Sbjct:    9 VETVLRAIDALYLNPDTSFKEQASKWLSEFQKSLYAWEISDQLLYMNRDLNSCYFGAQTIRIKIQCYFTELPTSSHEGLKNSLLEHVKKLNAETSVPIANQLCLAVADLFCHMVQWQNGIKDIIEKLSGCDASSGYLIDILKFIPEEMTSSTLRLGSNRRHSLMAQLETNKRQVIELLSLRAKTPEMPMLTRIFNCLASWWDNTGVMTEQDAPVSPLLETVFCILRNPASTPEQAYDAATQWILALLYQCRSFNGTSDGLLTWLQRNIYELLKVLQDCATAIASASSQTLQQEQLDLYKDRCTCLAHIFASLARTLRPALVRQPSAAGSGAPGDLRTLDCLLGVLELVPPLGSRELSAITFHALHSLADDAIRHRSLAAQSNMDSSAGNNSANSGGLRPIAALVPYFTRVVVALTRFCPNNTADLESTDE--LRDFRDDVHDLMQDILGLVGAETIFVELYNHVQQLQMLAVSSNAQVTALEVLHEAEACLFMMTTVAKRLSPHDPE--GYLSNLISGLVLPGLSAACPFPLQEVGCILYMELSHWAACHPQLRRQIVAQLIGIVEKAAGVEASNLQPGQKLAVSAALSALGSLASVYRATPSGGPNGLTSPGSESLRTGLLDDHWQDLVQRVAYNLPRLAWVPVYDATNFFAGIGRGMISSIGSGGGGVDFDPNSSRQAFPSRLAQICSVSLECLDKLMMENIAITGTDTTTDPRVWLDYLAALFRTFGCFLRRLDDGGKQQLGTGTQSIGIREVGSLAQSAQTCLSESLRLVREVIWPVVARVLTFYSSRARHMEHTCRLIRFIVRCFSVHLRDLLPEIAEKIVVAYRTGGQHSSFLYLASVLVDEFGEQPDCRFGLVRVYEALGGPTLKLLDGPALSQNPHTVEDLYRLCTRLVQRCPVAFLTSEEVDFNELCNVAVRSLGLYCTGPGANDD 939          
BLAST of Transportin-3 vs. Ensembl Cavefish
Match: tnpo3 (transportin 3 [Source:NCBI gene;Acc:103043090])

HSP 1 Score: 303.523 bits (776), Expect = 6.761e-88
Identity = 268/1001 (26.77%), Postives = 460/1001 (45.95%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVND-ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATD--FFCNDIHTIPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDET---------RSQLAPIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            P++    +++  L+H    +  + AS +L ELQ+S +AW I+DQLL + +D+ + YF AQTM+ KIQ  F ELP E+H++L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  +I  YS    ++P L+++L  +PEE  +RSLR+G NR+TEI  +L   S +V+ +L   +  S +++ +LIK F CL SWF + +     + + +++  ++ +L+     S +L +AA  C     +   ++ T   L  Q       LE AY +  A    D  L+Y +IF E+    L I +  P        GD RTL++LL+ AG  +         +++++ +  +RL E               P  ++L+  +  HC +        ED  +   FR  V  +++ +   V     F       SQL  +     P  +   EAVL ++ ++ K VD     N   TE L   V+LP       + +  +  + GE+          ++ ++  + K L E            S    A+ ++   C+   A               H F  L    + L +F  AL     I       + L + P E +A  + +LC + V  + +L+   S +       DP VW+D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V  Y     SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R VQR     L  GS  +  +   A+ +    + DA    ++F+ +  +    ND +    +R R +     +    L   LI+ C +     T  D+ E + ++++  R       F   L++AL  +      G V  T  Q+    K  +S  +  QV   +  F +L+
Sbjct:    6 PSLAMVYQAVQALYHDPDPSGKERASVWLGELQRSMHAWEISDQLLQLKQDVESCYFAAQTMKMKIQTSFYELPQETHLALRDSLLSHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLIEKYSNDVTSMPFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSTTVITLLLSCVEKSGSDEKMLIKVFRCLGSWFNLGVLDSNFMASNQLLMVLFQVLQRDE-TSTNLHEAASDCVCSALYAIENVDTHVALAMQLFQGVLTLETAYHMAVAREDLDKVLNYCRIFTELCETFLEITVRSP----GQGMGDLRTLELLLICAGHPQY-------EVVEISFNFWYRLGEHLYKTNDPALHGVFRPYIQRLLHSLARHCQLDPDHEGIPEDTDDFGEFRMRVSDLVKDVIFLVGSMECF-------SQLYSTLKDGNPP-WEVTEAVLFIMAAIAKSVDPEN--NPTLTEVLEQVVLLP--QTVHVAVRYTSIELVGEMSEVVDRNPRFLNPVLSYLMKGLREKPL--------ASVAAKAIHNICSVCRDHMA---------------HHFQGLLEIARSLDSF--ALSTEAAIGLLKGTALVLARLPLEKIAECLSDLCSVQVLALKKLLGQDSSN---GKSADPTVWLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNTHQADNRIVERCCRCLRFAVRCVGKGSASLLQPLVTQMVNVYQVYPHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCMPTFQLLEQPNGLRNHPDTVDDLFRLATRFVQRSPVTLL--GSNIIVHIIQCAIAATTLDHRDANCSVMKFVRDLIHTGVSNDHEDDFELRKRLIAQAMEQHGQQLVTQLIHTCCFCLPSYTLPDVAEVLWEIMVFDRP-----TFCRWLEAALKGLPKEMSGGAVTVTHKQLTDFHKQVTSAEECKQVCWAVREFTRLY 922          
BLAST of Transportin-3 vs. Ensembl Cavefish
Match: si:ch73-182a11.2 (importin-13-like [Source:NCBI gene;Acc:103045355])

HSP 1 Score: 89.7373 bits (221), Expect = 9.276e-18
Identity = 180/878 (20.50%), Postives = 352/878 (40.09%), Query Frame = 1
Query:   61 TVEATLESIDILHH-VKSGNVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCH--MVQWKNGLDEIITTYSQKAETIPI------LLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIK--CFECLNSWFL--INLFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-----QFQINTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDY---RTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLAPIFEQLITIMTCHCAVT--------ESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCK---RQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCL-CIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACK-------LGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLF 2544
            TVEA   ++  L++       N A  +L++ Q S  AW     LL  +K     +FGA T+  KI  H+ +LP E H SL+  L+  +   +      VLT+L +ALA L  H  +  W   + +++  +     ++ +      LL+VL  +PEE   R  +L   R+  +   L  +  S+  +L Q L        +K     CL+SW    ++L   + LL        + +LK   +   A E+L  A  QC    F +  +  +PQ++      +  +    +E  + IC        +H    L+    + +   AL+ ++L C     +  PG Y    T   L LT     +   + LD     T+ +   L   R    P++ QL+ ++                S+D+     +R D+   +  +   +  E++ R +   L  LL  +     S++   EA+L    S+ + VD + S+       L     +P +        +      G L  W ++   ++   ++ + + L  S  D S+  +      S L+ +   C+   R +A  +      ++++  H+ T++ +         +ALG  L  +P             E +  ++  L   ++  + RL  N++ S  P         +  IS+IF ++  + T + G       Q D   +  Q    P +     V++ ++P++  L+  ++ +  V+     +   SL+       PL++ + + I   ++   ++C L +   LV  F    AC+         L+++  + ++  F      G  ++P+  +   +L  ++++R  PD    G LD+  +F
Sbjct:   16 TVEAVERALQQLYYDPDMTQKNVAQKWLSQAQASPQAWLFCWALLRPDKVPEIQFFGASTLHAKITRHWTDLPAEQHESLRSQLIAEVGRFSCGPK-MVLTRLCVALASLILHNLLDSWTTAVPDLLRAFQGGEGSVEVDVRHQALLEVLVVLPEELQIR--KLPAERRAHLQRALAQEWSSLCPILRQILRKETTAGQVKERVLRCLSSWLALDVDLGESEGLLQDS-----FTLLKERELFDTAVETLVSAISQCDCQRFVDSLLKMMPQVLALQEPLKKSVQDRDMETCHGICRIAVALGETHCRTLLEQVDQW-QGFQALVSMILSC-----TGMPGHYPVDETSSSLTLTFWYTLQDDIMSLD-----TEKQTLYLQVYR----PVYFQLVEVLLHKARFPSDQEFTSWSSDDKEQFRTYRVDISDTLMCVYELLGPELL-RNLYDKLGVLLTDT--THSSSWQDVEALLYGFQSIAETVDVSYSDVIPGLIGL-----IPLITATNVQLAETIMLTIGSLAEWLADHSIMLAGALRLVLQAL--SNADLSVSTV------STLKRICRECRHHLRPHANDILTASQEVLVKQIHKTTQIMW-------LMQALGYLLSSLPD------------EEILGKLLSLLSPHIQQLERLA-NETPS--PASKLSTLHILGLISSIFSTL-DLNTQREG-------QEDSRNSHFQPHANPVVV----VLQQVFPLIQTLLSKWLKETEVVTAACAVFEKSLKTLIRDFAPLVDQLCELIGQLFSSYPQACALDLTRQLVHVF----ACEKEHFPPIAALLELVTSITMAIFQ----HGARDHPDVADSFMQLHTQVMKR-KPDVYLTGGLDIKVVF 811          
BLAST of Transportin-3 vs. Ensembl Cavefish
Match: ipo13 (importin 13 [Source:NCBI gene;Acc:103033579])

HSP 1 Score: 80.4925 bits (197), Expect = 6.974e-15
Identity = 125/524 (23.85%), Postives = 228/524 (43.51%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLIN--LFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-----QFQINTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P E + +LK  L   +  + +S +  VLT+L +ALA L  +M+   W   + E++  + ++   +        LL++L  +PEEF  ++ RL   RK ++ G L  +  +V  +L+Q L   +   L+K    +CL+SW L++  L   + LL        +  L  P +   A E++  A  Q  +  + N  +  +PQ++Q     +  +    +E ++ IC        +H+   L+  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++  H A   +++E    ++ SD     EQ R++ VDI    +   +MLG          L +LL ++   QP+++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   37 NKNLAQKWLMQAQISPQAWQFCWALLSPDKVPEIQYFGASALHTKISRYWGDIPAEQYDTLKTQLFSQI-ALFASGSKIVLTRLCVALASLALNMMPEAWPGAVSEMVRMFQEEGGGVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALGREWAAVYPLLQQLLRQPDSPALVKARVLKCLSSWVLLDVPLSESEGLLEAG-----FAALSDPELFDTAVEAIVNAISQPDSQRYVNTLLKLVPQVLQLQEQLREAVQNGDMETSHGICRIAVSLGENHSRTLLEQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDIMSFEAEKQAVYLQVYRPVYFQLVDVL-LHKAQFPTDEE--YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTNAE--QPTSWQHTEALLYGFQSIAETIDVNYSDVIPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 522          
BLAST of Transportin-3 vs. Ensembl Cavefish
Match: ipo13 (importin 13 [Source:NCBI gene;Acc:103033579])

HSP 1 Score: 80.4925 bits (197), Expect = 6.974e-15
Identity = 125/524 (23.85%), Postives = 228/524 (43.51%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLIN--LFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-----QFQINTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P E + +LK  L   +  + +S +  VLT+L +ALA L  +M+   W   + E++  + ++   +        LL++L  +PEEF  ++ RL   RK ++ G L  +  +V  +L+Q L   +   L+K    +CL+SW L++  L   + LL        +  L  P +   A E++  A  Q  +  + N  +  +PQ++Q     +  +    +E ++ IC        +H+   L+  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++  H A   +++E    ++ SD     EQ R++ VDI    +   +MLG          L +LL ++   QP+++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   37 NKNLAQKWLMQAQISPQAWQFCWALLSPDKVPEIQYFGASALHTKISRYWGDIPAEQYDTLKTQLFSQI-ALFASGSKIVLTRLCVALASLALNMMPEAWPGAVSEMVRMFQEEGGGVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALGREWAAVYPLLQQLLRQPDSPALVKARVLKCLSSWVLLDVPLSESEGLLEAG-----FAALSDPELFDTAVEAIVNAISQPDSQRYVNTLLKLVPQVLQLQEQLREAVQNGDMETSHGICRIAVSLGENHSRTLLEQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDIMSFEAEKQAVYLQVYRPVYFQLVDVL-LHKAQFPTDEE--YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTNAE--QPTSWQHTEALLYGFQSIAETIDVNYSDVIPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 522          
BLAST of Transportin-3 vs. Ensembl Cavefish
Match: ipo13 (importin 13 [Source:NCBI gene;Acc:103033579])

HSP 1 Score: 80.1073 bits (196), Expect = 7.627e-15
Identity = 125/524 (23.85%), Postives = 228/524 (43.51%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLIN--LFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-----QFQINTYQLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS-RNFRLDETRSQLA---PIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N N A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P E + +LK  L   +  + +S +  VLT+L +ALA L  +M+   W   + E++  + ++   +        LL++L  +PEEF  ++ RL   RK ++ G L  +  +V  +L+Q L   +   L+K    +CL+SW L++  L   + LL        +  L  P +   A E++  A  Q  +  + N  +  +PQ++Q     +  +    +E ++ IC        +H+   L+  + +     AL+ +++ C     +  PG Y            N    +L L     + D   +F  ++    L    P++ QL+ ++  H A   +++E    ++ SD     EQ R++ VDI    +   +MLG          L +LL ++   QP+++   EA+L    S+ + +D N S+       L     +P +        D      G L  W ++  P+M
Sbjct:   30 NKNLAQKWLMQAQISPQAWQFCWALLSPDKVPEIQYFGASALHTKISRYWGDIPAEQYDTLKTQLFSQI-ALFASGSKIVLTRLCVALASLALNMMPEAWPGAVSEMVRMFQEEGGGVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALGREWAAVYPLLQQLLRQPDSPALVKARVLKCLSSWVLLDVPLSESEGLLEAG-----FAALSDPELFDTAVEAIVNAISQPDSQRYVNTLLKLVPQVLQLQEQLREAVQNGDMETSHGICRIAVSLGENHSRTLLEQVEHWQSFL-ALVNMIMFC-----TGIPGHY----------PVNETTSSLTLTFWYTLQDDIMSFEAEKQAVYLQVYRPVYFQLVDVL-LHKAQFPTDEE--YASWSSD---EKEQFRIYRVDISDTLMYVYEMLGAELLSNLYDKLGRLLTNAE--QPTSWQHTEALLYGFQSIAETIDVNYSDVIPGLIGL-----IPRININNVQLADTVMFTIGALAEWLADH-PVM 515          
BLAST of Transportin-3 vs. Ensembl Sea Lamprey
Match: tnpo3 (transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708])

HSP 1 Score: 262.692 bits (670), Expect = 2.092e-74
Identity = 261/966 (27.02%), Postives = 440/966 (45.55%), Query Frame = 1
Query:  166 AWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEII--TTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLS--LNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQ--CATDFFCNDIHTIPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLA---------PIFEQLITIMTCHCAV-TESEDEP----NLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAH-IPVRVRTV-GWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQI---QKLRSSMLQDSQVLEGLETFAKLF 2982
            AW I+DQLL M +D+ + YF AQTM+ KIQ  F ELP ++H SL++SL+ H+  +    +P ++TQL+LA+ADL   M  WK  +  +I    Y     ++P LL++L  +PEE  +RSLR+G NR+TEI  EL   S  VV +L        +++  L+K F CL SWF + +     + N +++  ++ +L+  + A  +L +AA    C+  +   ++HT   L  Q       L+  Y +  A    D  L+Y ++F E+A   L +++  P        G+  TL MLL  AG    C   V +I  ++     +RL E   QL          P  ++LI  +  HC +  + E  P    +   FR  V  +++ +   V     F ++   L     S+P      +   EAVL ++ ++ K +D++ ++  A  E +   V LP    A  + +  +  + GEL  +       ++ ++  + K L + +          SA  SA+QS+   C+   A   +      ++++      L   ++  +   +     L         + L +  E+L     +LC + V+ + +L+  ++ + V     DP +W+D ++AIF         ++  P + + Q    +A IQ                +WPVL+D ++   +D R++ER  R LR+++RC    +  LL  +  ++         SCFLY+G ILVDE+G ++ C+ GL  M  AF  P F +L Q  GL  +P+T +DLFRL  R +QR     L   ++    +   A+ +    + DA    ++FL +  +    ND       R   V G LQ  G   + R L   C +     T  DL E + +L +  R+      F   L+ +L  +      G V AT  Q+    K  +S    + V   L  F KL+
Sbjct:    1 AWEISDQLLQMRRDVESCYFAAQTMKMKIQFAFFELPADTHASLRDSLLTHIETLK-DVSPVIVTQLALAIADLALQMATWKGCVQTLIEKARYGNDVSSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEELAYHSAVVVTLLAACAENCGSDEKTLVKVFRCLASWFNLAVLDCHFMANNKLLLILFQVLQH-DQAPSALHEAACDCLCSALYGLENVHTELPLATQLFEGVMTLQNGYHMAVAREDLDKALNYCRVFTELAETFLEMIVLSP----GHGLGNLWTLDMLLTCAG---HCQYEVAEITFNLW----YRLCEQLFQLKDNDLNAVFRPYAQRLIHALCRHCQMDPDHEGVPDEADDFWEFRLRVSDLVKDVIFLVGPAECFAQLFATLKD---SNPP-----WEVTEAVLFIMSAIGKSIDSDNAQTLA--EVMQAVVTLP--DDAHLAVQYTSIQLVGELGDFIDRNPHFLEPVLNFLTKGLRQKEL--------ASAAASAVQSVCSACRDHMAVHFEG-----LLQIARSIDTLGLSHESAIGLLKGTALVL-------ARLPLDKISESLK----DLCAVQVNALKKLLTLEASNGVST---DPTIWLDRLAAIF---------RHTNPIVENGQLHPCQAVIQE---------------IWPVLSDTLNKNQADNRIVERCCRCLRFAIRCVGKGSASLLHPLVTQVRTRAHMHPHSCFLYLGSILVDEYGTEEGCRQGLHDMLQAFCGPTFLLLEQPSGLRNHPDTVDDLFRLATRFIQRSPVTLLQSAAMPA--ILQCALVAATLDHRDANCSVMKFLRDMVHTGIVNDHKEDFEARRELVHGILQQHGQVLVDRLLQAACFYLPPS-TLSDLSEVLWELELFDRA-----TFCRWLEHSLKGLPKESTGGAVTATHKQLTDFHKQVTSAEDCNAVTWALREFTKLY 882          
BLAST of Transportin-3 vs. Ensembl Sea Lamprey
Match: IPO13 (importin 13 [Source:HGNC Symbol;Acc:HGNC:16853])

HSP 1 Score: 60.077 bits (144), Expect = 2.762e-9
Identity = 119/531 (22.41%), Postives = 201/531 (37.85%), Query Frame = 1
Query:  121 NDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMV--QWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVV-----EVLEQSLSLNNDIVLI------------KCFECLNSWFLINLFHDKDLLNCR-VISCIYDILKSPNI---ASESLFKAAVQCATDFFCND-IHTIPQLVQ-QFQ----INTYQLEAAYQIC------AYSHADYCL---DYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILI--DVTDSRNFRLDETRSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMF-VDIE---VVFRKMLG---------DLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            N A  +L + Q S  AW  +  LL   K     YFGA  +  KI  ++ ++P E + +LK  L   +          VLT+L +ALA L  + +   W   + ++   +       P LL++L  +PEE   ++ RL  +RK  + G L  ++ + V      +LEQ                       K   C  SW  +    D  L  C  ++   +  L+   +   A ++L +A  Q     + N  +  IPQ++Q Q Q    +     E  + IC        +HA   L   D+ + F     AL+ +V+ C     +  PG Y               C  L     +  D+T     +         P++ QL+ ++          +  +  A         EQ R++ VDI    +   +MLG          L +LL ++   QP  + + EA L    S+ + +D N S+       L+ ++    +G  Q    D      G L  W ++  P+M
Sbjct:   40 NAAQKWLMQAQVSPDAWHFSWVLLGSEKAPEIQYFGASALHTKISRYWADIPSEQYEALKSQLSTRIAQFADGPK-MVLTRLCVALASLALNTLPDAWPTAVSDMTQAFPPG----PALLELLTVLPEEL--QTSRLAQHRKGVVRGVLAREAPACVFPLLLRLLEQGGGGGGGGAGDGAASAGATTLGQKVLRCFASWVQL----DVPLTECEGLVHSTFRALRDAELFDTAVDALVQAISQPDAQRYVNTLLKLIPQVLQLQEQLTQAVQNGDTETTHGICRVVVALGENHARTLLEQTDHWQSFL----ALVNMVMYC-----TGIPGHY--------PVDETTSCLTLTFWYTLQDDITSLGGEKQAMYLQMYRPVYFQLVDVLLYKAQFPTDAEYASWSADEK------EQFRIYRVDISDTLMYVYEMLGPELLSNLYDKLGRLLTAT--GQPPQWQQTEAFLYGFQSIAETLDVNDSDVIPGLIGLIPRI---TVGNVQ--LADTIMFTIGALAEWLADH-PVM 528          
BLAST of Transportin-3 vs. Ensembl Yeast
Match: MTR10 (Nuclear import receptor; mediates the nuclear localization of proteins involved in mRNA-nucleus export; promotes dissociation of mRNAs from the nucleus-cytoplasm mRNA shuttling protein Npl3p; required for retrograde import of mature tRNAs; relocalizes from cytoplasm to the nuclear periphery upon DNA replication stress [Source:SGD;Acc:S000005686])

HSP 1 Score: 66.2402 bits (160), Expect = 1.808e-11
Identity = 71/238 (29.83%), Postives = 120/238 (50.42%), Query Frame = 1
Query:  121 NDASNFLTELQQSNYAWSIADQLLY----MNKDLVTSYFGAQTMRNKIQLHFDELPFESHV-SLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEE---FSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSL--NND------IVLIKCFECLNSWFLINLFHDKDLLNCR-VISCIYDILKSPNIASESLFKAAVQC 783
            N A  FL + Q+S  AWSI +++L      N  L  + F AQT+RNK+     +L  E+++   K+SL+  L + N      ++TQL++ALA L    ++W+N + EII+  +       ILL+ L+ +PEE    ++ SL   V   + I   +D  +  V++ L   + L  N D      I L +   CLNSW     F  + LL  + +I+ +++ + + N +    F +A+ C
Sbjct:   26 NKALQFLEQFQRSTVAWSICNEILSKEDPTNALLELNIFAAQTLRNKVTYDLSQL--ENNLPQFKDSLLTLLLSHNQKL---IITQLNVALARLAIQFLEWQNPIFEIISLLNSSPS---ILLNFLRILPEETLDIASTSLT-EVEFNSRIHELIDPIAEDVLKFLVSCIDLLQNTDGNSSSSISLEQILRCLNSWSY--EFPVEQLLTVQPLINLVFETISNGNESDMEAFDSAIDC 252          
BLAST of Transportin-3 vs. Ensembl Nematostella
Match: EDO32037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW84])

HSP 1 Score: 290.812 bits (743), Expect = 9.361e-84
Identity = 267/1001 (26.67%), Postives = 477/1001 (47.65%), Query Frame = 1
Query:   58 PTVEATLESIDILHHVKSGNVND-ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSL--NNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHT-------IPQLVQQFQINTYQLEAAYQICAYSHADY--CLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNR-ECCALVLDILIDVTDSRNFRLDETRSQL-APIFEQLITIMTCHCAV-TESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNS-ALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDP-CDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGE-GLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVE-------SFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQVLEGLETFAKLFS 2985
            PTVE     I  L++    +  + AS +L  LQ+S YAW IADQLL  N D+ TSYF AQTMR K+Q +F EL    H SL++S++ HL N ++++   ++TQL LALADL   M QWK+ +DE+   +    E++P+LL++L  +PEE  +  LR+G NR+  +  EL   + + + ++   +     ++ + IK F C  SW ++  F  ++ +N ++++   + L +P   +  +   A   A DF CN ++T       +P     FQ     L  AY+  A +  D+   L+  ++F EM  + L  +++ P  D     GD RTL +LL     N+ E   +  +    ++++     D+++S +  P  E+LI  ++ HC +  + E  P+  +  S+    + ++       V   K    + Q LVS       ++   E++L ++ ++ + V       A    Q L  ++L        + K  +  + GEL  W  +    +D ++Q    FLL     S++    +S+ ++ A++ + V C +Q  +      + ++ ++      L   ++  V   + + + L      EG+    ++P+ +   +  LC   V  +N+      IS  P +   DP +W+D ++A+F S+         RP  G              T P       V+E +WP LA+L + +  D +++ER  R +R+++RC       LL  +  ++V  YA+ K SCFLY+G ILVDE+GD++ C  GL+QM  A ++P F +L GE GL E+P+T +DL+RL+ R +Q+    FL       N     A+ +    + +A +  ++FL E            +++ +  I  R   V  + +    ++   LI+ C          ++ + + +LL   R      E L  +  +L ++      G V AT  Q+++  +S L  +   +G+   AK+FS
Sbjct:    9 PTVEQVRSVISTLYNSPDPHAKEKASEWLGHLQRSVYAWEIADQLLMQNTDVETSYFAAQTMRTKVQYYFHELQPAQHDSLRQSILHHLANRHNASQ-AIITQLCLALADLAVQMPQWKHVVDELAHRFGSSVESLPLLLELLTVLPEEVDSHHLRVGANRREAVLNELRHSAHTALHLMTTCVEKCSADEKIRIKLFRCAGSWVMLGAFPPQEFVNSKLMAITIETLMNPTQQTSDMLHEA---AADFICNALYTAEDLDLHLPLADGLFQ-KVMALGPAYE-AAVNEEDFDRALNLCRVFTEMGESFLHQIVDMPGRD----LGDLRTLSILLSCVQHNQYEIAEITFNFWYRLSEAIFKTEDDSKSNVFKPYIEKLIESLSSHCRMEADHEGIPDEESEFSEFRERVSELIKDCVFIVSSTKCFQQMYQSLVSHGSNM--SWEFTESILFVMATVARAVALESDVVA----QFLP-IVLNLPEAVHIAVKYTSIRLIGELADWIEKHPDFLDPIMQ----FLL-----STVQVQSLSSVSAVAVEQICVACHKQMGR-----HFDVLAQVVIATDSLHMSSEATVGLIKGVCKIL------EGV----ESPDKITEGMRRLCSAQVSALNQ------ISHAPANSFPDPTLWLDRLAAVFRSI-------EYRPSSGK-------------THPCQV----VVEEVWPTLANLCEKYQHDVKIIERCCRCMRFAVRCIGKSAGNLLSPMVDQMVRIYANHKHSCFLYLGSILVDEYGDEEGCVPGLVQMTKALALPTFEILSGEKGLVEHPDTVDDLYRLISRCIQKFPLQFLQCDM--ANHALQCAIAAATLQHREANSSVMKFLKELILSGAIKVQGLHKDKNDQIHERSSLVRQILSGQGQNIVNGLIHACAGSLPTYMIPEVADVIYELLAFCR-----QETLQWISHSLSSLPTQSVPGHVIATPEQLREFHNS-LSSASNQQGVWKAAKVFS 930          
BLAST of Transportin-3 vs. Ensembl Medaka
Match: tnpo3 (transportin 3 [Source:NCBI gene;Acc:101165123])

HSP 1 Score: 305.064 bits (780), Expect = 1.736e-88
Identity = 266/981 (27.12%), Postives = 457/981 (46.59%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQC------ATDFFCNDIHTIPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDET---------RSQLAPIFEQLITIMTCHCAVTES-----EDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNP-ETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVL-QGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQND-DAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLR---SSMLQDSQVLEGLETFAKLF 2982
            AS +L ELQ+S YAW I+DQLL + +D+ + YF AQTM+ KIQ+ F ELP E+H +L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  Y+    ++P L+++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  + +++ +LIK F CL SWF + +     +   +++  ++ +L+     + +L +AA  C      AT+   N++    QL Q        LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  +         +++++ +  +RL E           S   P  ++L+  +  HC +        ED  +   FR  V  +++ +   V     F       SQL  +     P  +   EAVL ++ S+ K VD +   N   +E L   V+LP       + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ      +  ++ +           +  V   +               + L + P E ++  + +LC + V  + +L+  QS +       DP VW+D ++ IF         ++  P + + Q+   +  IQ                +WPVL++ ++   +D R++ER  R LR+++RC    +  LL+ +  ++V+ Y     SCFLY+G ILVDE+G ++ C+ GL+ M  A  +P F +L Q  GL  +P+T +DLFRL  R VQR SP  L   S+ V+ +   AV +    + DA    ++F+ +  +    ND +    VR R +G    +    L   L++ C +     T  D+ E + ++++  R       F   L++AL  +      G V  T  Q+       +S  +  QV   +  F +LF
Sbjct:   30 ASVWLGELQRSMYAWEISDQLLQLRQDVESCYFAAQTMKMKIQMCFYELPPETHNALRDSLLTHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLLEKYNNDVSSMPFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSSTVVTLLTSCVEKTGHDEKMLIKVFRCLGSWFNLGVLDSNFMAGNQLLMVLFQVLQRDETTT-NLHEAASDCVCSALYATENVDNNMALALQLFQ----GVLTLETAYHMATAREDLDKVLNYCRIFTELCETFLETMVRSP----GQGMGDLRTLELLLICAGNPQY-------EVVEISFNFWYRLGEHLYKINDPALHSVFRPYIQRLLHCLARHCQLDPDHEGIPEDTDDFGEFRVRVSDLVKDVIFLVGSMECF-------SQLYSTLKDGNPP-WEVTEAVLFIMASISKSVDPDN--NPTLSEVLQQVVLLP--EGVHMAVRYTSIELVGEMSEVVDRNPRFLDPVLSYLMKGLREKPL--------ASAAAKAIHNICSVCRDHMAQ-----HFQGLLDIARSLDSFALSTEAAVGLLKGTA------------LVLARLPLEKISECLSDLCAVQVIALKKLLTEQSTN---GKSADPTVWLDRLAVIF---------RHTNPIVENGQTHPCQKVIQE---------------IWPVLSETLNAHQADNRIVERCCRCLRFAVRCVGKGSASLLQPLVTQMVSVYQVFPHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCMPTFQLLEQPNGLRNHPDTVDDLFRLATRFVQR-SPVTLLSSSIIVH-IIQCAVAATSLDHRDANCSVMKFVRDLIHTGVANDHEEDFEVRKRLIGQAMEQHGQQLISQLLHSCCFCLPPYTLPDVAEVLWEVMVFDRP-----TFCRWLENALKALPKETSGGAVTVTHKQLTDFHRQVTSAEECKQVCWAVREFTRLF 922          
BLAST of Transportin-3 vs. Ensembl Medaka
Match: tnpo3 (transportin 3 [Source:NCBI gene;Acc:101165123])

HSP 1 Score: 166.392 bits (420), Expect = 3.314e-41
Identity = 179/652 (27.45%), Postives = 306/652 (46.93%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSL--SLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQC------ATDFFCNDIHTIPQLVQQFQINTYQLEAAYQIC-AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNF--RLDET---------RSQLAPIFEQLITIMTCHCAVTE-----SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDL---SQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLC-IPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIF 1995
            AS +L ELQ+S YAW I+DQLL + +D+ + YF AQTM+ KIQ+ F ELP E+H +L++SL+ H+ N+    +P ++TQL+LA+ADL   M  WK  +  ++  Y+    ++P L+++L  +PEE  +RSLR+G NR+TEI  +L   S +VV +L   +  + +++ +LIK F CL SWF + +     +   +++  ++ +L+  +  + +L +AA  C      AT+   N++     L  Q       LE AY +  A    D  L+Y +IF E+    L  ++  P        GD RTL++LL+ AG  +     V++I        NF  RL E           S   P  ++L+  +  HC +        ED  +   FR  V  +++        +V+F  ++G +   SQL  +     P  +   EAVL ++ S+ K VD    +N     ++L QV+L   G    + +  +  + GE+          +D ++  + K L E            SA   A+ ++   C+   AQ  +      ++ +           +  V   +     L  +P  +E + E           + +LC + V  + +L+  QS +       DP VW+D ++ IF
Sbjct:   30 ASVWLGELQRSMYAWEISDQLLQLRQDVESCYFAAQTMKMKIQMCFYELPPETHNALRDSLLTHIQNLK-DLSPIIVTQLALAIADLALQMASWKGCVHTLLEKYNNDVSSMPFLIEILTVLPEEVHSRSLRIGANRRTEIIEDLAYYSSTVVTLLTSCVEKTGHDEKMLIKVFRCLGSWFNLGVLDSNFMAGNQLLMVLFQVLQR-DETTTNLHEAASDCVCSALYATENVDNNM----ALALQLFQGVLTLETAYHMATAREDLDKVLNYCRIFTELCETFLETMVRSP----GQGMGDLRTLELLLICAGNPQY---EVVEISF------NFWYRLGEHLYKINDPALHSVFRPYIQRLLHCLARHCQLDPDHEGIPEDTDDFGEFRVRVSDLVK--------DVIF--LVGSMECFSQLYSTLKDGNPP-WEVTEAVLFIMASISKSVD---PDNNPTLSEVLQQVVLLPEGVHM-AVRYTSIELVGEMSEVVDRNPRFLDPVLSYLMKGLREKPL--------ASAAAKAIHNICSVCRDHMAQHFQ-----GLLDIARSLDSFALSTEAAVGLLKGTALVLARLP--LEKISEC----------LSDLCAVQVIALKKLLTEQSTN---GKSADPTVWLDRLAVIF 619          
BLAST of Transportin-3 vs. Ensembl Medaka
Match: ipo13 (importin 13 [Source:NCBI gene;Acc:101155839])

HSP 1 Score: 66.6254 bits (161), Expect = 1.371e-10
Identity = 57/197 (28.93%), Postives = 97/197 (49.24%), Query Frame = 1
Query:  115 NVNDASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQ--WKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLINL 675
            N N A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P + + SLK  L   +   +S +   VLT+L +ALA L  + +   W   + E++  + ++A  +        LL++L  +PEEF  ++ RL   RK ++ G L  +  SV  +L+Q L   +    +K     CL+SW  +++
Sbjct:   79 NKNLAQKWLMQAQISPQAWQFCWILLSPDKVPEIQYFGASALHTKISRYWSDIPTDQYESLKSQLFSQIACFSSGSK-MVLTRLCVALASLALNTMPEAWPGAVAEMVRVFQEEAGGVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALAREWGSVCPLLQQLLRRTDSPGAVKARVLRCLSSWVQLDV 272          
BLAST of Transportin-3 vs. Ensembl Medaka
Match: si:ch73-182a11.2 (importin-13 [Source:NCBI gene;Acc:101174623])

HSP 1 Score: 64.6994 bits (156), Expect = 4.963e-10
Identity = 121/522 (23.18%), Postives = 217/522 (41.57%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQ--WKNGLDEIITTYS-QKAETIP---------------ILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLI--KCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNI---ASESLFKAAVQCATDFFCNDIHTIPQLVQQF--QINTY----QLEAAYQIC------AYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDY---RTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLAPIFEQLITIM--TCHCAVTE------SEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIM 1554
            A  +LT+ Q S   W     LL  +K     +FGA T+  KI  H+ +LP E H +L+  L+  + + ++     V T+L +ALA +  +++   W   + +I+  +  QK ++                  LL++L  IPEEF   S RL   R++++   L  +  +V  +L Q L   +   L+  K   CL+SW  +++   +   +  ++   +  L +P +   A E++     Q     + + + ++  LV     Q+ T      +E ++ IC        +H+   L+    + E   AL+ ++L C     S  PG Y    T   L LT         L  DIL    + +   L   R    P++ QL+ ++    H    E      S+D+     +R D+   +  +   +  E++ +   G   QL+   PQ Q   +   EA+L    S+ + +D N S+       LL ++ +  L  A     D      G L  W ++  P+M
Sbjct:   38 AQKWLTQAQASAQGWQWCWALLGSDKIPEVQFFGASTLHIKICHHWSDLPTEQHETLRMQLLSQILHFSAGPK-MVRTRLCVALASMALNLIPHVWSQPVVDIVRAFQPQKQDSEGGCSAEVSRDPQAHCLALLELLTVIPEEF--LSSRLAPARRSQLREALASEWATVCPMLRQLLQSQDSSSLVKEKVLHCLSSWVGLDVSLGE---SQELVQDFFSTLSNPQLFDSAVETIVTVISQPDCQRYIDALLSLMPLVLGLYDQLKTAAQVGDMETSHGICRIAVALGETHSRVLLEQLDHWQEYL-ALVNMILFC-----SGIPGHYPVSETTSSLTLTFWYT-----LQDDILSFEEEKQAVYLQVYR----PVYFQLVDVLLQKSHYPSEEEYASWSSDDKEQFRIYRVDISDTLMYVYEILGSELLSKLYDGLGRQLM--DPQ-QSGVWQDTEALLFGFQSIAETIDVNYSDVIPGLIGLLPRINISNLMLA-----DTVMYTIGSLAEWLADH-PVM 529          
BLAST of Transportin-3 vs. Ensembl Medaka
Match: ipo13 (importin 13 [Source:NCBI gene;Acc:101155839])

HSP 1 Score: 64.3142 bits (155), Expect = 5.828e-10
Identity = 55/193 (28.50%), Postives = 95/193 (49.22%), Query Frame = 1
Query:  127 ASNFLTELQQSNYAWSIADQLLYMNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQ--WKNGLDEIITTYSQKAETI------PILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKC--FECLNSWFLINL 675
            A  +L + Q S  AW     LL  +K     YFGA  +  KI  ++ ++P + + SLK  L   +   +S +   VLT+L +ALA L  + +   W   + E++  + ++A  +        LL++L  +PEEF  ++ RL   RK ++ G L  +  SV  +L+Q L   +    +K     CL+SW  +++
Sbjct:    1 AQKWLMQAQISPQAWQFCWILLSPDKVPEIQYFGASALHTKISRYWSDIPTDQYESLKSQLFSQIACFSSGSK-MVLTRLCVALASLALNTMPEAWPGAVAEMVRVFQEEAGGVDGRARCLALLELLTVLPEEF--QTSRLPQYRKGQVRGALAREWGSVCPLLQQLLRRTDSPGAVKARVLRCLSSWVQLDV 190          
BLAST of Transportin-3 vs. Planmine SMEST
Match: SMESG000033219.1 (SMESG000033219.1)

HSP 1 Score: 1914.81 bits (4959), Expect = 0.000e+0
Identity = 925/930 (99.46%), Postives = 927/930 (99.68%), Query Frame = 1
Query:  196 MNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTIPQLVQQFQINTYQLEAAYQICAYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQVLEGLETFAKLFS 2985
            MNKDLVTSYFGAQTMRNKIQLHFDELPFESH+SLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTIPQLVQQFQINTYQLEAAYQICAYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYN AEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEY+WPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLL DIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSW SLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQVLEGLETFAKLFS
Sbjct:    1 MNKDLVTSYFGAQTMRNKIQLHFDELPFESHMSLKESLMKHLNNVNSSTNPTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIPEEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFECLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDFFCNDIHTIPQLVQQFQINTYQLEAAYQICAYSHADYCLDYAKIFCEMASALLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDSRNFRLDETRSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVMEQIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNNAEAVLCMIGSLVKFVDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASEREPIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQILKPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQNPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIFLSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYMWPVLADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLADIAQKIVAAYAHSKESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENPNTTEDLFRLMVRLVQRCSPDFLSWESLDVNRLFDMAVRSIPGTNIDAKTLALRFLVESFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKSDEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYATQSQIQKLRSSMLQDSQVLEGLETFAKLFS 930          
The following BLAST results are available for this feature:
BLAST of Transportin-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNPO31.041e-8526.40transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103][more]
TNPO33.168e-8325.83transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103][more]
TNPO33.168e-8325.83transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103][more]
TNPO31.423e-7025.67transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103][more]
TNPO31.382e-4635.03transportin 3 [Source:HGNC Symbol;Acc:HGNC:17103][more]
back to top
BLAST of Transportin-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tsr-18.608e-1527.88pep chromosome:WBcel235:II:2460866:2473370:-1 gene... [more]
tsr-11.581e-1426.03pep chromosome:WBcel235:II:2460842:2473370:-1 gene... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnpo-SR1.256e-7124.75gene:FBgn0031456 transcript:FBtr0077715[more]
Tnpo-SR1.256e-7124.75gene:FBgn0031456 transcript:FBtr0335126[more]
CG109503.997e-1527.23gene:FBgn0034205 transcript:FBtr0086990[more]
cdm2.304e-1125.00gene:FBgn0261532 transcript:FBtr0083619[more]
cdm2.304e-1125.00gene:FBgn0261532 transcript:FBtr0336472[more]
back to top
BLAST of Transportin-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnpo34.312e-9027.04transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708... [more]
tnpo37.450e-9027.04transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708... [more]
tnpo32.283e-8927.17transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708... [more]
ipo131.102e-1323.18importin 13 [Source:ZFIN;Acc:ZDB-GENE-070706-1][more]
si:ch73-182a11.22.254e-1022.49si:ch73-182a11.2 [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNPO36.931e-8027.41transportin 3 [Source:NCBI gene;Acc:100490799][more]
TNPO31.992e-2726.42transportin 3 [Source:NCBI gene;Acc:100490799][more]
klf103.836e-1124.09Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE... [more]
klf104.777e-1124.09Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE... [more]
klf105.683e-1124.09Kruppel-like factor 10 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tnpo31.595e-8726.46transportin 3 [Source:MGI Symbol;Acc:MGI:1196412][more]
Tnpo31.033e-8626.30transportin 3 [Source:MGI Symbol;Acc:MGI:1196412][more]
Tnpo31.125e-1928.17transportin 3 [Source:MGI Symbol;Acc:MGI:1196412][more]
Ipo131.483e-1024.00importin 13 [Source:MGI Symbol;Acc:MGI:2385205][more]
back to top
BLAST of Transportin-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P2B1|TNPO3_MOUSE1.116e-8626.46Transportin-3 OS=Mus musculus OX=10090 GN=Tnpo3 PE... [more]
sp|Q9Y5L0|TNPO3_HUMAN4.997e-8526.40Transportin-3 OS=Homo sapiens OX=9606 GN=TNPO3 PE=... [more]
sp|Q8GUL2|MOS14_ARATH2.701e-1227.19Transportin MOS14 OS=Arabidopsis thaliana OX=3702 ... [more]
sp|Q9USZ2|YNR7_SCHPO8.920e-1132.82Uncharacterized protein C11G11.07 OS=Schizosacchar... [more]
sp|O94829|IPO13_HUMAN1.020e-924.00Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 ... [more]
back to top
BLAST of Transportin-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MGB25.610e-11629.08Xpo1 domain-containing protein OS=Opisthorchis fel... [more]
A0A074ZUY05.872e-11629.31Xpo1 domain-containing protein OS=Opisthorchis viv... [more]
A0A564YSP51.224e-11328.28Xpo1 domain-containing protein OS=Hymenolepis dimi... [more]
A0A158QC447.155e-11128.19Xpo1 domain-containing protein OS=Hymenolepis dimi... [more]
A0A4S2MFY73.245e-11030.80Xpo1 domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnpo36.761e-8826.77transportin 3 [Source:NCBI gene;Acc:103043090][more]
si:ch73-182a11.29.276e-1820.50importin-13-like [Source:NCBI gene;Acc:103045355][more]
ipo136.974e-1523.85importin 13 [Source:NCBI gene;Acc:103033579][more]
ipo136.974e-1523.85importin 13 [Source:NCBI gene;Acc:103033579][more]
ipo137.627e-1523.85importin 13 [Source:NCBI gene;Acc:103033579][more]
back to top
BLAST of Transportin-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tnpo32.092e-7427.02transportin 3 [Source:ZFIN;Acc:ZDB-GENE-040426-708... [more]
IPO132.762e-922.41importin 13 [Source:HGNC Symbol;Acc:HGNC:16853][more]
back to top
BLAST of Transportin-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MTR101.808e-1129.83Nuclear import receptor; mediates the nuclear loca... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO320379.361e-8426.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transportin-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnpo31.736e-8827.12transportin 3 [Source:NCBI gene;Acc:101165123][more]
tnpo33.314e-4127.45transportin 3 [Source:NCBI gene;Acc:101165123][more]
ipo131.371e-1028.93importin 13 [Source:NCBI gene;Acc:101155839][more]
si:ch73-182a11.24.963e-1023.18importin-13 [Source:NCBI gene;Acc:101174623][more]
ipo135.828e-1028.50importin 13 [Source:NCBI gene;Acc:101155839][more]
back to top
BLAST of Transportin-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000033219.10.000e+099.46SMESG000033219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034693 ID=SMED30034693|Name=Transportin-3|organism=Schmidtea mediterranea sexual|type=transcript|length=3071bp
TAAATTTGTTTTAATATTCATTTGGCGTCAGAATTTAAATTTGTTATGAT
GACTCTCCCTACTGTGGAAGCGACATTAGAATCTATAGACATTTTGCACC
ATGTAAAATCTGGAAATGTAAATGATGCATCAAATTTTCTCACAGAATTA
CAACAATCGAATTACGCATGGAGTATAGCAGATCAATTATTATACATGAA
TAAAGATTTAGTGACTTCATATTTTGGTGCACAAACAATGAGAAATAAGA
TTCAATTACATTTTGACGAATTACCTTTCGAATCACATGTGTCATTAAAG
GAATCATTAATGAAGCATTTAAATAATGTTAACTCTAGTACTAACCCCAC
AGTTTTAACTCAACTTTCATTAGCATTAGCCGATTTATTTTGTCATATGG
TTCAATGGAAAAATGGATTAGATGAGATAATAACGACGTATTCACAGAAA
GCAGAAACTATTCCCATTTTGTTGGACGTGCTTAAGTTCATACCAGAAGA
GTTCTCAAATCGGTCTTTGAGATTGGGAGTCAATAGAAAGACGGAAATAT
TTGGTGAATTAGACGGGAAAAGTCTTTCAGTTGTTGAAGTGCTGGAGCAA
TCATTATCATTAAATAACGATATTGTTCTAATCAAATGTTTTGAATGCCT
AAATAGTTGGTTCCTAATCAACCTTTTCCACGACAAAGATTTGCTGAACT
GTAGAGTCATTTCATGCATTTACGATATTTTAAAATCCCCAAACATTGCC
AGTGAATCCCTGTTTAAGGCAGCCGTACAGTGCGCCACAGATTTCTTCTG
CAACGACATTCACACGATTCCTCAACTAGTTCAACAATTCCAAATCAACA
CTTATCAATTAGAAGCCGCATATCAAATCTGTGCGTATTCTCACGCCGAT
TACTGCCTTGATTACGCGAAAATATTTTGTGAAATGGCGTCGGCCTTGCT
ACCAATTGTTCTTGAATGTCCAAGGTTCGATAACAGCGCAAGTCCTGGCG
ATTACCGCACGTTGCAAATGTTACTGTTGACCGCCGGCACAAATCGTGAG
TGTTGCGCGTTGGTTTTAGATATTTTAATCGACGTCACGGACAGTCGGAA
TTTTAGATTGGATGAAACCAGATCCCAGCTTGCACCGATATTTGAGCAGC
TGATAACCATCATGACCTGCCACTGTGCGGTGACAGAAAGCGAGGACGAA
CCGAATCTGTGCGCTTTCCGGTCCGATGTGTTCTTTGTCATGGAACAGAT
CAGGATGTTTGTTGACATCGAGGTCGTTTTCAGGAAGATGCTCGGTGACC
TTTCTCAGCTGCTGGTGTCCTCCCCTCAAATGCAGCCGTCCAATTACAAC
AAGGCCGAAGCTGTGCTATGTATGATTGGCAGTCTGGTGAAATTCGTCGA
CACGAATCAATCAGAGAACGCGGCTTGGACCGAGCAGCTTCTAACGCAAG
TCATCCTTCCATGTCTAGGCCAAGCCCAGCCGAGCTTCAAGGATGTCGCA
TTCACAATGTTTGGCGAGTTGTGCCGGTGGGCGTCTGAGCGCGAGCCGAT
TATGGATTGTATGATTCAAGAGATGGCCAAATTCTTGTTGGAATCCAAAT
TCGACAGCTCGATTGACGAATTGCAAATGAGCGCATTCAACTCGGCATTG
CAATCTCTGGCAGTGTTCTGCAAGAGGCAAAACGCCCAAATCCTCAAACC
CGATAGGTGGGCATTGATAATCCGACTGTGCCATCGATTCACCGAGCTGA
CATTCCCAAACAAGCTACTGGTGAATTTCTATGAAGCGCTTGGCCGTTGC
CTGTGCATCCCGCACTCGATTGAAGGGCTGGTTGAGCTCGGCCAGAATCC
GGAAACATTAGCCCGACGGGTTTGGGAATTGTGCCAGATCAATGTGGACA
CCGTGAACCGGCTCGTGAAGAACCAATCGATATCGAGAGTGCCCCGCGAC
CCGTGTGACCCTTGTGTATGGATCGATAACATATCAGCAATATTCCTGTC
AATGCCCCGCATGGTCACCGGAAAGAATGGGCGGCCATTTATCGGCTCTG
ACCAATCAGATCAAAATGAAGCTGCCATTCAGGCCGCCACACAGCCGTAT
TTAACGGCCTATTATCAAGTCATGGAGTACCTGTGGCCGGTATTGGCCGA
CTTGATCGATTGCTTCATTAGTGATGGCAGGGTGCTCGAGCGCGTTGTTC
GCATACTCAGGTACAGCTTGCGCTGCTTTCAGACGCTTACCAAGCCGCTG
CTAGAGGATATCGCTCAGAAAATCGTTGCCGCTTATGCTCACAGCAAGGA
ATCGTGTTTCCTCTATGTCGGGGGGATTTTGGTCGATGAATTCGGTGATG
ACGACGCCTGCAAGCTGGGACTCATCCAGATGTTCTATGCGTTCTCGGTT
CCTGCATTCAGCGTCCTGCAGGGCGAGGGCCTGCACGAGAATCCCAACAC
GACAGAAGACTTATTCCGACTGATGGTGAGACTCGTTCAACGCTGCTCTC
CCGACTTCCTGTCCTGGGGGTCGTTGGACGTCAACCGGCTGTTTGATATG
GCCGTTCGTTCCATTCCCGGTACCAATATCGATGCCAAAACGTTGGCGTT
GCGATTCCTGGTCGAATCGTTCAATTGCGCCAATCAAAATGATGATGCCC
ACATTCCAGTTAGGGTGCGCACAGTCGGTTGGCTACAGGCGGAAGGCTTA
ACTCACTTGTGGCGAGCTTTGATTTATTTGTGCCGATGGAAATCAGATGA
GGTAACTGGCGGGGATCTCGTTGAGGACATGACGGATTTATTGATCGGTG
TCAGATCATTGACATCGATTGATGAGTTCCTGTTCGGTCTCGATTCTGCA
CTTGACAATATCGGGATGACCCGCCGAGATGGAATGGTCTATGCTACACA
ATCACAAATACAAAAGCTCCGATCTTCAATGCTCCAGGACTCACAAGTGC
TTGAAGGTCTTGAGACGTTTGCCAAGCTTTTCTCTTGATTTATGATGAGG
TTCTGAATGATTATTATCAAATTTTAATGTTTTTTGTAATATACGATTTA
TTCGTTTGTTTCTTTAAAAAA
back to top

protein sequence of SMED30034693-orf-1

>SMED30034693-orf-1 ID=SMED30034693-orf-1|Name=SMED30034693-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=981bp
MMTLPTVEATLESIDILHHVKSGNVNDASNFLTELQQSNYAWSIADQLLY
MNKDLVTSYFGAQTMRNKIQLHFDELPFESHVSLKESLMKHLNNVNSSTN
PTVLTQLSLALADLFCHMVQWKNGLDEIITTYSQKAETIPILLDVLKFIP
EEFSNRSLRLGVNRKTEIFGELDGKSLSVVEVLEQSLSLNNDIVLIKCFE
CLNSWFLINLFHDKDLLNCRVISCIYDILKSPNIASESLFKAAVQCATDF
FCNDIHTIPQLVQQFQINTYQLEAAYQICAYSHADYCLDYAKIFCEMASA
LLPIVLECPRFDNSASPGDYRTLQMLLLTAGTNRECCALVLDILIDVTDS
RNFRLDETRSQLAPIFEQLITIMTCHCAVTESEDEPNLCAFRSDVFFVME
QIRMFVDIEVVFRKMLGDLSQLLVSSPQMQPSNYNKAEAVLCMIGSLVKF
VDTNQSENAAWTEQLLTQVILPCLGQAQPSFKDVAFTMFGELCRWASERE
PIMDCMIQEMAKFLLESKFDSSIDELQMSAFNSALQSLAVFCKRQNAQIL
KPDRWALIIRLCHRFTELTFPNKLLVNFYEALGRCLCIPHSIEGLVELGQ
NPETLARRVWELCQINVDTVNRLVKNQSISRVPRDPCDPCVWIDNISAIF
LSMPRMVTGKNGRPFIGSDQSDQNEAAIQAATQPYLTAYYQVMEYLWPVL
ADLIDCFISDGRVLERVVRILRYSLRCFQTLTKPLLEDIAQKIVAAYAHS
KESCFLYVGGILVDEFGDDDACKLGLIQMFYAFSVPAFSVLQGEGLHENP
NTTEDLFRLMVRLVQRCSPDFLSWGSLDVNRLFDMAVRSIPGTNIDAKTL
ALRFLVESFNCANQNDDAHIPVRVRTVGWLQAEGLTHLWRALIYLCRWKS
DEVTGGDLVEDMTDLLIGVRSLTSIDEFLFGLDSALDNIGMTRRDGMVYA
TQSQIQKLRSSMLQDSQVLEGLETFAKLFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001494Importin-beta_N
IPR013598Exportin-1/Importin-b-like
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0008536Ran GTPase binding
GO:0005488binding
GO:0008139nuclear localization sequence binding
GO:0008565protein transporter activity
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0006606protein import into nucleus
GO:0006810transport
GO:0015031protein transport
GO:0035048splicing factor protein import into nucleus
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0031965nuclear membrane
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013598Exportin-1/Importin-beta-likePFAMPF08389Xpo1coord: 51..196
e-value: 6.7E-16
score: 58.7
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1..930
e-value: 2.3E-132
score: 444.9
NoneNo IPR availablePANTHERPTHR12363TRANSPORTIN 3 AND IMPORTIN 13coord: 7..924
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 4..813