Mitogen-activated protein kinase kinase kinase

Overview
NameMitogen-activated protein kinase kinase kinase
Smed IDSMED30034690
Length (bp)2084
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitogen-activated protein kinase kinase kinase (SMED30034690) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase (SMED30034690) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitogen-activated protein kinase kinase kinase (SMED30034690) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitogen-activated protein kinase kinase kinase (SMED30034690) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034690

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30034690h1SMcG0019463 dd_Smed_v4_8364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034690h1SMcG0019463 dd_Smed_v4_8364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034690h1SMcG0019463 dd_Smed_v4_8364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034690h1SMcG0019463 dd_Smed_v4_8364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 89.7373 bits (221), Expect = 3.050e-18
Identity = 62/189 (32.80%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  176 EKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 360          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Match: PAK2 (p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;Acc:HGNC:8591])

HSP 1 Score: 85.1149 bits (209), Expect = 5.465e-18
Identity = 49/141 (34.75%), Postives = 75/141 (53.19%), Query Frame = 3
Query: 1347 LRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            L+   I+ + + Y + +   + M+YL GGSL   + E    EA+IA + R  L  +  +H  + IH DIK  NV+L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:   44 LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 180          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 89.3521 bits (220), Expect = 6.237e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  271 EKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 455          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 88.9669 bits (219), Expect = 6.397e-18
Identity = 62/189 (32.80%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  274 EKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 458          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 89.3521 bits (220), Expect = 6.599e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  272 EKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 456          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 89.3521 bits (220), Expect = 1.797e-19
Identity = 60/194 (30.93%), Postives = 98/194 (50.52%), Query Frame = 3
Query: 1215 IKELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSID-NRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            +K+ +G GASG V++     +       ++A K     E L  EI    +  R   ++ Y E Y +D +   + M YL+GG+L   + K    E +IA + +  L  +  +H    +H DIK  NV+L  +   K+ D G  ++    SK+  +    +GT  +M+PEI+NK+  + KVDIWS G+M  EM+  
Sbjct:    1 MKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEI-KVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTV----VGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDG 189          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 91.6633 bits (226), Expect = 2.244e-19
Identity = 61/193 (31.61%), Postives = 99/193 (51.30%), Query Frame = 3
Query: 1212 EIKELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSID-NRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E+K+ +G GASG V++     +       ++A K     E L  EI    +  R   ++ Y E Y +D +   + M YL+GG+L   + K    E +IA + +  L  +  +H    +H DIK  NV+L  +   K+ D G  ++    SK+  +    +GT  +M+PEI+NK+  + KVDIWS G+M  EM+
Sbjct:  157 EMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEI-KVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTV----VGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMI 344          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 90.5077 bits (223), Expect = 8.932e-19
Identity = 61/190 (32.11%), Postives = 99/190 (52.11%), Query Frame = 3
Query: 1227 LGCGASGEVYLCETLNTK--LALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLAS-----HLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +G GASG VY    ++T+  +A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL        +E G     IA + R +L  +  +H R  IH DIK  N++L      K+ DFG  ++ + + +K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  252 IGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGI----IAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTM---VGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMV 434          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 90.1225 bits (222), Expect = 1.272e-18
Identity = 61/190 (32.11%), Postives = 99/190 (52.11%), Query Frame = 3
Query: 1227 LGCGASGEVYLCETLNTK--LALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLAS-----HLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +G GASG VY    ++T+  +A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL        +E G     IA + R +L  +  +H R  IH DIK  N++L      K+ DFG  ++ + + +K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  301 IGSGASGSVYTAIEISTEAEVAIKQMNLKDQPKKELIINEILVMRENKHANIVNYLDSYLVCDELWVVMEYLAGGSLTDVVTECQMEDGI----IAAVCREVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRKRTTM---VGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMV 483          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 90.5077 bits (223), Expect = 1.321e-18
Identity = 61/193 (31.61%), Postives = 99/193 (51.30%), Query Frame = 3
Query: 1212 EIKELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSID-NRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E+K+ +G GASG V++     +       ++A K     E L  EI    +  R   ++ Y E Y +D +   + M YL+GG+L   + K    E +IA + +  L  +  +H    +H DIK  NV+L  +   K+ D G  ++    SK+  +    +GT  +M+PEI+NK+  + KVDIWS G+M  EM+
Sbjct:  332 EMKKQIGVGASGTVFVANVAGSTDVVAVKRMAFKTQPKKEMLLTEI-KVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTV----VGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMI 519          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-18
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLC--ETLNTKLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY     +   ++A+K    ++   +E I N   ++R  K   ++ Y + Y +     + M+YL GGSL   + E    E +IA + R +L  +  +H  + IH DIK  N++L      K+ DFG  ++ + +  K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTM---VGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 618          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-18
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLC--ETLNTKLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY     +   ++A+K    ++   +E I N   ++R  K   ++ Y + Y +     + M+YL GGSL   + E    E +IA + R +L  +  +H  + IH DIK  N++L      K+ DFG  ++ + +  K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTM---VGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 618          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-18
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLC--ETLNTKLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY     +   ++A+K    ++   +E I N   ++R  K   ++ Y + Y +     + M+YL GGSL   + E    E +IA + R +L  +  +H  + IH DIK  N++L      K+ DFG  ++ + +  K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTM---VGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 618          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-18
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLC--ETLNTKLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY     +   ++A+K    ++   +E I N   ++R  K   ++ Y + Y +     + M+YL GGSL   + E    E +IA + R +L  +  +H  + IH DIK  N++L      K+ DFG  ++ + +  K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTM---VGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 618          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334544)

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-18
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLC--ETLNTKLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY     +   ++A+K    ++   +E I N   ++R  K   ++ Y + Y +     + M+YL GGSL   + E    E +IA + R +L  +  +H  + IH DIK  N++L      K+ DFG  ++ + +  K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTM---VGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMV 618          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 84.7297 bits (208), Expect = 1.895e-18
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 3
Query: 1413 MKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEY--NSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            M+YL GGS    LE G   E +IA I R IL  +  +H  K IH DIK  NV+LSE    K+ DFGV+    +++ K+       +GT  +MAPE+I +     K DIWS G+   E+ 
Sbjct:    1 MEYLGGGSALDLLEPGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTF----VGTPFWMAPEVIKQSAYDSKADIWSLGITAIELA 115          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 85.5001 bits (210), Expect = 4.493e-18
Identity = 50/129 (38.76%), Postives = 69/129 (53.49%), Query Frame = 3
Query: 1383 YSIDNRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEY--NSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            Y  D +  + M+YL GGS    LE G   E +IA I R IL  +  +H  K IH DIK  NV+LSE    K+ DFGV+    +++ K+       +GT  +MAPE+I +     K DIWS G+   E+ 
Sbjct:   89 YLKDTKLWIIMEYLGGGSALDLLEPGSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQIKRNTF----VGTPFWMAPEVIKQSAYDSKADIWSLGITAIELA 213          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 88.1965 bits (217), Expect = 8.182e-18
Identity = 61/214 (28.50%), Postives = 102/214 (47.66%), Query Frame = 3
Query: 1203 ENIEIKELLGCGASG--EVYLCETLNTKLALKM------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSL----------ASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHK-----IGTELYMAPEIINK-ENCSCKVDIWSFGVMLTEMVSSNG 1772
            E  E++E++G GA+   +  LC     ++A+K         S ++L +EI    Q      ++ Y   + + +   + MK L GGS+            H      E+ IA I + +L  +  +H+   IH D+K GN++L E    +I DFGVS + S    G + +HK     +GT  +MAPE++ +      K DIWSFG+   E+ + + 
Sbjct:   67 EAYELQEVIGSGATAVVQAALCSPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSH-PNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTFNKGEHRNGVLDESTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLSTG--GDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSA 277          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 87.8113 bits (216), Expect = 1.263e-17
Identity = 63/189 (33.33%), Postives = 98/189 (51.85%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    EA+IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  308 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 492          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 87.8113 bits (216), Expect = 1.263e-17
Identity = 63/189 (33.33%), Postives = 98/189 (51.85%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    EA+IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  308 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHCNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 492          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 91.6633 bits (226), Expect = 6.071e-19
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-----SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY+   + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y +     + M+YL GGSL   + E    E EIA + R  L  +  +H  + IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  169 EKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTM-------VGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMV 353          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 90.8929 bits (224), Expect = 1.493e-18
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-----SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY+   + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y +     + M+YL GGSL   + E    E EIA + R  L  +  +H  + IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  250 EKIGQGASGTVYIAVDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKHPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQEGEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPEQNKRSTM-------VGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMV 434          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 90.1225 bits (222), Expect = 2.862e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  225 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 409          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 88.9669 bits (219), Expect = 6.418e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  277 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 461          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Match: flii (FLII actin remodeling protein [Source:Xenbase;Acc:XB-GENE-478681])

HSP 1 Score: 88.9669 bits (219), Expect = 7.758e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  292 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 476          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 89.3521 bits (220), Expect = 4.530e-18
Identity = 62/189 (32.80%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  273 EKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 457          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 89.3521 bits (220), Expect = 4.530e-18
Identity = 62/189 (32.80%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EM+
Sbjct:  273 EKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMI 457          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 89.3521 bits (220), Expect = 4.693e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  272 EKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 456          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 89.3521 bits (220), Expect = 4.693e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  272 EKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 456          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 89.3521 bits (220), Expect = 4.693e-18
Identity = 63/189 (33.33%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  272 EKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 456          
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q869N2|PAKB_DICDI (Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum OX=44689 GN=pakB PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.282e-20
Identity = 66/189 (34.92%), Postives = 104/189 (55.03%), Query Frame = 3
Query: 1227 LGCGASGEVYLCETL--NTKLALK-MPKSTEDLYREIYNCCQLLRCK--KILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFS----EAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            +G GA+GEV++   L  N K+A+K MP + +++   +     +  C+   I+ Y + Y + +   +AM+++ GG L   LE+  S    EA+IA +    L  +A IH +  IH DIK  N++L      K+ DFG +   +KSK+  +    +GT  +MAPE+I  +N   KVDIWS G+M  EM  S
Sbjct:  576 IGEGAAGEVFVVTQLKTNNKVAIKKMPLNQQNMKLIVTEIGIMKSCRHQNIIDYIDSYLVGDSLWVAMEFMGGGCLTEILEQFNSVKLVEAQIAYVCAETLKGLAYIHSQHRIHRDIKSDNILLGSDGSVKLADFGYAAQLTKSKQKRVTI--VGTPYWMAPELIRGQNYDRKVDIWSLGIMAMEMAES 762          
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q10056|SHK2_SCHPO (Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.564e-18
Identity = 67/200 (33.50%), Postives = 102/200 (51.00%), Query Frame = 3
Query: 1203 ENIEIKELLGCGASGEVYLCETLNTK-------LALKMPKSTEDLYRE-IYNCCQLLR---CKKILGYKELYSIDNRPC-MAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E   +K  LG GASG VYL + +  K       +A+K         +E I N   ++R      I+ Y + + +  R   + M+Y+  GSL   +EK   +EA+IA+I       I  +H R  IH DIK  NV+L  S   KI DFG  +  ++++ K   +   +GT  +MAPE++ +     KVDIWS G+M+ EM+
Sbjct:  307 EYFNVKHKLGQGASGSVYLAKVVGGKQLGIFDSVAIKSIDLQCQTRKELILNEITVMRESIHPNIVTYLDSFLVRERHLWVVMEYMNAGSLTDIIEKSKLTEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKITDFGFCARLSNRTNKRVTM---VGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMI 503          
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|Q5APR8|CLA4_CANAL (Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CLA4 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.223e-18
Identity = 66/195 (33.85%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 1215 IKELLGCGASGEVYLCETL---NTKLALKMPKSTEDLYRE-IYNCCQLLR---CKKILGYKELYSI-DNRPCMAMKYLKGGSLASHLEKG---FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            I E  G GASG VYL E +   N K+A+K         +E I N   +++    K I+ + + Y I DN   + M+Y++GGSL   +E      +E +IA I    L  +  +H++  IH DIK  NV+L      KI DFG      + ++K+  +    +GT  +MAPE++ ++    KVD+WS G+M  EM+
Sbjct:  687 IVEKAGQGASGNVYLAEMIKDNNRKIAIKQMDLDAQPRKELIINEILVMKDSQHKNIVNFLDSYLIGDNELWVIMEYMQGGSLTEIIENNDFKLNEKQIATICFETLKGLQHLHKKHIIHRDIKSDNVLLDAYGNVKITDFGFCAKLTDQRNKRATM----VGTPYWMAPEVVKQKEYDEKVDVWSLGIMTIEMI 877          
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|O14427|CLA4_CANAX (Serine/threonine-protein kinase CLA4 OS=Candida albicans OX=5476 GN=CLA4 PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.500e-18
Identity = 66/195 (33.85%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 1215 IKELLGCGASGEVYLCETL---NTKLALKMPKSTEDLYRE-IYNCCQLLR---CKKILGYKELYSI-DNRPCMAMKYLKGGSLASHLEKG---FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            I E  G GASG VYL E +   N K+A+K         +E I N   +++    K I+ + + Y I DN   + M+Y++GGSL   +E      +E +IA I    L  +  +H++  IH DIK  NV+L      KI DFG      + ++K+  +    +GT  +MAPE++ ++    KVD+WS G+M  EM+
Sbjct:  682 IVEKAGQGASGNVYLAEMIKDNNRKIAIKQMDLDAQPRKELIINEILVMKDSQHKNIVNFLDSYLIGDNELWVIMEYMQGGSLTEIIENNDFKLNEKQIATICFETLKGLQHLHKKHIIHRDIKSDNVLLDAYGNVKITDFGFCAKLTDQRNKRATM----VGTPYWMAPEVVKQKEYDEKVDVWSLGIMTIEMI 872          
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Match: sp|P50527|STE20_SCHPO (Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk1 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 4.610e-18
Identity = 59/186 (31.72%), Postives = 98/186 (52.69%), Query Frame = 3
Query: 1227 LGCGASGEVYLCETLNTKLAL---KMPKSTEDLYREIYNCCQLLRC---KKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +G GASG+VY    + T L++   KM  + +     I N   +++    K I+ + + +   +   M M+Y++GGSL   +     SE +IA I +  L  +  +HE   +H DIK  N++LS     K+ DFG  ++ +S   K   +   +GT  +MAPE++ ++    KVD+WS G+M  EMV
Sbjct:  392 IGQGASGDVYSARQVGTNLSVAIKKMNINQQPKKEFIVNEILVMKSHHHKNIVNFIDTFFYKSELWMVMEYMRGGSLTEVVTNNTLSEGQIAAICKETLEGLQHLHENGIVHRDIKSDNILLSLQGDIKLTDFGFCAQIDSNMTKRTTM---VGTPYWMAPEVVTRKEYGFKVDVWSLGIMAIEMV 574          
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Match: M2XS31 (Serine/threonine protein kinase isoform 1 OS=Galdieria sulphuraria OX=130081 GN=Gasu_58740 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.775e-20
Identity = 73/197 (37.06%), Postives = 108/197 (54.82%), Query Frame = 3
Query: 1203 ENIEIKELLGCGASGEVYLCETLNTK--LALKM------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLE---KGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            EN++++E +G G+ GEVY    L TK  LA+K+          E++ RE     QL R   I+ Y      +    + M+YL+GGSL   L+   + F E+ IA+  +NIL  +  +H  K IH DIK  NV+LS+S  AK++DFGVS+  SK+ +       +GT  +MAPE+I       K DIWS G+ + E+ 
Sbjct:    8 ENLQLQECIGSGSFGEVYKALNLRTKQLLAVKVIDLEDAEGDLEEVRRETRILAQL-RNPYIVTYYSSLVFETTLWIIMEYLEGGSLRDLLDCRRQPFKESIIARFIQNILQGLKYLHMEKRIHRDIKAANVLLSKSGVAKLVDFGVSQQLSKTMQRR--NTFVGTPYWMAPEVIAASYYDEKADIWSLGITILELA 201          
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Match: A0A0B6ZP70 (Protein kinase domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF73225 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.403e-19
Identity = 65/192 (33.85%), Postives = 108/192 (56.25%), Query Frame = 3
Query: 1212 EIKELLGCGASGEVYLCETLNTK--LALKM----PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK-GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            ++K++LG GASG V+L +  N+   +A+KM     +  +DL  +     +L + + I+ + +LY + N   + M+YL GGSL   + +    E +IA +SR  L  +  +H +  IH DIK  NV++S     K+ DFG      + +S +  +L    GT  +MAPE+++ +  S KVDIWS G+M+ EM+
Sbjct:  135 DVKQILGAGASGTVHLAKCRNSGQLVAIKMMDLNQQPRKDLIIQEIQIMKLSKHENIVNFLDLYCVRNELWVVMEYLDGGSLTDVVARFVLEERQIATVSRECLKGLDFLHRKCIIHRDIKSDNVLVSLKGVVKLTDFGFCAQLSSDRSTRNSVL----GTPCWMAPELVSNQQYSYKVDIWSLGIMVIEML 322          
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Match: A7S4G7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g104385 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.535e-19
Identity = 66/202 (32.67%), Postives = 108/202 (53.47%), Query Frame = 3
Query: 1206 NIEIKELLGCGASGEVYLCETLNT--KLALK------MPKSTEDLYREIYNCCQLL---RCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSE--YNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            N    +LLG GA G+VY+C  L+T  +LA+K      +  ST++  + +    + +   R ++I+ Y  + + D    + M+YL GGS+  H+++    +E+   K SR IL  I  +H  + +H DIK  N++       K+ DFG S+     +SK G+   H  GT  +MAPE+IN E    K D+WS G  + EM+++
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH--GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTT 202          
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Match: Q6Y2W8 (GCK-like kinase MIK OS=Zea mays OX=4577 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.498e-19
Identity = 71/194 (36.60%), Postives = 105/194 (54.12%), Query Frame = 3
Query: 1218 KELLGCGASGEVY--LCETLNTKLALKM------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKG--FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHK--IGTELYMAPEII-NKENCSCKVDIWSFGVMLTEMV 1760
            ++L+GCG+ G+VY    + LN ++A+K+          ED+ +EI    Q  RC  I  Y   Y    +  + M+Y+ GGS+A  L+ G    E  IA I R++L  I  +H    IH DIK  N++L+ES   K+ DFGVS   +K+    + + K  +GT  +MAPE+I N E  + K DIWS G+   EM 
Sbjct:   18 RDLIGCGSFGDVYKGFDKELNKEVAIKVIDLEEAEDDIEDIQKEISVLSQC-RCPYITDYYGSYLHQTKLWIVMEYMAGGSVADLLQAGPPLDEMSIACILRDLLHAIEYLHSEGKIHRDIKAANILLTESGDVKVADFGVSAQLTKT----MSRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITAIEMA 206          
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Match: A0A109FDB8 (Pkinase-domain-containing protein (Fragment) OS=Rhodotorula sp. JG-1b OX=1305733 GN=RHOSPDRAFT_21350 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 7.059e-19
Identity = 64/188 (34.04%), Postives = 98/188 (52.13%), Query Frame = 3
Query: 1227 LGCGASGEVYLCETLNTKLAL--------KMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKG-FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +G GASG VY    + T L++        + PK  +DL        +  R   I+ Y + + +     + M+Y++GGSL   +     SE +IA +SR +L  +  +HE   IH DIK  NV+LS S   K+ DFG  ++  S + K   +   +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:   45 IGQGASGGVYTAYQVGTNLSVAIKQMNLEQQPK--QDLIINEILVMKESRHPNIVNYIDSFLVRGDLWVCMEYMEGGSLTDVVTANIMSEGQIAAVSREVLQGLKHLHEHGVIHRDIKSDNVLLSMSGDIKLTDFGFCAQIKSDNAKRTTM---VGTPYWMAPEVVTRKEYGSKVDIWSLGIMAIEMV 227          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 89.7373 bits (221), Expect = 1.994e-18
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG-----VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  280 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTM-------VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 464          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 89.7373 bits (221), Expect = 2.204e-18
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG-----VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  301 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTM-------VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 485          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 89.7373 bits (221), Expect = 2.204e-18
Identity = 64/192 (33.33%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG-----VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    E +IA + R  L  +  +H  + IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  301 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQNKRSTM-------VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 485          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 85.5001 bits (210), Expect = 5.590e-18
Identity = 63/199 (31.66%), Postives = 94/199 (47.24%), Query Frame = 3
Query: 1221 ELLGCGASGEVY--------LCETLNTKLALKMPKSTEDLYREIYNCCQLLR---CKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG-VSEYNSKSKKGY---LLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            E+LG GA G VY        L       L +   ++ E  Y  +     LL+      I+G+      DN   + M+Y+ GGS++S L +     E   A  +R +L  +A +HE + IH D+K  N++L  +   K+IDFG     N  +  G    LLK   GT  +MAPE+IN+     K D+WS G  + EM + 
Sbjct:   20 EVLGRGAYGTVYCGLTSQGQLIAVKQVLLDVSTSETAEKEYSRLEREVDLLKNLEHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATG 218          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Match: stk39 (serine/threonine kinase 39 [Source:NCBI gene;Acc:103028154])

HSP 1 Score: 87.4261 bits (215), Expect = 1.102e-17
Identity = 61/214 (28.50%), Postives = 101/214 (47.20%), Query Frame = 3
Query: 1203 ENIEIKELLGCGASG--EVYLCETLNTKLALKM------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSL----------ASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHK-----IGTELYMAPEIINK-ENCSCKVDIWSFGVMLTEMVSSNG 1772
            E  E++E++G GA+   +  LC     ++A+K         S E+L +EI    Q      ++ Y   + + +   + MK L GGS+            H      E  IA I + +L  +  +H+   IH D+K GN++L E    +I DFGVS + +    G + +HK     +GT  +MAPE++ +      K DIWSFG+   E+ + + 
Sbjct:   27 EAYELQEVIGSGATAVVQAALCTPRQERVAVKRINLEKCQTSMEELLKEIQAMSQC-NHPNVVTYYTSFVVKDELWLVMKLLSGGSVLDIIKHTCSRGEHKNGVLDEPTIASILKEVLEGLDYLHKNGQIHRDVKAGNILLGEDGSVQIADFGVSAFLATG--GDVTRHKVRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAIELATGSA 237          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 2.114e-17
Identity = 72/212 (33.96%), Postives = 103/212 (48.58%), Query Frame = 3
Query: 1212 EIKEL--LGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKG--FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVS-EYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSSNGLKLLINYRLFTRNLLRSGAG 1832
            EI EL  LG GA G V+L +     +A+K  K  E    +I +  +L R   I+ +K + +     C+ M+Y   G L   L  G   S   +   +R I   ++ +H  K IH D+K  NV+++     KI DFG S E   KS +        GT  +MAPE+I  E  S KVDIWSFGV+L E+++       I YR    + +  G G
Sbjct:   13 EISELQWLGSGAQGAVFLGKFRGEHVAVK--KVREQKETDIKHLHKL-RHPNIITFKGVCTHAPCYCIIMEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSF----AGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGE-----IPYRDVDSSAIIWGVG 212          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001278.1 (pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-1 gene:ENSPMAG00000001147.1 transcript:ENSPMAT00000001278.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.305e-17
Identity = 49/153 (32.03%), Postives = 81/153 (52.94%), Query Frame = 3
Query: 1305 TEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL--EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAK----IIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVM 1745
             ED+ RE+ +  + LR   I+   E+Y  D    + ++ + GG L   L  ++  SE E  +  + IL  ++ +H R+  HFD+K  N++L E++  K    IIDFG+++       G   +H  GT  ++ PEI+N E    + D+WS GVM
Sbjct:   40 PEDIKREV-SILRELRHPNIISLHEVYENDTDVTLILELVSGGELFDFLAHKESLSEDEATEFLKQILDGVSYLHCRRIAHFDLKPENIMLLENRAPKAHVKIIDFGLAQ---SIVDGVEFRHIFGTPEFVVPEIVNYEPLGVQADMWSIGVM 188          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 82.4185 bits (202), Expect = 1.337e-16
Identity = 62/203 (30.54%), Postives = 102/203 (50.25%), Query Frame = 3
Query: 1206 NIEIKELLGCGASGEVYLCETLNT--KLALKM----PKSTEDLYREIYNC-CQL-----LRCKKILGYKELYSIDNRPCMA--MKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEY-NSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS 1763
            N +  +LLG GA G VYLC   +T  +LA+K     P S E   +E+    C++     L+ ++I+ Y        +  ++  M+Y+ GGS+   L      +E    K +R IL  ++ +H    +H DIK  N++   +   K+ DFG S+   +   +G  ++   GT  +M+PE+IN E    K DIWS G  + EM++
Sbjct:  358 NWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVE-TSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLT 559          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 80.4925 bits (197), Expect = 3.411e-16
Identity = 74/291 (25.43%), Postives = 141/291 (48.45%), Query Frame = 3
Query:  969 FEYTLNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLL-----CINYGKSSI-----KPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYL-CETLNTKLALKMPKS---TEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISR--NILSQIAE----IHERKFIHFDIKCGNVVLSESKCAKIIDFGVS------EYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS 1763
            +  ++ + I+++    +HYK+ T  +    + ++ +      + V Y L     C   GK  I     KP + D +         +  E+I++++ LG G  G+V++      TK+A+KM K        + E  N  + L+  K++    + + D    +  +Y++ GSL   L+   SE    K  +  ++ +Q+AE    I ++ +IH D++  N++++ +   KI DFG++      EY ++    + +K       + APE IN  + S K D+WSFG++LTEMV+
Sbjct:  165 YSLSVRDHIVEVGDTVKHYKIRTLDKGGYFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQPQKPWEKDAWE--------IPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVT-DEPIFIVTEYMEKGSLLDFLKT--SEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAKFPIK-------WTAPEAINYGSFSIKSDVWSFGILLTEMVT 437          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 75.8702 bits (185), Expect = 2.892e-15
Identity = 58/193 (30.05%), Postives = 96/193 (49.74%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNTKLAL-------KMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL--EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVV-LSE-SKCAKIIDFGVSE-YNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS 1763
            ++LG G  G V  C+  ++ L L       K PK  E++  EI N    L    ++   + Y   +   + M+Y++GG L + +  + G SE +     R I   +  +H++  +H D+K  N++ LS      KIIDFG++  Y  + K    LK   GT  ++APE++N E  S   D+WS GV+   ++S
Sbjct:   31 DVLGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKNEI-NIMNQLNHVNLVQLFDAYESRSDITLIMEYVEGGELFNRIIDQSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRWGYQIKIIDFGLARRYKPREK----LKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLS 218          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 86.6557 bits (213), Expect = 2.647e-18
Identity = 66/204 (32.35%), Postives = 105/204 (51.47%), Query Frame = 3
Query: 1203 ENIEIKELLGCGASGEVYLCETLNTK--LALKM-------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCM--AMKYLKGGSLAS----HLEKG--FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS 1763
            + IE   +LG GA G V  C+  N     ALK+       P+  + ++RE+    +  + + I+ Y  +++ D    +  AM+Y+ G SL +     LE+G   SE  + KI+  +L  ++ +HE+K IH DIK  N++L+E+   K+ DFGVS     S    L     GT  YMAPE I  +  S   D+WS G+ + E+ +
Sbjct:  219 DRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFREL-QFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNS----LATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVAN 417          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 87.0409 bits (214), Expect = 2.817e-18
Identity = 70/248 (28.23%), Postives = 116/248 (46.77%), Query Frame = 3
Query: 1158 DLYNNNLCIEIMLSAENIEIK----------ELLGCGASGEVYLCE-------------------TLNTKLALKMPKSTEDLYRE-IYNCCQLL---RCKKILGYKELYSIDNRPCMA-MKYLKGGSLASHLE-----------KGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +L NN+   EI++  + + I           E  G GASG VYL +                    +  ++A+K  + +E   ++ I N   ++   R + I+ + E Y ID+      M+Y++GG L   L+              +E ++A I +     +  +H +K IH DIK  N++L+     KI DFG  V     +SK+  +    +GT  +MAPEI+N++    KVD+WS G+ML EM+
Sbjct:  333 ELKNNDDSNEIIMKMKTVAIDVNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATM----VGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMI 576          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 85.8853 bits (211), Expect = 5.093e-18
Identity = 66/196 (33.67%), Postives = 99/196 (50.51%), Query Frame = 3
Query: 1224 LLGCGASGEVYLCETLNTK--LALKM-------PKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCM--AMKYLKGGSLASH----LEKG--FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            +LG GA G V  C   N K   ALK        P+  + ++RE+    +  +   I+ Y  +++ +    +  AM+Y+ G SL +     L++G   SE  I KI+ ++L  ++ +HERK IH DIK  N++L+E    K+ DFGVS     S    L     GT  YMAPE I  +  S   D+WS G+ L E+ 
Sbjct:  219 ILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFREL-QFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNS----LAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVA 409          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 83.5741 bits (205), Expect = 3.861e-17
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 3
Query: 1284 ALKMPKSTEDLYREIYNCCQL-------LRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSE----YNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS 1763
            A+  PK+ ++++R++ +  Q        L  + I+ Y           + ++Y+ GGS++S L     F E+ I   +R IL  +A +H++  IH DIK  N+++    C KI DFG+S+     N K  K   L+   G+  +M+PE++ +   + K DIWS G ++ EM +
Sbjct:  483 AVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQ---GSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT 652          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 81.6481 bits (200), Expect = 1.878e-16
Identity = 63/217 (29.03%), Postives = 100/217 (46.08%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCET---------------------LNTKLALKMPKSTEDLYRE-IYNCCQLL---RCKKILGYKELY-SIDNRPCMAMKYLKGGSLASHLEKG---------FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E  G GASG VYL E                      +  K+A+K    ++   +E I N   ++   R K I+ + E Y   D+   + M++++GGSL   +E            +E +IA I R     +  +H++  IH DIK  NV+L      KI DFG      + +SK+  +    +GT  +MAPE++ +     K+D+WS G+M  EM+
Sbjct:  550 EKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATM----VGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEML 762          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 98.9821 bits (245), Expect = 5.078e-23
Identity = 66/202 (32.67%), Postives = 108/202 (53.47%), Query Frame = 3
Query: 1206 NIEIKELLGCGASGEVYLCETLNT--KLALK------MPKSTEDLYREIYNCCQLL---RCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSE--YNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            N    +LLG GA G+VY+C  L+T  +LA+K      +  ST++  + +    + +   R ++I+ Y  + + D    + M+YL GGS+  H+++    +E+   K SR IL  I  +H  + +H DIK  N++       K+ DFG S+     +SK G+   H  GT  +MAPE+IN E    K D+WS G  + EM+++
Sbjct:    3 NWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVH--GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTT 202          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 87.8113 bits (216), Expect = 1.339e-18
Identity = 64/193 (33.16%), Postives = 96/193 (49.74%), Query Frame = 3
Query: 1212 EIKEL--LGCGASGEVYLCETLNTKLALKMPKSTEDL---YREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKG--FSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGV-SEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            EI EL  LG GA G V+L    + ++A+K  +  +D    +    N   ++R K +     +Y      C+ M+Y   G L   L  G   +   +   +  I   +  +H  K IH D+K  N+++S +   KI DFG   E+N KS K        GT  +MAPE+I  E CS KVD+WSFGV+L E+++ 
Sbjct:   34 EIHELQWLGSGAQGAVFLGVYSDEQVAVKKVRHEKDTDIKHLRNLNHPNIIRFKGVCNQAPVY------CVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDILKISDFGTCKEFNEKSAKMTF----AGTVAWMAPEVIRNEPCSEKVDVWSFGVLLWELLTG 216          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 87.0409 bits (214), Expect = 1.530e-18
Identity = 56/183 (30.60%), Postives = 93/183 (50.82%), Query Frame = 3
Query: 1242 SGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL--EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLL------KHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            +GE    + ++ K AL+    ++++ RE     Q++R   I+   E+   +NR  +  +   GG L  ++   K   E E+ K  R I+S +  +H+   IH D+K  N++L E    +IIDFG+S   S +K G L       K + G+  Y APEI+  +    KVD+WS GV +  M++ 
Sbjct:   47 TGEKVAVKIIDKKQALEDRYVSKNMRREA-RILQMVRHPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLLDEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPAYAAPEILGHQLYGTKVDVWSIGVNMYAMLTG 228          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 87.4261 bits (215), Expect = 4.574e-18
Identity = 62/192 (32.29%), Postives = 95/192 (49.48%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG-----VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K    ++   +E I N   ++R  K   I+ Y + Y +     + M+YL GGSL   + E    E +IA + R  L  +  +H    IH DIK  N++L      K+ DFG       E N +S         +GT  +MAPE++ ++    +VD+WS G+M  EMV
Sbjct:  230 EKIGQGASGTVYTAIEVATGHEVAIKQMNLSQQPKKELIINEILVMRENKHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATITPEQNKRSTM-------VGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMV 414          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Match: EDO25735 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVM4])

HSP 1 Score: 81.2629 bits (199), Expect = 4.005e-17
Identity = 59/220 (26.82%), Postives = 95/220 (43.18%), Query Frame = 3
Query: 1185 EIMLSAENIEIKELLGCGASGEVYLC--ETLNTKLALKMPKSTED------LYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSSNGLKLLINYRLFTRNLLR 1820
            E +L     ++   LG G   EVYL    +L  K+A+K+  S +D        +E +    L     I  Y      D R  + M+++ GG LA H  + F       I + + S +A +H +  +H DIK  N++      A I DFGV++              +G+  Y +PE    +    + DI+S GV+L EM++ +      NY     N L+
Sbjct:    3 EQLLEIPGYQVHGRLGKGGMAEVYLATQASLQRKVAIKVLLSADDQAFSQRFLKEGHIVASLHHPSIITIYDIDQLADGRHYLTMEFVPGGDLAQHKGEVFDLPRALSIVQQVASGLAVVHGKGLVHRDIKPANILFRSDGTAVITDFGVAKEVELDHDLTQFGIAVGSPSYSSPEQAQCQALDARSDIYSLGVILLEMLTGSNPYRATNYTQTVMNHLQ 222          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 90.5077 bits (223), Expect = 1.084e-18
Identity = 61/190 (32.11%), Postives = 97/190 (51.05%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    ++T       ++ L+     E +  EI    + L+   I+ + + + + +   + M+YL GGSL   + E    EA+IA + R +L  +  +H  + IH DIK  NV+L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  206 EKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEIL-VMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 390          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 90.5077 bits (223), Expect = 1.343e-18
Identity = 61/190 (32.11%), Postives = 97/190 (51.05%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    ++T       ++ L+     E +  EI    + L+   I+ + + + + +   + M+YL GGSL   + E    EA+IA + R +L  +  +H  + IH DIK  NV+L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  243 EKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEIL-VMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 427          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 90.5077 bits (223), Expect = 1.343e-18
Identity = 61/190 (32.11%), Postives = 97/190 (51.05%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    ++T       ++ L+     E +  EI    + L+   I+ + + + + +   + M+YL GGSL   + E    EA+IA + R +L  +  +H  + IH DIK  NV+L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  243 EKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEIL-VMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 427          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Match: ENSORLT00000030173.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 90.5077 bits (223), Expect = 1.343e-18
Identity = 61/190 (32.11%), Postives = 97/190 (51.05%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT-------KLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    ++T       ++ L+     E +  EI    + L+   I+ + + + + +   + M+YL GGSL   + E    EA+IA + R +L  +  +H  + IH DIK  NV+L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  243 EKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEIL-VMKELKNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMV 427          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Match: pak1 (p21 (RAC1) activated kinase 1 [Source:NCBI gene;Acc:101164663])

HSP 1 Score: 90.1225 bits (222), Expect = 1.916e-18
Identity = 64/189 (33.86%), Postives = 98/189 (51.85%), Query Frame = 3
Query: 1221 ELLGCGASGEVYLCETLNT--KLALKMPKSTEDLYRE-IYNCCQLLRCKK---ILGYKELYSIDNRPCMAMKYLKGGSLASHL-EKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFG--VSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMV 1760
            E +G GASG VY    + T  ++A+K     +   +E I N   ++R  K   I+ Y + Y + +   + M+YL GGSL   + E    EA+IA + R  L  +  +H  + IH DIK  N++L      K+ DFG        +SK+  +    +GT  +MAPE++ ++    KVDIWS G+M  EMV
Sbjct:  292 EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTM----VGTPYWMAPEVVTRKAYCPKVDIWSLGIMAIEMV 476          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000070043.1 (SMESG000070043.1)

HSP 1 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 555/608 (91.28%), Postives = 565/608 (92.93%), Query Frame = 3
Query:   36 MKLKFHFDDILKEKTMEIDDLMPVKSMKLNYNKTAKMKLPIKSTYLIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTIHPXXXXXXXXXXXXXXSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINYNSNPKTSIKSILLNSPEFDRTVDVFTWFKTIVDF-------------------------------FKLGHLDQFEYTLNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            MKLKFHFDDILKE+TMEIDDLMPVKSMKLNYNKTAKMKLPIKSTY+IYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTI+PLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRIN NSNPKTSIKSILLNS EFDRT D+F WF+TI  F                               F+LG   +FEY LNET+IKLKSRGRHYKLETTSEV TVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELY IDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIH+RKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS+
Sbjct:    1 MKLKFHFDDILKEETMEIDDLMPVKSMKLNYNKTAKMKLPIKSTYMIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTINPLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINCNSNPKTSIKSILLNSNEFDRT-DIFKWFQTIYFFRLGSFGEFGYALNSPEYDQTDVFKWFKTSNVFRLGSFGEFEYALNETVIKLKSRGRHYKLETTSEVSTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYCIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHQRKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSN 607          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000070043.1 (SMESG000070043.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 541/577 (93.76%), Postives = 550/577 (95.32%), Query Frame = 3
Query:   81 MEIDDLMPVKSMKLNYNKTAKMKLPIKSTYLIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTIHPXXXXXXXXXXXXXXSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINYNSNPKTSIKSILLNSPEFDRTVDVFTWFKTIVDFFKLGHLDQF---------------EYTLNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            MEIDDLMPVKSMKLNYNKTAKMKLPIKSTY+IYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTI+PLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRIN NSNPKTSIKSILLNS EFDRT D+F WF+TI  FF+LG   +F               EY LNET+IKLKSRGRHYKLETTSEV TVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELY IDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIH+RKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS+
Sbjct:    1 MEIDDLMPVKSMKLNYNKTAKMKLPIKSTYMIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTINPLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINCNSNPKTSIKSILLNSNEFDRT-DIFKWFQTIY-FFRLGSFGEFGYALNSPELGSFGEFEYALNETVIKLKSRGRHYKLETTSEVSTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYCIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHQRKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSN 575          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000070043.1 (SMESG000070043.1)

HSP 1 Score: 1058.9 bits (2737), Expect = 0.000e+0
Identity = 541/593 (91.23%), Postives = 550/593 (92.75%), Query Frame = 3
Query:   81 MEIDDLMPVKSMKLNYNKTAKMKLPIKSTYLIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTIHPXXXXXXXXXXXXXXSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINYNSNPKTSIKSILLNSPEFDRTVDVFTWFKTIVDF-------------------------------FKLGHLDQFEYTLNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            MEIDDLMPVKSMKLNYNKTAKMKLPIKSTY+IYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTI+PLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRIN NSNPKTSIKSILLNS EFDRT D+F WF+TI  F                               F+LG   +FEY LNET+IKLKSRGRHYKLETTSEV TVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELY IDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIH+RKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVS+
Sbjct:    1 MEIDDLMPVKSMKLNYNKTAKMKLPIKSTYMIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVRCEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTINPLLDNLPTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINCNSNPKTSIKSILLNSNEFDRT-DIFKWFQTIYFFRLGSFGEFGYALNSPEYDQTDVFKWFKTSNVFRLGSFGEFEYALNETVIKLKSRGRHYKLETTSEVSTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYCIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHQRKFIHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSN 592          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000003013.1 (SMESG000003013.1)

HSP 1 Score: 228.794 bits (582), Expect = 2.604e-65
Identity = 188/612 (30.72%), Postives = 304/612 (49.67%), Query Frame = 3
Query:  114 MKLNYNKTAKMKLPIKSTYLIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWN----KLIVRCEDSPNDSFTQCSDCHDKY-LWEYLKPG-FYPIFL-------PRNI----QDESTIHPXXXXXXXXXXXXXXSGIPIGLVNCHLLFCKVISDWI-------VDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRINYNSNPKTSIKSILLNSPEF------DRTVDVFTWFKTIVDFFKLG---HLDQFEYTLNE-TIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNN--NLCIEIMLSAENIEIKELLGCGASGEVYLCETLNTKLALKMPK---STEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLE--KGFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSEY----NSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSSNGLKLLINYRLFTRNL 1814
            + +N  K   ++ P    +LIY +IILND + +++YKI PN +I+  KL NY++ D + +EIF+    P+ +HLI+   DTI  ++  L NI+ +I ++WN+ GQ ++ NQ + D   N    KLI+ C D  +  F +    HD++ L+ Y +   FY  ++        R+I     D+  +  L D      L+ +    P+G +N   L C+ +S++I       +  +      D   G R      I C I   ++ R    +    SI++IL N  ++      D + +   W K  VD F       +D  + T +  + +K+      Y +   S V TV+  K +IS   G P   +  +  G   +KP D+D  +   N  +EI+ S + ++ +  LG G+ G V+      TK ++ + +   S EDLYR+I     + R ++ +    L   +   C  M Y+  GSL S LE  K F E +IAKIS  IL QI  IH+R  IH DIK  N+VL E   AK+IDFG+S++    +  S +  L  +  GT LYMAPE++  +  + K+DIWSFG+++ EM + N     +   +F RN+
Sbjct:   16 LDINVGKELSIEAP---YFLIYNDIILNDNRVIEYYKINPNKKIFAAKLENYLQRDHIVVEIFIMRFNPDRIHLIVKPCDTIAHIKLLLENIVADISNIWNMNGQLLAGNQSVADTANNGIDLKLIILCGDQIDIEFDKFCKIHDQFILYNYWRKYIFYDGWIRGDLFNSDRDILMALVDKWKLILLSDFTIDCKLEKNFLHFPVGFLNSRWLACEYLSEYIYGICDDYLKLVKQDIRLDGNSGFRDFIFDAIQCSILNSIKFRTADTAGIDKSIRTILTNGIDYLMNFINDPSFNGRYWMKLYVDEFMFAPSNTVDMNDITFDTYSDVKIHIDQCKYDITVPSTVETVIQLKNAISMLTGFPSDQMYLVKRG-GDVKPDDNDRIDGIYNYFVEIINSFDCLQDETSLGKGSFGTVFKYVDKETKSSIILKEQHLSNEDLYRDISIQSLIERSERFINRNRLIDKNGHICFTMDYMSLGSLKSLLETKKYFPEDQIAKISYQILKQIEYIHKRYIIHRDIKSENIVLDEHYNAKLIDFGLSKFTVGLSQTSLEERLKIYAPGTVLYMAPELLMDKPYTNKIDIWSFGIVMVEMATGNVPYSDLPQPVFIRNI 623          
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Match: SMESG000017211.1 (SMESG000017211.1)

HSP 1 Score: 228.024 bits (580), Expect = 7.321e-65
Identity = 194/624 (31.09%), Postives = 303/624 (48.56%), Query Frame = 3
Query:   69 KEKTMEIDDLMPVKSMKLNYN-KTAKMKLPIKSTY-LIYENIILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHLIMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWN---KLIV------RCEDSPNDSFTQCSDCHDK------YLWEYLKP----GFYPIFLPRNIQDESTIHPXXXXXXXXXXXXXXSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYEYSGYIICIIFQYMQQRI------NYNSNPKT------SIKSILLNSPEF------DRTVDVFTWFKTIVDFFKLGHLDQFEYT----------LNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISCQYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGCGASGEVYLCE---TLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELYSIDNRPCMAMKYLKGGSLASHLEK--GFSEAEIAKISRNILSQIAEIHERKFIHFDIKCGNVVLSESKCAKIIDFGVSE----YNSKSKKGYLLKHKIGTELYMAPEIINKENCSCKVDIWSFGVMLTEMVSS 1766
            +++ + I   M V+ +K N + K     + +K  Y  I+ N+IL +   +K Y+I  ND IW GK+ N++K D + +EIF+   IP  V +IM   D+I ++RSKL  I P I ++WN  G+ M ++Q++ D       KLI+       CE   N SF +C D HD+       +W+ ++         + L + + D+  +    ++     L   ++  P   +N   LF   ++D I + +M     D     R EY   +   I  Y +  I      + NS P        SI+SI+L + E+        + +   W K ++   K   L QF  +           ++  + +K  G  +++  T +V TV+DAK  IS   G+  + +LCI     S KP D DL+++   IEI LS E++E  +LL  G  G VYL +   ++   +  +  +  +DLYREI    QL   + I  Y  LY  +    MAMKYL  GSL ++L++  G  E +I++I   IL QI  IH  K IH DI   N+V  E   AK+IDFG+S+     + +     L K+  G   Y+APE +N E  S KVDIWSFG +  EM + 
Sbjct:   13 RKEEIYISQYMEVRDIKSNLDAKYGGQGVLVKYYYRFIHGNLILYENVCIKHYRIAANDEIWFGKIENFLKSDDVIVEIFLLGFIPTSVFMIMKTFDSISEIRSKLSRIYPMISNIWNARGRLMRDDQMITDSDEEGHYKLIICYCDIESCE--MNYSFEECCDLHDRSWVEQFLIWDQVRDENNNDSRRMMLIKRL-DKVRLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVM-----DYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLI---KQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADS-KPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSKGSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTG 624          
The following BLAST results are available for this feature:
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK13.050e-1832.80p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK25.465e-1834.75p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;... [more]
PAK36.237e-1833.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK16.397e-1832.80p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK36.599e-1833.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-21.797e-1930.93Serine/threonine-protein kinase max-2 [Source:Uni... [more]
max-22.244e-1931.61Serine/threonine-protein kinase max-2 [Source:Uni... [more]
pak-18.932e-1932.11Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.272e-1832.11Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
max-21.321e-1831.61Serine/threonine-protein kinase max-2 [Source:Uni... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak1.658e-1831.38gene:FBgn0267698 transcript:FBtr0334539[more]
Pak1.658e-1831.38gene:FBgn0267698 transcript:FBtr0081714[more]
Pak1.658e-1831.38gene:FBgn0267698 transcript:FBtr0081716[more]
Pak1.658e-1831.38gene:FBgn0267698 transcript:FBtr0081715[more]
Pak1.658e-1831.38gene:FBgn0267698 transcript:FBtr0334544[more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24b1.895e-1840.34serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk24b4.493e-1838.76serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk398.182e-1828.50serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
pak11.263e-1733.33p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak11.263e-1733.33p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox26.071e-1933.33quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.493e-1833.33quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
flii2.862e-1833.33FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii6.418e-1833.33FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
flii7.758e-1833.33FLII actin remodeling protein [Source:Xenbase;Acc:... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak14.530e-1832.80p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak14.530e-1832.80p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak34.693e-1833.33p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak34.693e-1833.33p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak34.693e-1833.33p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q869N2|PAKB_DICDI2.282e-2034.92Serine/threonine-protein kinase pakB OS=Dictyostel... [more]
sp|Q10056|SHK2_SCHPO1.564e-1833.50Serine/threonine-protein kinase shk2 OS=Schizosacc... [more]
sp|Q5APR8|CLA4_CANAL2.223e-1833.85Serine/threonine-protein kinase CLA4 OS=Candida al... [more]
sp|O14427|CLA4_CANAX2.500e-1833.85Serine/threonine-protein kinase CLA4 OS=Candida al... [more]
sp|P50527|STE20_SCHPO4.610e-1831.72Serine/threonine-protein kinase shk1/pak1 OS=Schiz... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M2XS312.775e-2037.06Serine/threonine protein kinase isoform 1 OS=Galdi... [more]
A0A0B6ZP701.403e-1933.85Protein kinase domain-containing protein OS=Arion ... [more]
A7S4G73.535e-1932.67Predicted protein (Fragment) OS=Nematostella vecte... [more]
Q6Y2W86.498e-1936.60GCK-like kinase MIK OS=Zea mays OX=4577 PE=2 SV=1[more]
A0A109FDB87.059e-1934.04Pkinase-domain-containing protein (Fragment) OS=Rh... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK31.994e-1833.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK32.204e-1833.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK32.204e-1833.33p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
map3k195.590e-1831.66mitogen-activated protein kinase kinase kinase 19 ... [more]
stk391.102e-1728.50serine/threonine kinase 39 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008193.12.114e-1733.96pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
ENSPMAT00000001278.12.305e-1732.03pep scaffold:Pmarinus_7.0:GL476529:253165:339525:-... [more]
map3k21.337e-1630.54mitogen-activated protein kinase kinase kinase 2 [... [more]
hck3.411e-1625.43HCK proto-oncogene, Src family tyrosine kinase [So... [more]
mylk32.892e-1530.05myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK12.647e-1832.35MAPKK involved in the protein kinase C signaling p... [more]
SKM12.817e-1828.23Member of the PAK family of serine/threonine prote... [more]
MKK25.093e-1833.67MAPKK involved in the protein kinase C signaling p... [more]
STE113.861e-1729.48Signal transducing MEK kinase; involved in pheromo... [more]
CLA41.878e-1629.03Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414105.078e-2332.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375751.339e-1833.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.530e-1830.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336674.574e-1832.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257354.005e-1726.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015480.21.084e-1832.11serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000028689.11.343e-1832.11serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.11.343e-1832.11serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000030173.11.343e-1832.11serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
pak11.916e-1833.86p21 (RAC1) activated kinase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Mitogen-activated protein kinase kinase kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070043.10.000e+091.28SMESG000070043.1[more]
SMESG000070043.10.000e+093.76SMESG000070043.1[more]
SMESG000070043.10.000e+091.23SMESG000070043.1[more]
SMESG000003013.12.604e-6530.72SMESG000003013.1[more]
SMESG000017211.17.321e-6531.09SMESG000017211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034690 ID=SMED30034690|Name=Mitogen-activated protein kinase kinase kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2084bp
TCTATATAAATCTTATATGAAATCTTTGAATCACAATGAAATTAAAGTTT
CACTTTGATGACATTTTAAAGGAAAAAACTATGGAGATTGATGATCTTAT
GCCAGTAAAATCAATGAAGTTAAATTATAATAAAACTGCAAAGATGAAAT
TACCAATAAAATCAACTTATTTGATTTATGAAAATATTATTTTAAATGAT
CAAAAATCATTAAAATTTTATAAAATTCGTCCTAATGATCGCATATGGGT
GGGTAAACTCTATAATTATATGAAAATGGATAAATTGGCAATTGAGATAT
TTGTATATTGGCATATACCCGAATTTGTCCACCTGATAATGAATGAAAAT
GATACTATATTACAATTGAGATCAAAACTGGGCAATATAATTCCTAATAT
CATTGATGTGTGGAATATTTACGGCCAAGAAATGTCCAATAATCAGTTGT
TGAATGATATTGTCTGGAATAAATTAATTGTGAGATGCGAGGATTCTCCT
AATGATTCGTTTACTCAATGTTCTGATTGTCATGATAAATATTTGTGGGA
ATATCTTAAACCTGGTTTTTATCCAATCTTTTTGCCCAGAAATATTCAAG
ATGAATCCACAATTCATCCGTTATTAGATAATTTACCAACTGATTTATTG
GATTTTGATTTGTCTGGTATTCCAATCGGATTGGTCAACTGCCATTTGCT
GTTTTGCAAAGTAATTTCTGATTGGATAGTGGATGCTATCATGGCGACAA
CAAATGCAGACAGTGAACGTGGGGTTAGATATGAATATTCTGGATACATA
ATTTGCATAATTTTTCAATATATGCAACAAAGGATTAATTACAATTCCAA
CCCCAAAACATCAATTAAAAGCATTTTATTGAATTCCCCCGAGTTTGATC
GGACTGTTGATGTTTTTACATGGTTTAAAACAATTGTTGATTTCTTCAAG
CTTGGGCATTTAGATCAATTTGAATATACTTTAAATGAAACAATAATCAA
ATTGAAGTCTCGAGGTCGACATTATAAGTTAGAAACTACCTCAGAAGTAT
TAACGGTACTCGATGCAAAGAAATCGATATCATGCCAATATGGAGTGCCG
GTTCAATATCTGTTATGCATCAACTATGGGAAATCTAGCATTAAACCAAT
GGACGATGATCTCTATAACAATAATCTTTGTATAGAGATTATGTTGAGCG
CTGAAAATATTGAAATAAAAGAATTGCTTGGTTGTGGAGCGTCAGGAGAA
GTATATTTATGCGAGACACTAAATACTAAACTTGCTTTGAAAATGCCGAA
AAGTACTGAAGACCTTTACCGAGAAATCTATAATTGTTGCCAACTTTTGC
GATGTAAAAAAATACTAGGATATAAAGAATTATACAGTATCGATAATCGT
CCTTGTATGGCAATGAAATACCTTAAAGGAGGATCTCTCGCCTCACACTT
AGAAAAAGGGTTTTCAGAAGCAGAAATCGCAAAGATTTCTCGTAATATCC
TTAGTCAAATCGCAGAAATTCATGAGCGAAAGTTCATTCATTTCGATATA
AAATGTGGTAATGTTGTTCTTTCGGAATCCAAATGTGCAAAGATTATTGA
TTTTGGAGTATCGGAATATAATTCAAAATCAAAAAAAGGTTACCTTTTAA
AACATAAGATCGGCACAGAGTTGTATATGGCACCGGAGATAATAAATAAA
GAAAATTGCTCCTGTAAAGTCGATATTTGGTCATTTGGTGTAATGCTAAC
GGAAATGGTTTCAAGTAATGGATTAAAATTATTAATTAATTATAGATTAT
TTACACGAAATCTCCTCAGAAGCGGTGCCGGAGACTTGTGGTAAATAAAT
AAATATATTGATTTATAGTCTGAAATGAAAATAGGAAATTAATTTTTTGT
TCTTAATTTTTAATGTTAATTGCTGCTCAATTTCTGATTCTTTGTGCTCT
TTTATCAAATAAGCAAAAATCGATAAAAATATATATTTCACATTATCCCA
CAATCTCAACCATTTCTCAATGGATTTTTAGGAAATTCAAAGCTAGTTCC
GGATTTCCAAATTTTTGTTTCCCATTTTCTTTCA
back to top

protein sequence of SMED30034690-orf-1

>SMED30034690-orf-1 ID=SMED30034690-orf-1|Name=SMED30034690-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=603bp
MKLKFHFDDILKEKTMEIDDLMPVKSMKLNYNKTAKMKLPIKSTYLIYEN
IILNDQKSLKFYKIRPNDRIWVGKLYNYMKMDKLAIEIFVYWHIPEFVHL
IMNENDTILQLRSKLGNIIPNIIDVWNIYGQEMSNNQLLNDIVWNKLIVR
CEDSPNDSFTQCSDCHDKYLWEYLKPGFYPIFLPRNIQDESTIHPLLDNL
PTDLLDFDLSGIPIGLVNCHLLFCKVISDWIVDAIMATTNADSERGVRYE
YSGYIICIIFQYMQQRINYNSNPKTSIKSILLNSPEFDRTVDVFTWFKTI
VDFFKLGHLDQFEYTLNETIIKLKSRGRHYKLETTSEVLTVLDAKKSISC
QYGVPVQYLLCINYGKSSIKPMDDDLYNNNLCIEIMLSAENIEIKELLGC
GASGEVYLCETLNTKLALKMPKSTEDLYREIYNCCQLLRCKKILGYKELY
SIDNRPCMAMKYLKGGSLASHLEKGFSEAEIAKISRNILSQIAEIHERKF
IHFDIKCGNVVLSESKCAKIIDFGVSEYNSKSKKGYLLKHKIGTELYMAP
EIINKENCSCKVDIWSFGVMLTEMVSSNGLKLLINYRLFTRNLLRSGAGD
LW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0000186activation of MAPKK activity
GO:0006468protein phosphorylation
GO:0006972hyperosmotic response
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0031152aggregation involved in sorocarp development
GO:0045762positive regulation of adenylate cyclase activity
GO:0046777protein autophosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004709MAP kinase kinase kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR000626Ubiquitin-like_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005938cell cortex