G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30034676
Length (bp)1470
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30034676) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30034676) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30034676) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30034676) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30034676h1SMcG0012368 Contig49267uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034676h1SMcG0012368 Contig49267newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30034676h1SMcG0012368 dd_Smed_v4_15630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034676h1SMcG0012368 dd_Smed_v6_15630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-6 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q8I7K6])

HSP 1 Score: 51.6026 bits (122), Expect = 6.583e-7
Identity = 53/210 (25.24%), Postives = 104/210 (49.52%), Query Frame = 2
Query:  182 IVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFP---AALRQKNMFACISLSMIR---FTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYN--------KGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKST 769
            I+L GL GN L++ V  +P +  S+  F L  L++ DI  L+F+L    +++   +     A   + MF   S         T    S++++V + ++R I V  P +  + CT K +  IVI++I   ++++   ++  +  Y+        +G +++ E    Y + F+ I +     LPF +M +AN  +I++LR+  K R  + ++
Sbjct:   17 IILVGLVGNGLSLYVYTTPNMRKSTVAFLLYSLSICDIFVLLFALPLYSISYLPIWDNVYGAWSMRRMFIAFSTKFFYPLCMTAKTASLYIMVVITVERWIAVCRPLQVHIWCTFKNSVRIVIAIITFSIILNFPKFFEYQIGYSDALGYWPKRGILDAEEHWWYYISYFIIISVIFDYLLPFVIMFIANMKVINELRKSRKERALLTTS 226          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: npr-9 (Galanin-like G-protein coupled receptor npr-9 [Source:UniProtKB/Swiss-Prot;Acc:Q23497])

HSP 1 Score: 50.8322 bits (120), Expect = 1.421e-6
Identity = 31/110 (28.18%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSI---FFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKA 490
            ++A+I+L GL GN L V V    ++ NS+ T  +  LA+ D+++L+  +    ++++     FP        + C  ++  + T  Y SVW L  +A+DR + V++P ++
Sbjct:   49 IFAVIILVGLVGNALVVIVAFGRQMRNSTNTLIIG-LAISDLMFLLLCVPFTAVDYAAPTWIFPE-------WTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVES 150          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-15 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q21413])

HSP 1 Score: 49.6766 bits (117), Expect = 3.148e-6
Identity = 81/373 (21.72%), Postives = 160/373 (42.90%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMI-------RFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFT----YNKGSVNSC-------ELKESYRNPFLYIDLTLVMG-LPFFVMSVANSLIISKLREMEKLRKGM------KSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRS--RDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSL-LLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCK---YCFC 1195
            ++  + LFG+  N + + V     + N +  ++   L+  D+L L+ S+      FS+   A       +  +S+ +I       +  LT +SV++ + V++ R + V  PF  + I      K ++++ I    + +   ++ L         +G  NS         +   Y   F     T+VM  LPF +++  N  II+ L++  K+RK M      +S + +P D+++  ++  S     ++ +  N        I+       S   DK+   +T ML+++       TT  L +N++ +  +I  L  ++F   L  L+  +   +     +N A   ++Y + G K+R   IRL  K   + FC
Sbjct:   26 LFPFVYLFGIISNSINICVFSQKSMRNHTVNWFFLALSFSDLLTLVASI----FVFSVPVYAENSHNPEYIDLSVQLIVWFYPLAQIGLT-MSVYVTILVSVHRYLGVCHPFLIRRISNSNAVKAVIVAAIVFAFVFNASRWFELHAQPCSFGTEGQTNSSVVYPTSLMMNRMYTLIFRNAAYTIVMFFLPFAILTYVNLRIIATLKQSYKMRKAMTTSRSKRSDSTVPTDTIVTKIDGYSAVVPVENGEKGN-------GILMGGANNGSVKNDKKENGVTVMLVAI-------TTEFLLFNLIAFATNIIELSSIRFFADLETLLVELSTFLVN---VNGASTIIIYLIFGSKYRNVFIRLFRKNLGHNFC 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-15 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q21413])

HSP 1 Score: 49.6766 bits (117), Expect = 3.148e-6
Identity = 81/373 (21.72%), Postives = 160/373 (42.90%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMI-------RFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFT----YNKGSVNSC-------ELKESYRNPFLYIDLTLVMG-LPFFVMSVANSLIISKLREMEKLRKGM------KSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRS--RDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSL-LLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCK---YCFC 1195
            ++  + LFG+  N + + V     + N +  ++   L+  D+L L+ S+      FS+   A       +  +S+ +I       +  LT +SV++ + V++ R + V  PF  + I      K ++++ I    + +   ++ L         +G  NS         +   Y   F     T+VM  LPF +++  N  II+ L++  K+RK M      +S + +P D+++  ++  S     ++ +  N        I+       S   DK+   +T ML+++       TT  L +N++ +  +I  L  ++F   L  L+  +   +     +N A   ++Y + G K+R   IRL  K   + FC
Sbjct:   26 LFPFVYLFGIISNSINICVFSQKSMRNHTVNWFFLALSFSDLLTLVASI----FVFSVPVYAENSHNPEYIDLSVQLIVWFYPLAQIGLT-MSVYVTILVSVHRYLGVCHPFLIRRISNSNAVKAVIVAAIVFAFVFNASRWFELHAQPCSFGTEGQTNSSVVYPTSLMMNRMYTLIFRNAAYTIVMFFLPFAILTYVNLRIIATLKQSYKMRKAMTTSRSKRSDSTVPTDTIVTKIDGYSAVVPVENGEKGN-------GILMGGANNGSVKNDKKENGVTVMLVAI-------TTEFLLFNLIAFATNIIELSSIRFFADLETLLVELSTFLVN---VNGASTIIIYLIFGSKYRNVFIRLFRKNLGHNFC 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: daf-37 (G-protein coupled receptor daf-37 [Source:UniProtKB/Swiss-Prot;Acc:Q18321])

HSP 1 Score: 48.1358 bits (113), Expect = 9.787e-6
Identity = 39/115 (33.91%), Postives = 58/115 (50.43%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYI----SVWLLVAVAIDRMIWVIFPFKAKMIC 502
            V  +I LFGLFGN  T  +L  P + N +  F LT LA+ D   LI +     + + I + AA       A ++     F L++I    SV++ VAV I+R + V  P  +K +C
Sbjct:   39 VGTLIGLFGLFGNATTALILTRPSMRNPNNLF-LTALAVFDSCLLITAFFIYAMEYIIEYTAAFDL--YVAWLTYLRFAFALSHISQTGSVYITVAVTIERYLAVCHPKSSKNMC 150          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 81.2629 bits (199), Expect = 3.939e-16
Identity = 102/407 (25.06%), Postives = 168/407 (41.28%), Query Frame = 2
Query:  194 GLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTY-NKGSVNSCELKESYRNP---FLYIDLTLVMGLPFFVMSVANSLI------ISKLREMEKLRKGMKSTNRIP-------------------NDSVIPNLNATSKCSNRKHAKN-----------------NNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTAN-NVNDSQYMK 1273
            G  GN L+V V    KL   S++FYL  LA+ D  +L   L  Q LNF       +  +N F C   +   +  ++ SVW +VA  ++R I VI+P K + +CT + AKI++  L  V  L  L +    K  +  K +   C+L   Y+     F Y D  +V  +PF  ++V N+         + +R    + K    TN +P                   + S+    +  +  S + +  N                 NN +    CEI ++  RR+ ++     +TKMLL V+  F+    P     I  Y     +      NQ + +   ++ I +  +  NF ++F+LYC+SG  FR+  +            IF R+   +    N  V  S+Y +
Sbjct:   73 GSIGNILSVFVFFRTKLRKLSSSFYLAALAVSDTCFLA-GLFAQWLNF---LNVDIYNQNYF-CQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCTVWKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQH--HCEITQKPARRKVQNSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESA-----RNQNSTI--ALQYIFHAFFITNFGINFVLYCVSGQNFRKAVLS-----------IFRRVSSAQREAGNTQVTVSEYCR 454          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-1h24.2 (si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-482])

HSP 1 Score: 51.9878 bits (123), Expect = 1.060e-6
Identity = 96/399 (24.06%), Postives = 166/399 (41.60%), Query Frame = 2
Query:  116 FNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLI----FSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHF-YWTLKFTYNKG---SVNSCELK---ESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKL-REMEKLRKGMKSTNRIPNDSVIPNLNAT-SKCSNRKHAKNNNVEEITPC----EIVKRSTRRRSRDKQTTSLTK---------MLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIEN 1234
            F    P  +D +R I   +++++ L  +FGN L + VLI  K   + T  +L  LA+ D++  I    F+L   +L   IF  A  +    F  IS+S        IS + LVA+AI+R   +  P K++   TR  A  ++ +   + V I + +  +++   +NK    + + C L+         +  + L+++  +P  VM +A  LI  +L R ++   +  K T+ + N      LN   S C +        V +  P      +    T +  R +  TS  K         ML+ +   F V   PL + N       I +     +  L+G        I  L Y +  V+ ++YC    +FR+    LL  +  C+    NR  + E 
Sbjct:   23 FKPTRPKEMDSVRII---LYSLVFLLSVFGNLLIIVVLIVNKRMRTVTNSFLLSLAVSDLMMAIFCIPFNLIPSLLEDFIFGAAMCKTVAYFMGISVS--------ISTFSLVAIAIERYSAICNPLKSRAWQTRSHAYKVIAATWVLSVAIMVPYPVFSILVPFNKTNNITAHMCRLEWPISQVEQTWYVLLLSILFFIPGVVMIIAYGLISRELYRGIQFELEQKKDTSGVKN-----GLNGGLSSCHDESDGCYIQVSKKPPAMELSTLTTSGTVKTDRPRSNTSEAKLIAKKRVIRMLIIIVAMFFVCWMPLYTANTWKAFDQISA-----QRALSGAPIS---FIQLLSYTSACVNPIIYCFMNTRFRKA---LLATFGCCRRPCHNRRKRKEG 394          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-1h24.2 (si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-482])

HSP 1 Score: 51.6026 bits (122), Expect = 1.505e-6
Identity = 96/399 (24.06%), Postives = 167/399 (41.85%), Query Frame = 2
Query:  116 FNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLI----FSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHF-YWTLKFTYNKG---SVNSCELK---ESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKL-REMEKLRKGMKSTNRIPNDSVIPNLNAT-SKCSNRKHAKNNNVEEITPCEIVK--------RSTRRRSRDKQTTSLTK-----MLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIEN 1234
            F    P  +D +R I   +++++ L  +FGN L + VLI  K   + T  +L  LA+ D++  I    F+L   +L   IF  A  +    F  IS+S        IS + LVA+AI+R   +  P K++   TR  A  ++ +   + V I + +  +++   +NK    + + C L+         +  + L+++  +P  VM +A  LI  +L R ++   +  K T+ + N      LN   S C +        V +  P   +         ++ R RS   +   + K     ML+ +   F V   PL S N       I +     +  L+G        I  L Y +  V+ ++YC    +FR+    LL  +  C+    NR  + E 
Sbjct:   47 FKPTRPKEMDSVRII---LYSLVFLLSVFGNLLIIVVLIVNKRMRTVTNSFLLSLAVSDLMMAIFCIPFNLIPSLLEDFIFGAAMCKTVAYFMGISVS--------ISTFSLVAIAIERYSAICNPLKSRAWQTRSHAYKVIAATWVLSVAIMVPYPVFSILVPFNKTNNITAHMCRLEWPISQVEQTWYVLLLSILFFIPGVVMIIAYGLISRELYRGIQFELEQKKDTSGVKN-----GLNGGLSSCHDESDGCYIQVSKKPPAMELSTLTTSGPVKTDRPRSNTSEAKLIAKKRVIRMLIIIVAMFFVCWMPLYSANTWKAFDQISA-----QRALSGAPIS---FIQLLSYTSACVNPIIYCFMNTRFRKA---LLATFGCCRRPCHNRRKRKEG 418          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: trhrb (thyrotropin-releasing hormone receptor b [Source:ZFIN;Acc:ZDB-GENE-060503-382])

HSP 1 Score: 50.0618 bits (118), Expect = 4.175e-6
Identity = 83/344 (24.13%), Postives = 141/344 (40.99%), Query Frame = 2
Query:  179 IIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYW---TLKFTYNKGSVNSCELKESYRN---PFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTP---LLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCK 1183
            +I   G+ GN + + V+++ K   + T  YL  LA+ D++ L+ + G   +  S+F            C+ ++  ++     S   + A  I+R I +  P KA+ +CT   AK I+I +     L  + +++     +  Y   ++ +C  K S RN   P  + D  +   LP  + +V   LI   L             N +P+D+        +   N   AK N ++  + C     ++RR+        +TKML  V I F V   P   L+  N      ++ +  L F                T  YLN A++ L+Y     KFR  A R LC+
Sbjct:   31 LICALGIVGNVMVILVVLTTKHMRTPTNGYLVSLAVADLMVLV-AAGLPSIADSLFGSWVFGHA---GCLCITYFQYLGINASSCSITAFTIERYIAICHPIKAQFLCTLSRAKKIIIGVWVFTSLYCVMWFYLSDVQQVLYKDATIITCAYKVS-RNLYLPIYFFDFGIFFVLPLTLATVLYGLIARILF-----------LNPLPSDTK----EEKNGHGNFSKAKRNKLKSSSRCSSTTAASRRQ--------VTKMLAVVVILFAVLWMPYRTLVVVNSFLQDAYLDTWFLLF--------------CRTCVYLNSAINPLIYNAMSQKFR-AAFRRLCR 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 49.6766 bits (117), Expect = 4.771e-6
Identity = 32/112 (28.57%), Postives = 63/112 (56.25%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLI-SPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSI---FFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAK 493
            ++++I L G  GNCL +AVLI + ++N  ST  ++  L L D+ +++F +  Q   +++    F A       F C ++  I +   Y S++ L AV++DR + + +P +++
Sbjct:   24 IFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGA-------FVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSR 128          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 49.6766 bits (117), Expect = 4.771e-6
Identity = 32/112 (28.57%), Postives = 63/112 (56.25%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLI-SPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSI---FFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAK 493
            ++++I L G  GNCL +AVLI + ++N  ST  ++  L L D+ +++F +  Q   +++    F A       F C ++  I +   Y S++ L AV++DR + + +P +++
Sbjct:   24 IFSMIFLVGTVGNCLVLAVLIRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGA-------FVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSR 128          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28596|TRFR_SHEEP (Thyrotropin-releasing hormone receptor OS=Ovis aries OX=9940 GN=TRHR PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 9.767e-6
Identity = 96/360 (26.67%), Postives = 156/360 (43.33%), Query Frame = 2
Query:  122 QIHPPAIDIIRNICIGVWAIIVL--FGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKF---TYNKGSVNSCELKES--YRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLC 1180
            Q+ P A+  +    + +  ++++   G+ GN + V V++  K   + T  YL  LA+ D++ L+ + G   +  SI+            C+ ++ +++     S   + A  I+R I +  P KA+ +CT   AK I+I + A   +  + +++ L     TY    V SC  K S  Y +P   +D  +   +P  + +V    I   L          +++N   NDS   N N  SK SNR    N+ V           S+R++        +TKML  V I F +   P   Y  L  V    S   Q EN    L+F   RI     YLN A++ ++Y +   KFR  A R LC
Sbjct:   13 QLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPTNCYLVSLAVADLMVLV-AAGLPNITDSIYGSWVY---GYVGCLCITYLQYLGINASSCSITAFTIERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLSPIPSDPKENSNTWKNDSTHQNKNLNSKTSNRYF--NSTV-----------SSRKQ--------VTKMLAVVVILFALLWMP---YRTLVVVNSFLSSPFQ-ENWF--LLFC--RICI---YLNSAINPVIYNLMSQKFR-AAFRKLC 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3U400 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1343 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.896e-80
Identity = 153/376 (40.69%), Postives = 227/376 (60.37%), Query Frame = 2
Query:  125 IHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRL---LCKYCFCKALIFNRMLKIE-NRT 1240
            + PP +  IR  CI VW+I++ FGLFGN LTV VL + +L  SST+FYLTVLA+ D+LYL+ SL   + NF  FFP+ +RQ +   C+    + +TL YISVWLLVAV ++R IWV+ PF+A+ ICT++ AK +V+++++V  L+D HF+ T+++   + S  SC         F ++DL  V  LP  +M +AN LI  KLR M K R G+                ATS  +N +   +                    + +++T+LT+ML+S NIFF+VS TPLL Y+++F+   +++   + E+   G++F IER++YTLWY NFA+HFLLYC+SGP FR E + +   L  +C C +     M K+E NR+
Sbjct:   34 VTPPLVSGIRYACIPVWSILLFFGLFGNALTVFVLRAKRLQQSSTSFYLTVLAITDVLYLLTSLVASIANFIFFFPSEVRQISNTFCVLTPFLHYTLAYISVWLLVAVTVERAIWVVLPFQARNICTKRTAKFVVVTIVSVFTLLDTHFFVTMRYIEVQPSYWSCSTTYFADKVFPFLDLLFVAVLPCAIMLIANCLIGWKLRVMRKFRSGVA---------------ATSTSNNNQGGSD--------------------KREKSTNLTRMLVSTNIFFIVSVTPLLIYDVVFFSVDVRAWAEEDEDVRGGMLFAIERLVYTLWYTNFAIHFLLYCLSGPPFRAEVLVIFNRLRDFCCCGSAQKQTMDKLEMNRS 374          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3W0N4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3234 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 1.309e-76
Identity = 157/413 (38.01%), Postives = 226/413 (54.72%), Query Frame = 2
Query:  125 IHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTANNVNDSQYMKTYCLTEENKYIKEFQNTPTKSLCPASVAGE 1363
            + PP I  IR  CI VW+I++ FG+FGN LTV VL + +L  SST+FYLT LA+ D+LYL+ SL   + NF  FFP  LRQ +   C+    + +TL YISVWLLV V ++R +WV+ PF+A+ ICT++ AK +V  L+    L+D+HF+ T+ +   +    +C         F ++DL LV  LP  +M VAN LI  KLR M K R G  +T  + N       N+T +    K  K+ N                         LT+ML+S N+FF+VS TPLL Y+++F+   I++   + E    G+IF IER++YTLWY NF++HFLLYC+SGP FR E +           ++FNR+    NR        +  +T         +K  +  PT ++   S AG+
Sbjct:   26 VTPPLISGIRYACIPVWSILLCFGIFGNALTVFVLRAKRLQQSSTSFYLTALAITDMLYLLTSLVASIANFIFFFPLELRQLSRTFCVLTPFLSYTLAYISVWLLVTVTVERAVWVVLPFRARHICTKRTAKFVVALLVFGFTLLDIHFFVTMLYQEVRPGYWACMTTYFSDKVFPFLDLLLVAVLPCTIMLVANCLIGWKLRVMRKFRSG-TATGMVSN-------NSTDQGGGDKREKSIN-------------------------LTRMLVSTNVFFIVSVTPLLIYDVVFFSVDIRAWAEEAEEVRGGMIFAIERLVYTLWYTNFSIHFLLYCLSGPPFRAEVL-----------VLFNRL---RNRIRKAARKPRVDQT--------ELKRPETMPTSTVNAVSTAGD 383          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3TQP7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9870 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.866e-76
Identity = 157/381 (41.21%), Postives = 221/381 (58.01%), Query Frame = 2
Query:   86 MNFSTAVNSTFNQIHPP-AIDI------IRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLL--CKYCFCKA 1201
            M+ S  V++T     PP A DI      IR   I +W +++ FGLFGN LTV VL + +L  SST+FYLT LA+ D+LYL+ SL   + NF  FFP  LRQ +   C+ L  I +TL YISVWLLVAV ++R IWV+ PF+A  ICTR+ AK +V  L+ V  ++D+HF+ T+++         C+        F Y+DL LV  LP  +M +AN LI  KLR M K R G  S ++         LN+ +  +N +                        + +++T+LT+ML+S N+FF++S TPLL Y+++F+   +K+   + E    G+IFG+ER +YTLWY NFA+HFLLYC+SGP FR E   LL   +  FC A
Sbjct:    1 MSDSVNVSNTSTDSSPPSAFDIPLSITAIRYTYIPIWILLLFFGLFGNALTVFVLQAKRLKQSSTSFYLTALAITDMLYLLTSLVTSVANFIYFFPFELRQTSKTFCVLLPFINYTLAYISVWLLVAVTVERAIWVVLPFRAHRICTRRTAKFVVPLLVIVFTILDIHFFITMRYVNISKDKWICKPNSFTDKVFPYLDLLLVAVLPCTIMLIANCLIGWKLRVMLKFRTGTASASK--------TLNSNADPANAE------------------------KKEKSTNLTRMLVSTNVFFIISVTPLLIYDVVFFSIDVKAWAEENEKVRGGIIFGLERFVYTLWYTNFAIHFLLYCLSGPPFRAEVFVLLNRIRTRFCNA 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3WQM9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3054 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 4.114e-76
Identity = 147/350 (42.00%), Postives = 206/350 (58.86%), Query Frame = 2
Query:  125 IHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRL 1174
            + PP I  IR  CI +W+I++ FG+FGN LTV VL + +L  SST+FYLT LA+ D+LYL+ SL   + NF  FFP  LRQ +   C+    + +TL YISVWLLV V ++R +WV+ PF+A+ ICT++ AK +V+ L+    L+D+HF+ T+++   +    +C         F ++DL LV  LP  +M VAN LI  KLR M K R G  S         + N N T + S  K  K+ N                         LT+ML+S N+FF+VS TPLL Y+++F+   I++   + E    G+IF IER++YTLWY NFA+HFLLYC+SGP FR E + L
Sbjct:   26 VTPPLISGIRYACIPIWSILLCFGIFGNALTVFVLRAKRLQQSSTSFYLTALAITDMLYLLTSLVASIANFIFFFPLELRQLSRTFCVFTPFLSYTLAYISVWLLVTVTVERAVWVVLPFRARHICTKRTAKFVVVLLVFGFTLLDIHFFVTMRYHEVRPKYWACMTTYFSDKVFPFLDLLLVAVLPCTIMLVANCLIGWKLRVMRKFRSGTAS-------GAVSN-NNTDQGSGDKREKSIN-------------------------LTRMLVSTNVFFIVSVTPLLIYDVVFFSVDIRAWAEEAEEVRGGMIFAIERLVYTLWYTNFAIHFLLYCLSGPPFRAEVLVL 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3SC23 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2081 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 4.683e-76
Identity = 148/357 (41.46%), Postives = 211/357 (59.10%), Query Frame = 2
Query:  131 PPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAI----RLLCKYC 1189
            P +I  IR   I +W +++ FGLFGN LTV VL + +L  SST+FYLT LA+ D+LYL+ SL   + NF+ FFP  LRQ +   C+ L  I +TL YISVWLLVAV ++R IWV+ PF+A  ICTR+ AK IV  L+ V  ++D+HF+ T+++         C         F Y+DL LV  LP  VM +AN LI  KLR M K R G  + ++  N                 +A + N E                + +++T+LT+ML+S N+FF++S TPLL Y+++F+   +K+   + E    G++FG+ER +YTLWY NFA+HFLLYC+SGP FR E +    R+  ++C
Sbjct:   23 PLSITAIRYTYIPIWIMLLFFGLFGNALTVFVLQAKRLKQSSTSFYLTALAITDMLYLLTSLVSSIANFTYFFPFELRQTSKTFCVLLPFINYTLAYISVWLLVAVTVERAIWVVLPFRAHRICTRRTAKFIVPLLLIVFTILDIHFFITMRYVQISKDKWICRPNSFTDKVFPYLDLLLVAVLPCTVMLIANCLIGWKLRVMRKFRTGTLTGSKTLNS----------------NADSTNTE----------------KKEKSTNLTRMLVSTNVFFIISVTPLLIYDVVFFSIDVKAWAEENEKVRGGILFGLERFVYTLWYTNFAIHFLLYCLSGPPFRAEVLVLFNRIRTRFC 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: nmur1a (neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE-081104-220])

HSP 1 Score: 50.0618 bits (118), Expect = 7.011e-7
Identity = 32/115 (27.83%), Postives = 62/115 (53.91%), Query Frame = 2
Query:  164 IGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTR 508
            + ++ +I + G+ GN LT  V+   +L  + T FYL  LA+ D+L L+  +  ++      +P+   +     C   +M+  T+ + SV  + A++++R I V+ P KA+ + TR
Sbjct:   57 LAIYLLIFVTGVVGNFLTCIVISRHRLMRTPTNFYLFSLAVSDLLVLVLGMPLELYEMWENYPSLFGEG---GCYFKTMLFETVCFASVLNVTALSVERYIAVVHPLKARWLVTR 168          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:101165474])

HSP 1 Score: 50.8322 bits (120), Expect = 2.279e-6
Identity = 33/112 (29.46%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  170 VWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICT 505
            V+ +I L GL GN LT AV+   K   + T FYL  LA+ D+L L+F +  ++ +    +P    +     C   + +  T+ + S+  + A++++R I V+ P K + + T
Sbjct:   96 VYLLIFLIGLSGNVLTCAVIAKHKRMRNPTNFYLVSLAVSDLLVLMFGMPLEIYDLWQNYPFPFGEG---GCYFKTFLFETVCFASILNVTALSVERYIAVVHPLKTRYLST 204          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000002498.1 (SMESG000002498.1)

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 438/441 (99.32%), Postives = 439/441 (99.55%), Query Frame = 2
Query:   86 MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTANNVNDSQYMKTYCLTEENKYIKEFQNTPTKSLCPASVAGEQQKLITVELLQETSM 1408
            MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRKIAKIIVISLIA+LVLIDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSK SNRKHAKNNNVEEIT CEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTANNVNDSQYMKTYCLTEENKYIKEFQNTPTKSLCPASVAGEQQKLITVELLQETSM
Sbjct:    1 MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRKIAKIIVISLIAMLVLIDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKFSNRKHAKNNNVEEIT-CEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTANNVNDSQYMKTYCLTEENKYIKEFQNTPTKSLCPASVAGEQQKLITVELLQETSM 440          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000037421.1 (SMESG000037421.1)

HSP 1 Score: 350.517 bits (898), Expect = 1.318e-116
Identity = 189/418 (45.22%), Postives = 282/418 (67.46%), Query Frame = 2
Query:   86 MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKES--YRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIP----NLNATSKCS------NRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLLCKYCFCKALIFNRMLK-IENRTANNVNDSQYMKTYCLTEENK 1300
            MN S+A +++   + P +++IIR ICI VWA I+L G+FGN LTV VL  PKLN +STTFYLT+LA++D+LYLIFSLGGQM++F++ FP  +RQ N  +C  L++I +TL YISVWLLVAV+IDRMIWV+ PFKAK+ICTRK+AKIIV       + ID+HF WT+KF  ++   N+CE+ ++  ++  F Y+DLTL+M LPF +M ++N LI+ K++++  LR+ +  ++ IP  + +      +N+ S  S      N+    + N  E       +R ++   +DKQTTSLT+MLLSVN+FF+ ST PLL Y++++Y+   K ++ ++   + G+IFG+ER++YT WYLNF++HFLLYC+SGPKFR+EA   + +Y F +       +K + N   NN      +  Y   +++K
Sbjct:    1 MNQSSAWDNSTFPVMPDSVEIIRRICIAVWANIILVGVFGNILTVIVLAGPKLNTTSTTFYLTILAIVDLLYLIFSLGGQMVDFALLFPNTMRQSNELSCKLLNIILYTLAYISVWLLVAVSIDRMIWVLLPFKAKLICTRKVAKIIVSIFCIFFIGIDIHFIWTVKFVKHQTK-NNCEVIDNILFKYIFPYVDLTLIMILPFVIMLISNILIVLKIQKVSVLRQTLHRSSTIPEPNQVGILKVKMNSISSPSRFQDDTNQISISSRNRSESQVKFFKRRQSKYSLKDKQTTSLTRMLLSVNLFFMASTAPLLIYDVIYYLIDFKEMIQKYGIYIGGVIFGVERLVYTFWYLNFSIHFLLYCLSGPKFREEAKLFISQYFFRRKSFNQSSVKSVNNLKQNNTKTVHLVDRYHENDKSK 417          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000047150.1 (SMESG000047150.1)

HSP 1 Score: 298.516 bits (763), Expect = 1.327e-97
Identity = 166/348 (47.70%), Postives = 242/348 (69.54%), Query Frame = 2
Query:   86 MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKES--YRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRI--PNDSVIPNLNATSKCSNRKHAKNNNVEEIT----PCEIVKRSTRRRS----RDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYT 1093
            MN S+A +++   + P +++IIR ICI VWA I+L G+FGN LTV VL  PKLN +STTFYLT+LA++D+LYLIFSLGGQM++F++ FP  +RQ N  +C  L++I +TL YISVWLLVAV+IDRMIWV+ PFKAK+ICTRK+AKIIV       + ID+HF WT+KF  ++   N+CE+ ++  ++  F Y+DLTL+M LPF +M ++N LI+ K++++  LR+ +  ++ I  PN   I  +   S  S  +   + N   I+        VK   RR+S    +DKQTTSLT+MLLSVN+FF+ ST PLL Y++++Y+   K ++ ++   + G+IFG+ER++YT
Sbjct:    1 MNQSSAWDNSTFPVMPDSVEIIRRICIAVWANIILVGVFGNILTVIVLAGPKLNTTSTTFYLTILAIVDLLYLIFSLGGQMVDFALLFPNTMRQSNELSCKLLNIILYTLAYISVWLLVAVSIDRMIWVLLPFKAKLICTRKVAKIIVSIFCIFFIGIDIHFIWTVKFVKHQTK-NNCEVIDNILFKYIFPYVDLTLIMILPFVIMLISNILIVLKIQKVSVLRQTLHRSSTIPEPNQVGILKVKMNSISSPSRFQDDTNQISISSRNRSESQVKFFKRRQSKYSLKDKQTTSLTRMLLSVNLFFMASTAPLLIYDVIYYLIDFKEMIQKYGIYIGGVIFGVERLVYT 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000000903.1 (SMESG000000903.1)

HSP 1 Score: 282.722 bits (722), Expect = 8.923e-91
Identity = 155/355 (43.66%), Postives = 238/355 (67.04%), Query Frame = 2
Query:  122 QIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNS-CELKE-SYRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRKHAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLLLQFENQLTG-LIFGIERIIYTLWYLNFAVHFLLYCMSGPKFRQEAIRLL 1177
            ++ P  + +IRNICI VW  I++FG+ GN +TV VL  P +N  ST+ YL  LA+ D+++LIFS+GGQ+++F  FFP  LRQK+   C  +++  FT+TYISVWLLV V +DRM WVIFPFK++  CT + AK  +  +  V V+I+ HF W++    +  S  + CE  +  ++  F   DL  V  LP   M +AN +II+K++ M+ +R+ MK+   I  ++VI NL+  +K  N    K   +  +    I K ST  + RD++T+SLTKML+++NIFF++ST PLL Y++ ++   + +LL++ + +L G LIFG+E+++YTLWYL+F++HFLLYCMSGPKFR +A+ ++
Sbjct:    2 EVIPETVKVIRNICIVVWTFIIVFGVVGNIMTVLVLQYPNMNTMSTSIYLKALAIADMIFLIFSVGGQLIDFMFFFPMQLRQKHSVFCHIVNLFGFTVTYISVWLLVFVTLDRMFWVIFPFKSRKFCTIQTAKSTIAGVCLVCVMINTHFMWSVSSLISVHSNKTICEWSDVRFKLIFPIFDLIFVNILPSLTMLIANVMIIAKVKHMKNIREKMKTHQHIIKENVISNLSLENKM-NSNLLKPPELVPMNSLSIQKASTSDKRRDRKTSSLTKMLMTINIFFIISTLPLLIYDLAYWFIDM-NLLIKTDGKLYGPLIFGLEKLVYTLWYLHFSMHFLLYCMSGPKFRWQALYMV 354          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000047150.1 (SMESG000047150.1)

HSP 1 Score: 279.256 bits (713), Expect = 2.063e-90
Identity = 158/328 (48.17%), Postives = 227/328 (69.21%), Query Frame = 2
Query:   86 MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLISPKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFACISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRXXXXXXXXXXXXXXXXXDLHFYWTLKFTYNKGSVNSCELKES--YRNPFLYIDLTLVMGLPFFVMSVANSLIISKLREMEKLRKGMKSTNRI--PNDSVIPNLNATSKCSNRKHAKNNNVEEIT----PCEIVKRSTRRRS----RDKQTTSLTKMLLSVNIFFLVSTTPLLSYNILFYVPHIKSLL 1033
            MN S+A +++   + P +++IIR ICI VWA I+L G+FGN LTV VL  PKLN +STTFYLT+LA++D+LYLIFSLGGQM++F++ FP  +RQ N  +C  L++I +TL YISVWLLVAV+IDRMIWV+ PFKAK+ICTRK+AKIIV       + ID+HF WT+KF  ++   N+CE+ ++  ++  F Y+DLTL+M LPF +M ++N LI+ K++++  LR+ +  ++ I  PN   I  +   S  S  +   + N   I+        VK   RR+S    +DKQTTSLT+MLLSVN+FF+ ST PLL Y++++Y+   K ++
Sbjct:    1 MNQSSAWDNSTFPVMPDSVEIIRRICIAVWANIILVGVFGNILTVIVLAGPKLNTTSTTFYLTILAIVDLLYLIFSLGGQMVDFALLFPNTMRQSNELSCKLLNIILYTLAYISVWLLVAVSIDRMIWVLLPFKAKLICTRKVAKIIVSIFCIFFIGIDIHFIWTVKFVKHQTK-NNCEVIDNILFKYIFPYVDLTLIMILPFVIMLISNILIVLKIQKVSVLRQTLHRSSTIPEPNQVGILKVKMNSISSPSRFQDDTNQISISSRNRSESQVKFFKRRQSKYSLKDKQTTSLTRMLLSVNLFFMASTAPLLIYDVIYYLIDFKEMI 327          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frpr-66.583e-725.24FMRFamide Peptide Receptor family [Source:UniProt... [more]
npr-91.421e-628.18Galanin-like G-protein coupled receptor npr-9 [So... [more]
frpr-153.148e-621.72FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-153.148e-621.72FMRFamide Peptide Receptor family [Source:UniProt... [more]
daf-379.787e-633.91G-protein coupled receptor daf-37 [Source:UniProt... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CNMaR3.939e-1625.06gene:FBgn0053696 transcript:FBtr0091684[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-1h24.21.060e-624.06si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-48... [more]
si:dkey-1h24.21.505e-624.06si:dkey-1h24.2 [Source:ZFIN;Acc:ZDB-GENE-060503-48... [more]
trhrb4.175e-624.13thyrotropin-releasing hormone receptor b [Source:Z... [more]
galr2a4.771e-628.57galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a4.771e-628.57galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q28596|TRFR_SHEEP9.767e-626.67Thyrotropin-releasing hormone receptor OS=Ovis ari... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U4002.896e-8040.69G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3W0N41.309e-7638.01G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3TQP71.866e-7641.21G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3WQM94.114e-7642.00G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3SC234.683e-7641.46G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur1a7.011e-727.83neuromedin U receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur32.279e-629.46neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002498.10.000e+099.32SMESG000002498.1[more]
SMESG000037421.11.318e-11645.22SMESG000037421.1[more]
SMESG000047150.11.327e-9747.70SMESG000047150.1[more]
SMESG000000903.18.923e-9143.66SMESG000000903.1[more]
SMESG000047150.12.063e-9048.17SMESG000047150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034676 ID=SMED30034676|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1470bp
AAATATCTTACTTTCTGTGGTCAACTATTAAATAAAACTATCGTGAAGTA
AAATGGAAATAATGTTTTCCCATTGACAAAAATACATGAATTTTTCTACA
GCAGTCAATAGCACCTTCAACCAAATCCATCCACCTGCAATTGACATTAT
TCGAAACATTTGTATTGGGGTATGGGCAATAATTGTTTTATTCGGCTTAT
TTGGCAATTGTCTGACAGTTGCTGTTTTAATATCACCAAAGTTAAACAAC
AGTAGCACAACATTCTATTTGACAGTTTTGGCCCTAATTGATATTTTATA
TTTAATATTTAGTTTAGGCGGACAAATGCTAAATTTTTCTATTTTTTTCC
CAGCAGCTCTCAGACAAAAGAATATGTTCGCCTGTATCTCGCTCAGTATG
ATTCGATTCACTCTCACTTATATTAGTGTTTGGTTACTTGTTGCTGTAGC
GATAGATCGGATGATTTGGGTCATATTTCCATTTAAAGCAAAAATGATAT
GTACACGAAAGATTGCCAAAATTATTGTCATCAGTCTTATTGCCGTGCTT
GTGTTGATAGATTTACATTTTTACTGGACTCTCAAATTCACTTACAATAA
AGGCAGTGTTAATAGCTGTGAATTGAAAGAATCTTATCGAAATCCATTTT
TATACATTGATTTAACTCTAGTAATGGGTTTACCATTTTTTGTCATGTCC
GTTGCAAATTCATTGATAATATCAAAACTTAGAGAAATGGAAAAGCTAAG
AAAAGGAATGAAGTCAACAAACCGAATTCCAAATGATTCAGTAATACCAA
ATTTGAATGCGACTTCCAAATGTTCGAATCGTAAACATGCGAAAAATAAC
AATGTTGAAGAAATAACTCCTTGTGAAATTGTCAAAAGATCCACAAGACG
AAGGTCAAGAGACAAACAAACAACAAGTCTCACTAAAATGCTGTTATCTG
TGAATATATTTTTCCTTGTCTCAACAACCCCATTATTGTCATATAATATT
CTTTTTTATGTTCCTCACATTAAAAGTTTATTGTTACAATTTGAAAATCA
ATTAACCGGTTTAATTTTTGGCATAGAGAGAATAATCTACACTTTATGGT
ATTTAAATTTTGCTGTTCATTTTCTTTTGTACTGCATGAGTGGTCCAAAA
TTTCGACAAGAAGCTATTCGACTATTGTGTAAATATTGTTTTTGTAAAGC
TTTAATATTCAATAGAATGTTGAAAATCGAAAATCGAACAGCAAATAATG
TTAATGACAGTCAGTACATGAAGACATACTGCTTAACTGAAGAAAATAAA
TATATCAAAGAATTTCAAAACACTCCAACTAAAAGTCTCTGTCCAGCTTC
CGTTGCTGGAGAACAACAGAAACTTATAACAGTCGAACTTCTTCAAGAAA
CTAGCATGTAAAATTAACATAATTTATTCTTGATTTCTTTTGAAACTGAA
ATATTTTAATGTGTTTGTTG
back to top

protein sequence of SMED30034676-orf-1

>SMED30034676-orf-1 ID=SMED30034676-orf-1|Name=SMED30034676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MNFSTAVNSTFNQIHPPAIDIIRNICIGVWAIIVLFGLFGNCLTVAVLIS
PKLNNSSTTFYLTVLALIDILYLIFSLGGQMLNFSIFFPAALRQKNMFAC
ISLSMIRFTLTYISVWLLVAVAIDRMIWVIFPFKAKMICTRKIAKIIVIS
LIAVLVLIDLHFYWTLKFTYNKGSVNSCELKESYRNPFLYIDLTLVMGLP
FFVMSVANSLIISKLREMEKLRKGMKSTNRIPNDSVIPNLNATSKCSNRK
HAKNNNVEEITPCEIVKRSTRRRSRDKQTTSLTKMLLSVNIFFLVSTTPL
LSYNILFYVPHIKSLLLQFENQLTGLIFGIERIIYTLWYLNFAVHFLLYC
MSGPKFRQEAIRLLCKYCFCKALIFNRMLKIENRTANNVNDSQYMKTYCL
TEENKYIKEFQNTPTKSLCPASVAGEQQKLITVELLQETSM*
back to top
Aliases
The feature 'G_PROTEIN_RECEP_F1_2 domain-containing protein' has the following synonyms
Synonym
gpcrP-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 25..49
score: 25.22
coord: 107..129
score: 25.74
coord: 58..79
score: 25.32
coord: 281..305
score: 22.07
coord: 330..356
score: 22.26
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 40..308
e-value: 1.5E-18
score: 67.1
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 20..364
e-value: 5.0E-47
score: 162.5
NoneNo IPR availablePANTHERPTHR46641:SF12CNMAMIDE RECEPTORcoord: 24..409
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 24..409
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 32..359
e-value: 1.14661E-31
score: 120.816
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 7..370
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 285..307
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 104..123
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..348
score: 24.745