Sphingomyelin synthase-related protein 1

Overview
NameSphingomyelin synthase-related protein 1
Smed IDSMED30034675
Length (bp)1866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sphingomyelin synthase-related protein 1 (SMED30034675) t-SNE clustered cells

Violin plots show distribution of expression levels for Sphingomyelin synthase-related protein 1 (SMED30034675) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sphingomyelin synthase-related protein 1 (SMED30034675) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sphingomyelin synthase-related protein 1 (SMED30034675) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034675

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034675SMESG000049879.1 SMESG000003119.1 dd_Smed_v4_11976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034675SMESG000049879.1 SMESG000003119.1 dd_Smed_v4_11976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034675SMESG000049879.1 SMESG000003119.1 dd_Smed_v6_11976_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30034675SMESG000003119.1 Contig41538newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30034675SMESG000003119.1 Contig41538uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:HGNC Symbol;Acc:HGNC:26320])

HSP 1 Score: 278.485 bits (711), Expect = 6.663e-87
Identity = 182/376 (48.40%), Postives = 247/376 (65.69%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDNSN------IESNKVNDISIYVRKKELSE------SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I  +V  E   N+D+        I + +  D   ++   ELS       + ++S+  Q ++ ++   +   + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  +IL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:   37 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTD---WLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 404          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:HGNC Symbol;Acc:HGNC:26320])

HSP 1 Score: 278.485 bits (711), Expect = 6.663e-87
Identity = 182/376 (48.40%), Postives = 247/376 (65.69%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDNSN------IESNKVNDISIYVRKKELSE------SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I  +V  E   N+D+        I + +  D   ++   ELS       + ++S+  Q ++ ++   +   + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  +IL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:   37 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTD---WLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 404          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:HGNC Symbol;Acc:HGNC:26320])

HSP 1 Score: 276.944 bits (707), Expect = 1.515e-85
Identity = 182/376 (48.40%), Postives = 247/376 (65.69%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDNSN------IESNKVNDISIYVRKKELSE------SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I  +V  E   N+D+        I + +  D   ++   ELS       + ++S+  Q ++ ++   +   + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  +IL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:  100 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTD---WLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 467          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Match: SGMS2 (sphingomyelin synthase 2 [Source:HGNC Symbol;Acc:HGNC:28395])

HSP 1 Score: 164.466 bits (415), Expect = 1.039e-44
Identity = 107/262 (40.84%), Postives = 157/262 (59.92%), Query Frame = 3
Query:  510 SFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQ----QRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            +F+Y   +  +T+ ++ + HER+P     PPLPD   D +  + WAF  SE+  +IL+ +W +  +F +Y+ I+ RRF  ++GT++L R +TM +T+L VPG H     KL   +Q    K+ R L +  G GLSI G    CGD++FSGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY+IDV +A+Y+++RLF +YH  AN  +L V  Q     RA  WFP+F +FE +  G+IP  F  P  +
Sbjct:   82 AFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQA---KVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNLKVSSQTNFLSRA-WWFPIFYFFEKNVQGSIPCCFSWPLSW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Match: SGMS2 (sphingomyelin synthase 2 [Source:HGNC Symbol;Acc:HGNC:28395])

HSP 1 Score: 164.466 bits (415), Expect = 1.039e-44
Identity = 107/262 (40.84%), Postives = 157/262 (59.92%), Query Frame = 3
Query:  510 SFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQ----QRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            +F+Y   +  +T+ ++ + HER+P     PPLPD   D +  + WAF  SE+  +IL+ +W +  +F +Y+ I+ RRF  ++GT++L R +TM +T+L VPG H     KL   +Q    K+ R L +  G GLSI G    CGD++FSGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY+IDV +A+Y+++RLF +YH  AN  +L V  Q     RA  WFP+F +FE +  G+IP  F  P  +
Sbjct:   82 AFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDYIDRVKWAFSVSEINGIILVGLWITQWLFLRYKSIVGRRFCFIIGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQA---KVQRILRLISGGGLSITGSHILCGDFLFSGHTVTLTLTYLFIKEYSPRHFWWYHLICWLLSAAGIICILVAHEHYTIDVIIAYYITTRLFWWYHSMANEKNLKVSSQTNFLSRA-WWFPIFYFFEKNVQGSIPCCFSWPLSW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Match: F53B1.2 (Sphingomyelin synthase-related 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20696])

HSP 1 Score: 240.736 bits (613), Expect = 3.392e-72
Identity = 171/421 (40.62%), Postives = 255/421 (60.57%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIE--MEIKVIGTRKRLVCLINKWILSEVYRE------DYANTDNSN------------IESNKVNDISI-------YVRKKE-----------LSESSVSSNIGQRLSIED----SQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIP 1271
            + N+L+   + +    + + H++DG     L ++D+ +  + I  +G  K+++  I    LS+   E       + +T N N            +E N+ N +SI         R+ E           L++SS  ++  Q +S E+     +   T  K ++KL+ +F Y  +SF +TSFVMV+ H+R+PD   YPPLPD++LDN+P+I WAF   E + ++L ++W ++L FH  R I+ RR F+LLGTVFLLR  TMLITSLSVPG HL   C+  + N T+ +K+ +A  IW  LG+S++G+R+CGDYMFSGHTT +T+++ FITEYT   +  LHTF+W+LN F +F ILAAHEHYSIDVF+AFY+SSR+FLYYH  A N++ +     R R WFP+  +FE    G + N+F +P
Sbjct:   19 VGNWLKKIGMAKYADLIAMKHKVDGKCLLALTDTDLKDPPVSINCLGDIKKILFAIE--FLSQKVVEIGNSGVHHRSTPNGNGPSLKNSKDGLLVEYNEQNHLSISGEDVYTTTRRAEIVEDEETLLDTLAKSSDGTSTVQLISREEIIRQVERPDTYFKSVAKLLIAFAYSSLSFLMTSFVMVLVHDRVPDTKTYPPLPDIVLDNVPHIPWAFDMCETIGLVLAVVWFTVLFFHNQRVIVARRMFSLLGTVFLLRCFTMLITSLSVPGIHLQ--CE-ARPNTTMQEKLHKAFHIWSNLGMSLHGVRSCGDYMFSGHTTVITMISHFITEYTPADWTGLHTFTWVLNCFAIFLILAAHEHYSIDVFIAFYISSRMFLYYHAYAYNHAGITATDYRMRTWFPLGWFFEYGSQGKVENEFSLP 434          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Match: sms-1 (Phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3D4])

HSP 1 Score: 125.561 bits (314), Expect = 2.725e-31
Identity = 81/267 (30.34%), Postives = 139/267 (52.06%), Query Frame = 3
Query:  498 KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTC-KLIKSNQTIDQKISRALEIWLGLGLSI---NGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYS--LMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            K + +FL + ++    +  +   HER P     P +   ++  +    W  +  E + +   +    +++FH++R+I+LRR   +   ++ +R +TM++T   VP       C      N T    + R +    GLGL++     +  CGDY++SGHT  L +   FI EY+ RRFY LH  SW++   G+ F++ +H HY+IDV ++++  +R+F  YH QA + S  L V++ Q    WFP+  WFE D    +P +F+ P  Y
Sbjct:   67 KTLVAFLMLVVAAAGNTITLSWIHERYPLTPPLPDIVFELIPKI---PWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTP--VPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISY 328          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Match: sms-1 (Phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3D4])

HSP 1 Score: 124.405 bits (311), Expect = 1.854e-30
Identity = 83/267 (31.09%), Postives = 138/267 (51.69%), Query Frame = 3
Query:  498 KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTC-KLIKSNQTIDQKISRALEIWLGLGLSI---NGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYS--LMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            K + +FL + ++    +  +   HER P +T   P     L       W  +  E + +   +    +++FH++R+I+LRR   +   ++ +R +TM++T   VP       C      N T    + R +    GLGL++     +  CGDY++SGHT  L +   FI EY+ RRFY LH  SW++   G+ F++ +H HY+IDV ++++  +R+F  YH QA + S  L V++ Q    WFP+  WFE D    +P +F+ P  Y
Sbjct:  130 KTLVAFLMLVVAAAGNTITLSWIHERYP-LTPPLPDIVFELIPKI--PWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTP--VPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISY 391          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Match: sms-1 (Phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3D4])

HSP 1 Score: 124.405 bits (311), Expect = 2.313e-30
Identity = 83/267 (31.09%), Postives = 138/267 (51.69%), Query Frame = 3
Query:  498 KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTC-KLIKSNQTIDQKISRALEIWLGLGLSI---NGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYS--LMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            K + +FL + ++    +  +   HER P +T   P     L       W  +  E + +   +    +++FH++R+I+LRR   +   ++ +R +TM++T   VP       C      N T    + R +    GLGL++     +  CGDY++SGHT  L +   FI EY+ RRFY LH  SW++   G+ F++ +H HY+IDV ++++  +R+F  YH QA + S  L V++ Q    WFP+  WFE D    +P +F+ P  Y
Sbjct:  144 KTLVAFLMLVVAAAGNTITLSWIHERYP-LTPPLPDIVFELIPKI--PWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTP--VPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISY 405          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Match: sms-1 (Phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3D4])

HSP 1 Score: 124.405 bits (311), Expect = 4.100e-30
Identity = 83/267 (31.09%), Postives = 138/267 (51.69%), Query Frame = 3
Query:  498 KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTC-KLIKSNQTIDQKISRALEIWLGLGLSI---NGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYS--LMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            K + +FL + ++    +  +   HER P +T   P     L       W  +  E + +   +    +++FH++R+I+LRR   +   ++ +R +TM++T   VP       C      N T    + R +    GLGL++     +  CGDY++SGHT  L +   FI EY+ RRFY LH  SW++   G+ F++ +H HY+IDV ++++  +R+F  YH QA + S  L V++ Q    WFP+  WFE D    +P +F+ P  Y
Sbjct:  184 KTLVAFLMLVVAAAGNTITLSWIHERYP-LTPPLPDIVFELIPKI--PWGLRLCENLMIGSFVSLLVLILFHRHRWIVLRRLCFIGSILYGMRCITMMVTP--VPKADEDFECSPRFGENATFSLIVMRGVWSMFGLGLNLFDNQKVVLCGDYIYSGHTLVLVVSALFIGEYSPRRFYILHWLSWLVCSVGVIFLVLSHGHYTIDVILSYFACTRVFWAYHTQAAHPSIRLSVQNHQAKEFWFPLLRWFEGDIRRPVPRRFDCPISY 445          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Fly
Match: SMSr (gene:FBgn0052380 transcript:FBtr0076870)

HSP 1 Score: 276.944 bits (707), Expect = 1.764e-84
Identity = 187/391 (47.83%), Postives = 235/391 (60.10%), Query Frame = 3
Query:  159 HINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWI----LSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLS-----------KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCK-LIKSNQTIDQ------KISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFE 1265
            H +   ++      IDG     L E D+ +M  K +G +     L   WI    L  + +   A +    IE +  N  S+Y+          SS+       E    +  C+  L            K   S  Y F+   ITS  MVI HER+PDM +YPPLPD+ LDN+P+I WAF   E+   +L  IW  +L FHKYR +LLRRFF L GTVFLLR VTMLITSLSVPGTHL  + K     +  +D       ++SRA  IW GLG+SI G+RTCGDYMFSGHT  LTLLNFFITEYT R  Y LHT +W+LN+FG+FFILAAHEHYSIDVFVAFY++SRLFLYYH  ANN +LM  D +R R+WFPMF++FES   G +PN+++
Sbjct:   72 HFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYK-LGYKLTFGELKKFWIAVLKLQLLVKNSSAESVILGIECHG-NGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSDCDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDNVPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLSVPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTVALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYYHTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYD 460          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Match: zgc:162183 (zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30])

HSP 1 Score: 273.092 bits (697), Expect = 4.240e-85
Identity = 175/398 (43.97%), Postives = 241/398 (60.55%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVS--------SNIGQRLSIEDSQMLLTCNK---DLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S  ++  +LR     E    L   H +DG +   L E D+    +E+KV+G  KRL   I +  L + Y     ++D+S +           +    L  +S+         + +G   S  + +    C +   +  K     LY  +  G+TSFVMV+ HER+PDM  YPPLPD+ LD++P I WAF  +E  AV+L  +   +L+ H++R IL RR  NL GTVFLLR VTM +TSLSVPG HL  + K+     T   K+ RALEIW GLG+S+ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RAR+WFP+F++FE +  G +PN++  PF 
Sbjct:   15 SSKQVAVWLREQGFREYVDLLCSKHRLDGPSLLCLTEKDLRSPPLELKVLGDIKRLSLAIRR--LQKHY-TTLTHSDSSALSKIDTGGTEQTLSNGYLERASIDHQHCNGTVATVGGDHSYSNGKRKSHCGRLDPEYWKTALGALYAMMVCGVTSFVMVLVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACAVVLGSMLMLVLLMHRHRSILFRRLCNLTGTVFLLRCVTMFVTSLSVPGHHLQCSGKIYGDAWT---KVQRALEIWSGLGMSLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRNWNFIHTMSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTQA--YQHSRRARVWFPLFSFFECNVLGPVPNEYCWPFP 404          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Match: zgc:162183 (zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30])

HSP 1 Score: 269.24 bits (687), Expect = 1.042e-83
Identity = 173/398 (43.47%), Postives = 236/398 (59.30%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW-----ILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQ---RLSIEDSQMLLTCNK---DLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S  ++  +LR     E    L   H +DG +   L E D+    +E+KV+G  KRL   I +       L+       +  D    E    N    Y+ +  +     +  +       S  + +    C +   +  K     LY  +  G+TSFVMV+ HER+PDM  YPPLPD+ LD++P I WAF  +E  AV+L  +   +L+ H++R IL RR  NL GTVFLLR VTM +TSLSVPG HL  + K+     T   K+ RALEIW GLG+S+ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RAR+WFP+F++FE +  G +PN++  PF 
Sbjct:   13 SSKQVAVWLREQGFREYVDLLCSKHRLDGPSLLCLTEKDLRSPPLELKVLGDIKRLSLAIRRLQKHYTTLTHSDSSALSKIDTGGTEQTLSNG---YLERASIDHQHCNGTVATVDGDHSYSNGKRKSHCGRLDPEYWKTALGALYAMMVCGVTSFVMVLVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACAVVLGSMLMLVLLMHRHRSILFRRLCNLTGTVFLLRCVTMFVTSLSVPGHHLQCSGKIYGDAWT---KVQRALEIWSGLGMSLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRNWNFIHTMSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTQA--YQHSRRARVWFPLFSFFECNVLGPVPNEYCWPFP 402          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Match: zgc:162183 (zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30])

HSP 1 Score: 269.24 bits (687), Expect = 1.042e-83
Identity = 173/398 (43.47%), Postives = 236/398 (59.30%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW-----ILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQ---RLSIEDSQMLLTCNK---DLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S  ++  +LR     E    L   H +DG +   L E D+    +E+KV+G  KRL   I +       L+       +  D    E    N    Y+ +  +     +  +       S  + +    C +   +  K     LY  +  G+TSFVMV+ HER+PDM  YPPLPD+ LD++P I WAF  +E  AV+L  +   +L+ H++R IL RR  NL GTVFLLR VTM +TSLSVPG HL  + K+     T   K+ RALEIW GLG+S+ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RAR+WFP+F++FE +  G +PN++  PF 
Sbjct:   13 SSKQVAVWLREQGFREYVDLLCSKHRLDGPSLLCLTEKDLRSPPLELKVLGDIKRLSLAIRRLQKHYTTLTHSDSSALSKIDTGGTEQTLSNG---YLERASIDHQHCNGTVATVDGDHSYSNGKRKSHCGRLDPEYWKTALGALYAMMVCGVTSFVMVLVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACAVVLGSMLMLVLLMHRHRSILFRRLCNLTGTVFLLRCVTMFVTSLSVPGHHLQCSGKIYGDAWT---KVQRALEIWSGLGMSLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRNWNFIHTMSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTQA--YQHSRRARVWFPLFSFFECNVLGPVPNEYCWPFP 402          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Match: zgc:91976 (zgc:91976 [Source:ZFIN;Acc:ZDB-GENE-041114-201])

HSP 1 Score: 163.696 bits (413), Expect = 3.996e-44
Identity = 125/403 (31.02%), Postives = 211/403 (52.36%), Query Frame = 3
Query:  114 KLMSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVI--GTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSES-SVSSNIGQRLSIEDSQMLLTCNKDLS---------KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR--ARI-WFPMFTWFESDCPGTIPNQFEIPF 1274
            +L + S + ++L    + E T  L    E DG A   L E D   + + ++   + ++L+  I     +   +    N   ++ ++N    + + +    +S   +V+      L  E  ++L+    +           K   +FLY    F +T+ ++ + HER+P   + PPLPD   D    + WAF   E+  ++L+ +W +  +  K+R I+ RRFF ++GT++L R VTM +T+L VPG H   + KL       + +  R +++  G GLSI G    CGDY++SGHT  LTL   FI EY+ RRF+  H+  W L+  G+F IL AH+HY+IDV VA+++++RLF +YH  AN  +L  +      +R+ WF  F +FE++  G +P  +++PF
Sbjct:    5 RLWTASDVSDWLSEEGMQEYTEAL---REKDGPALLQLSEQDFNTLPLSLVTGDSGRQLLERIETLRFTSHMKAHKGNNHKNSYQAN--GHVGVILANGSISNGKTVNGAPKNGLLSEPVRILIPSLSEQERTPFPTEWFKTGVAFLYALCCFLMTTVMISVVHERVPPKEETPPLPDKFFDLFDRVEWAFSICEINGMLLVGLWFTQWLLLKHRSIIGRRFFFIVGTLYLYRCVTMYVTTLPVPGMHFKCSPKLFGD---WEAQSRRVMKLMAGGGLSITGSHALCGDYLYSGHTVMLTLTYLFIKEYSPRRFWWYHSICWCLSAVGIFCILLAHDHYTIDVVVAYFMTTRLFWWYHTMANQQALKEKSSGNMFSRVWWFGPFQYFETNVRGIVPRNYQLPF 399          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Match: zgc:91976 (zgc:91976 [Source:ZFIN;Acc:ZDB-GENE-041114-201])

HSP 1 Score: 163.696 bits (413), Expect = 3.996e-44
Identity = 125/403 (31.02%), Postives = 211/403 (52.36%), Query Frame = 3
Query:  114 KLMSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVI--GTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSES-SVSSNIGQRLSIEDSQMLLTCNKDLS---------KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR--ARI-WFPMFTWFESDCPGTIPNQFEIPF 1274
            +L + S + ++L    + E T  L    E DG A   L E D   + + ++   + ++L+  I     +   +    N   ++ ++N    + + +    +S   +V+      L  E  ++L+    +           K   +FLY    F +T+ ++ + HER+P   + PPLPD   D    + WAF   E+  ++L+ +W +  +  K+R I+ RRFF ++GT++L R VTM +T+L VPG H   + KL       + +  R +++  G GLSI G    CGDY++SGHT  LTL   FI EY+ RRF+  H+  W L+  G+F IL AH+HY+IDV VA+++++RLF +YH  AN  +L  +      +R+ WF  F +FE++  G +P  +++PF
Sbjct:    5 RLWTASDVSDWLSEEGMQEYTEAL---REKDGPALLQLSEQDFNTLPLSLVTGDSGRQLLERIETLRFTSHMKAHKGNNHKNSYQAN--GHVGVILANGSISNGKTVNGAPKNGLLSEPVRILIPSLSEQERTPFPTEWFKTGVAFLYALCCFLMTTVMISVVHERVPPKEETPPLPDKFFDLFDRVEWAFSICEINGMLLVGLWFTQWLLLKHRSIIGRRFFFIVGTLYLYRCVTMYVTTLPVPGMHFKCSPKLFGD---WEAQSRRVMKLMAGGGLSITGSHALCGDYLYSGHTVMLTLTYLFIKEYSPRRFWWYHSICWCLSAVGIFCILLAHDHYTIDVVVAYFMTTRLFWWYHTMANQQALKEKSSGNMFSRVWWFGPFQYFETNVRGIVPRNYQLPF 399          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Xenopus
Match: plin1 (perilipin 1 [Source:Xenbase;Acc:XB-GENE-949442])

HSP 1 Score: 282.722 bits (722), Expect = 1.290e-88
Identity = 187/407 (45.95%), Postives = 250/407 (61.43%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINK------WILSEVYREDYANTDNSNIESNKVND----------ISIYVRKKELSESSVSS----NIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIF 1289
            +  +LR     +    L   H +DG A   L E D+    +EIKV+G  KRL+  I K       +L E+     + T + +I +   +D           + +VR   + +   S+    N  +RL  E  +  ++C           +YVFI FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +EM  V+L  IW  +L+ HK+R ILLRR  +L+GTVFLLR VTM +TSLSVPG HL  + KL  +   I  K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PN++  PF   +F
Sbjct:   16 VAKWLREEGFCDYVDMLCNHHRLDGTALLALTEYDLRSPPLEIKVLGDIKRLMLSIRKLQKQHAGVLEELGLNTESQTGSLSISATPNSDWLCNGELSQEYNGHVRDSGMDQHQYSNGKHKNPAKRLDPEYWKTAISC-----------VYVFIVFGFTSFVMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEMCGVVLCYIWMLVLLLHKHRSILLRRLCSLMGTVFLLRCVTMFVTSLSVPGEHLQCSGKLYDN---IWAKLQRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVRGPVPNEYCWPFSRPVF 406          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Xenopus
Match: plin1 (perilipin 1 [Source:Xenbase;Acc:XB-GENE-949442])

HSP 1 Score: 282.722 bits (722), Expect = 1.759e-88
Identity = 187/407 (45.95%), Postives = 250/407 (61.43%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINK------WILSEVYREDYANTDNSNIESNKVND----------ISIYVRKKELSESSVSS----NIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIF 1289
            +  +LR     +    L   H +DG A   L E D+    +EIKV+G  KRL+  I K       +L E+     + T + +I +   +D           + +VR   + +   S+    N  +RL  E  +  ++C           +YVFI FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +EM  V+L  IW  +L+ HK+R ILLRR  +L+GTVFLLR VTM +TSLSVPG HL  + KL  +   I  K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PN++  PF   +F
Sbjct:   25 VAKWLREEGFCDYVDMLCNHHRLDGTALLALTEYDLRSPPLEIKVLGDIKRLMLSIRKLQKQHAGVLEELGLNTESQTGSLSISATPNSDWLCNGELSQEYNGHVRDSGMDQHQYSNGKHKNPAKRLDPEYWKTAISC-----------VYVFIVFGFTSFVMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEMCGVVLCYIWMLVLLLHKHRSILLRRLCSLMGTVFLLRCVTMFVTSLSVPGEHLQCSGKLYDN---IWAKLQRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVRGPVPNEYCWPFSRPVF 415          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Xenopus
Match: tsfm (Ts translation elongation factor, mitochondrial [Source:Xenbase;Acc:XB-GENE-964861])

HSP 1 Score: 157.147 bits (396), Expect = 4.772e-42
Identity = 103/265 (38.87%), Postives = 153/265 (57.74%), Query Frame = 3
Query:  498 KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR---ARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            K   +F+Y F +  +T+ ++ + HER+P     PPLPD   D +  +SWAF  SE+  +IL+ +W+   +F +Y+ I+ RRFF ++GT++L R +TM +T+L VPG H     KL   +    Q+I R +    G GLSI G    CGD+++SGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY++DV VA+Y+++RLF +YH  AN   L             WFP+F +FE +    IP  +  P  +
Sbjct:   78 KTGVAFIYAFFNMVLTTVMITVVHERVPPKEVSPPLPDKFFDYVSRVSWAFSVSEITGMILVALWTVQWVFLRYKSIVGRRFFFIIGTLYLYRCITMYVTTLPVPGVHFQCAPKLHGDSYAQLQRILRLIS---GGGLSITGSHILCGDFLYSGHTVILTLTYLFIKEYSPRHFWWYHLICWLLSAAGVICILVAHEHYTVDVIVAYYVTTRLFWWYHTMANEKCLKTSSPTNLLTRTWWFPVFLFFEKNVQACIPCSYSWPISW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Xenopus
Match: slc38a5 (solute carrier family 38 member 5 [Source:Xenbase;Acc:XB-GENE-5856213])

HSP 1 Score: 155.992 bits (393), Expect = 3.791e-41
Identity = 124/392 (31.63%), Postives = 202/392 (51.53%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTR--KRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIY-VRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARI-----WFPMFTWFESDCPGTIPNQFEIP 1271
            S  ++ N+L    + E +  L     + G A   LKE D  +  +  + +   + L+ +I    +     E      N ++ S K + +  Y   KK    +  S ++ Q + + + +       +  K + +FLY    F  T+ ++ + HER+P  T+  PLPD+  D    + WAF   E+  +IL+ +W    I  K++ I+ RRFF ++GT++L R +TM +T+L VPG H + + KL    +   ++I + L    G GLSI G  T CGDY++SGHT  LTL   FI EY+S R +  H   W L+  G+F IL AH+HY++DV VA+Y++SR F +YH  AN   L  +++  A +     W+  F +FE +  G +P   + P
Sbjct:   16 SPDQVANWLTERGLQEYSDTL---KSLSGKALLMLKEDDFKKPPLSRVSSDNGRHLLEMIEILKIEHHIEEHKNGHANGHLCSKKDHPVGDYGFPKKNGIPNGFSKDMIQ-IPLPEPERNQPFPDEWGKTLIAFLYALCCFIFTTVMISVVHERVPSKTEEAPLPDVFFDYFDRVQWAFSICEINGMILVGVWLCQWILLKHKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGMHFNCSPKLFGKWEAQTRRILKMLA---GGGLSITGSHTLCGDYLYSGHTVMLTLTYMFIKEYSSPRLWLYHWICWFLSCVGIFCILLAHDHYTVDVVVAYYITSRSFWWYHTMANQQVL--KEESSANLLSRVWWYRPFQYFERNVVGIVPYTMQWP 398          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Match: Samd8 (sterile alpha motif domain containing 8 [Source:MGI Symbol;Acc:MGI:1914880])

HSP 1 Score: 278.1 bits (710), Expect = 5.088e-87
Identity = 181/373 (48.53%), Postives = 241/373 (64.61%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDN---------SNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I ++V  E   N+D+         S ++S             +     +SS+  Q ++ ++       + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  VIL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +      +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:   37 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMSPMTPFLSALQSADWLCNGEPTHSCDGPIPDLSSDQYQYMNGKNKHSARRLDPEYWKTILSCVYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGVILCYIWILVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLRRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YHQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 404          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Match: Samd8 (sterile alpha motif domain containing 8 [Source:MGI Symbol;Acc:MGI:1914880])

HSP 1 Score: 277.715 bits (709), Expect = 5.684e-86
Identity = 182/375 (48.53%), Postives = 244/375 (65.07%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDN---------SNIESNK--VNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I ++V  E   N+D+         S ++S     N    +     + +  +SS+  Q ++ ++       + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  VIL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +      +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:  100 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMSPMTPFLSALQSADWLCNGEPTHSCDGPIPD--LSSDQYQYMNGKNKHSARRLDPEYWKTILSCVYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGVILCYIWILVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLRRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YHQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 467          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Match: Sgms2 (sphingomyelin synthase 2 [Source:MGI Symbol;Acc:MGI:1921692])

HSP 1 Score: 163.31 bits (412), Expect = 2.013e-44
Identity = 107/262 (40.84%), Postives = 157/262 (59.92%), Query Frame = 3
Query:  510 SFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQ----QRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            +F+Y   +  +T+ ++ + HER+P     PPLPD   D    + WAF  SE+  ++L+ +W +  +F +Y+ I+ RRFF ++GT++L R +TM +T+L VPG H     KL   +Q    KI R L +  G GLSI G    CGD++FSGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY++DV +A+Y+++RLF +YH  AN  +L V  Q     RA  WFP+F +FE +  G+IP  F  P  +
Sbjct:   82 AFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDYFDRVKWAFSVSEINGMVLVGLWITQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQA---KIQRILRLISGGGLSITGSHILCGDFLFSGHTVVLTLTYLFIKEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNLKVSSQTNFLSRA-WWFPIFYFFEKNVQGSIPCCFSWPLSW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Match: Sgms2 (sphingomyelin synthase 2 [Source:MGI Symbol;Acc:MGI:1921692])

HSP 1 Score: 163.31 bits (412), Expect = 2.013e-44
Identity = 107/262 (40.84%), Postives = 157/262 (59.92%), Query Frame = 3
Query:  510 SFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQ----QRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            +F+Y   +  +T+ ++ + HER+P     PPLPD   D    + WAF  SE+  ++L+ +W +  +F +Y+ I+ RRFF ++GT++L R +TM +T+L VPG H     KL   +Q    KI R L +  G GLSI G    CGD++FSGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY++DV +A+Y+++RLF +YH  AN  +L V  Q     RA  WFP+F +FE +  G+IP  F  P  +
Sbjct:   82 AFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDYFDRVKWAFSVSEINGMVLVGLWITQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQA---KIQRILRLISGGGLSITGSHILCGDFLFSGHTVVLTLTYLFIKEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNLKVSSQTNFLSRA-WWFPIFYFFEKNVQGSIPCCFSWPLSW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Match: Sgms1 (sphingomyelin synthase 1 [Source:MGI Symbol;Acc:MGI:2444110])

HSP 1 Score: 159.458 bits (402), Expect = 1.628e-42
Identity = 114/325 (35.08%), Postives = 175/325 (53.85%), Query Frame = 3
Query:  330 DYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR--ARI-WFPMFTWFESDCPGTIPNQFEIPFKYLIFY 1292
            D  N D S     K N +    RK+ +               E SQ  +    +  K   +FLY    F +T+ ++ + HER+P     PPLPD   D+   + WAF   E+  +IL+ +W    +  KY+ I+ RRFF ++GT++L R +TM +T+L VPG H + + KL       + ++ R +++  G GLSI G    CGDY++SGHT  LTL   FI EY+ RR +  H   W+L++ G+F IL AH+HY++DV VA+Y+++RLF +YH  AN   L    Q    AR+ W+  F +FE +  G +P  +  PF + + +
Sbjct:   96 DIPNPDGSFSIKTKPNGMPNGFRKEMIKIPMPEP--------ERSQYPM----EWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGLWLFQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGMHFNCSPKLFGD---WEAQVRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYSPRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEASQMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVH 405          
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Match: sp|Q96LT4|SAMD8_HUMAN (Sphingomyelin synthase-related protein 1 OS=Homo sapiens OX=9606 GN=SAMD8 PE=1 SV=2)

HSP 1 Score: 278.485 bits (711), Expect = 3.200e-86
Identity = 182/376 (48.40%), Postives = 247/376 (65.69%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDNSN------IESNKVNDISIYVRKKELSE------SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I  +V  E   N+D+        I + +  D   ++   ELS       + ++S+  Q ++ ++   +   + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  +IL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:   37 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHIDVLEEMGYNSDSPMGSMTPFISALQSTD---WLCNGELSHDCDGPITDLNSDQYQYMNGKNKHSVRRLDPEYWKTILSCIYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLHRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 404          
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9DA37|SAMD8_MOUSE (Sphingomyelin synthase-related protein 1 OS=Mus musculus OX=10090 GN=Samd8 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.976e-85
Identity = 182/375 (48.53%), Postives = 244/375 (65.07%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW--ILSEVYREDYANTDN---------SNIESNK--VNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            H +DGI    L E D+    +EIKV+G  KRL+  + K   I ++V  E   N+D+         S ++S     N    +     + +  +SS+  Q ++ ++       + +  K I S +YVFI FG TSF+MVI HER+PDM  YPPLPD+ LD++P I WAF  +E+  VIL  IW  +L+ HK+R ILLRR  +L+GTVFLLR  TM +TSLSVPG HL  T K+  S   + +K+ RA  IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  LHT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +      +RARIWFPMF++FE +  GT+PN++  PF
Sbjct:  100 HRLDGITLLTLTEYDLRSPPLEIKVLGDIKRLMLSVRKLQKIHTDVLEEMGYNSDSPMSPMTPFLSALQSADWLCNGEPTHSCDGPIPD--LSSDQYQYMNGKNKHSARRLDPEYWKTILSCVYVFIVFGFTSFIMVIVHERVPDMQTYPPLPDIFLDSVPRIPWAFSMTEVCGVILCYIWILVLLLHKHRSILLRRLCSLMGTVFLLRCFTMFVTSLSVPGQHLQCTGKIYGS---VWEKLRRAFAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFLHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YHQSRRARIWFPMFSFFECNVNGTVPNEYCWPF 467          
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9VS60|SMSR1_DROME (Sphingomyelin synthase-related 1 OS=Drosophila melanogaster OX=7227 GN=SMSr PE=1 SV=2)

HSP 1 Score: 276.944 bits (707), Expect = 1.768e-83
Identity = 187/391 (47.83%), Postives = 235/391 (60.10%), Query Frame = 3
Query:  159 HINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWI----LSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLS-----------KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCK-LIKSNQTIDQ------KISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFE 1265
            H +   ++      IDG     L E D+ +M  K +G +     L   WI    L  + +   A +    IE +  N  S+Y+          SS+       E    +  C+  L            K   S  Y F+   ITS  MVI HER+PDM +YPPLPD+ LDN+P+I WAF   E+   +L  IW  +L FHKYR +LLRRFF L GTVFLLR VTMLITSLSVPGTHL  + K     +  +D       ++SRA  IW GLG+SI G+RTCGDYMFSGHT  LTLLNFFITEYT R  Y LHT +W+LN+FG+FFILAAHEHYSIDVFVAFY++SRLFLYYH  ANN +LM  D +R R+WFPMF++FES   G +PN+++
Sbjct:   72 HFSRTLLDCLRQEAIDGEVLLSLTEEDVRDMRYK-LGYKLTFGELKKFWIAVLKLQLLVKNSSAESVILGIECHG-NGNSVYMPLASTGCGPPSSSTCPCPQAECPSYVSDCDTYLRMGGRYVPPEYFKTAMSLGYSFVVTWITSLTMVIVHERVPDMKRYPPLPDIFLDNVPHIPWAFNMCEITGSLLFTIWVVVLTFHKYRLVLLRRFFALAGTVFLLRCVTMLITSLSVPGTHLQCSQKDFAIDDPNVDMVGALIIRMSRAYRIWSGLGMSIQGVRTCGDYMFSGHTVALTLLNFFITEYTPRNLYFLHTLTWLLNMFGIFFILAAHEHYSIDVFVAFYITSRLFLYYHTLANNRALMQSDSKRTRVWFPMFSYFESSVDGMVPNEYD 460          
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Match: sp|Q20696|SMSR1_CAEEL (Sphingomyelin synthase-related 1 OS=Caenorhabditis elegans OX=6239 GN=F53B1.2 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.314e-71
Identity = 171/421 (40.62%), Postives = 255/421 (60.57%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIE--MEIKVIGTRKRLVCLINKWILSEVYRE------DYANTDNSN------------IESNKVNDISI-------YVRKKE-----------LSESSVSSNIGQRLSIED----SQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIP 1271
            + N+L+   + +    + + H++DG     L ++D+ +  + I  +G  K+++  I    LS+   E       + +T N N            +E N+ N +SI         R+ E           L++SS  ++  Q +S E+     +   T  K ++KL+ +F Y  +SF +TSFVMV+ H+R+PD   YPPLPD++LDN+P+I WAF   E + ++L ++W ++L FH  R I+ RR F+LLGTVFLLR  TMLITSLSVPG HL   C+  + N T+ +K+ +A  IW  LG+S++G+R+CGDYMFSGHTT +T+++ FITEYT   +  LHTF+W+LN F +F ILAAHEHYSIDVF+AFY+SSR+FLYYH  A N++ +     R R WFP+  +FE    G + N+F +P
Sbjct:   19 VGNWLKKIGMAKYADLIAMKHKVDGKCLLALTDTDLKDPPVSINCLGDIKKILFAIE--FLSQKVVEIGNSGVHHRSTPNGNGPSLKNSKDGLLVEYNEQNHLSISGEDVYTTTRRAEIVEDEETLLDTLAKSSDGTSTVQLISREEIIRQVERPDTYFKSVAKLLIAFAYSSLSFLMTSFVMVLVHDRVPDTKTYPPLPDIVLDNVPHIPWAFDMCETIGLVLAVVWFTVLFFHNQRVIVARRMFSLLGTVFLLRCFTMLITSLSVPGIHLQ--CE-ARPNTTMQEKLHKAFHIWSNLGMSLHGVRSCGDYMFSGHTTVITMISHFITEYTPADWTGLHTFTWVLNCFAIFLILAAHEHYSIDVFIAFYISSRMFLYYHAYAYNHAGITATDYRMRTWFPLGWFFEYGSQGKVENEFSLP 434          
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Match: sp|Q4JM44|SMS2_RAT (Phosphatidylcholine:ceramide cholinephosphotransferase 2 OS=Rattus norvegicus OX=10116 GN=Sgms2 PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 4.938e-44
Identity = 107/262 (40.84%), Postives = 158/262 (60.31%), Query Frame = 3
Query:  510 SFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQ----QRARIWFPMFTWFESDCPGTIPNQFEIPFKY 1280
            +F+Y   +  +T+ ++ + HER+P     PPLPD   D +  + WAF  SE+  ++L+ +W +  +F +Y+ I+ RRFF ++GT++L R +TM +T+L VPG H     KL   +Q    KI R L +  G GLSI G    CGD++FSGHT  LTL   FI EY+ R F+  H   W+L+  G+  IL AHEHY++DV +A+Y+++RLF +YH  AN  +L V  Q     RA  WFP+F +FE +  G+IP  F  P  +
Sbjct:   82 AFVYALFNLILTTVMITVVHERVPPKELSPPLPDKFFDYVDRVKWAFSVSEINGMVLVGLWLTQWLFLRYKSIVGRRFFFIMGTLYLYRCITMYVTTLPVPGMHFQCAPKLNGDSQA---KIQRILRLLSGGGLSITGSHILCGDFLFSGHTVVLTLTYLFIKEYSPRHFWWYHLVCWLLSAAGIICILVAHEHYTVDVIIAYYITTRLFWWYHSMANEKNLKVSSQTNFLSRA-WWFPIFYFFEKNVQGSIPCCFSWPLSW 339          
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Match: A0A5J4P421 (SAM domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0009666 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 2.669e-104
Identity = 215/414 (51.93%), Postives = 272/414 (65.70%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIE--SNKVNDISIYVRKKELSESSVSSNIGQRL---------SIEDSQMLLTCNKDLS-----------------KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIK-SNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S +++  +LR + ++E  I+ F  H IDG++F  L E D+ EM I  +  RKRLV L   W      R     + N+ +   S+  NDI+      + +  + S  +   L         +       L C +D S                 K+  S LY FI  GIT+FVMVIAHERLPDM+KYPPLPDL+LDNLP+I+WAF+A+E V V+L+ +W  IL FH+YR ILLRRFF L GTVFLLRS+TMLITSLSVPG HL   C   + +NQT   + +R LEIWLGLG+SI GI TCGDYMFSGHTTCLTLLNFFITEY+ RR   LHTFSW+LNLFG+FFI+A+HEHYSIDVFVA Y++SRLFLYYH  ANN  L   D++RA IWFP+F++FE D  G +PN +E+PF+
Sbjct:    7 SFAEVCAFLRKHKVSEFVISKFEMHAIDGLSFCLLTEQDLREMHISSVSQRKRLVFLAASW------RRTVERSFNNQLSPLSDLFNDINCDRLAAKCTYPTTSDGLLSSLLDCSEYNCYATSGDSTDLVCARDSSDNDKLPYDPVEPHPHMWKVFVSALYAFIVAGITAFVMVIAHERLPDMSKYPPLPDLLLDNLPHITWAFKAAEWVGVLLMFMWIIILFFHRYRQILLRRFFALTGTVFLLRSITMLITSLSVPGRHLTEHCTPYEFANQT--ARFNRVLEIWLGLGMSIRGIHTCGDYMFSGHTTCLTLLNFFITEYSPRRIQLLHTFSWVLNLFGVFFIMASHEHYSIDVFVAVYVTSRLFLYYHCLANNRILHQADKKRALIWFPLFSFFEYDVNGIVPNVYELPFR 412          
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Match: A0A183TPJ5 (SAM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS18393 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 6.075e-103
Identity = 204/407 (50.12%), Postives = 275/407 (67.57%), Query Frame = 3
Query:  144 YLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIES--NKVNDISIYV---------RKKELSESSVSSNI--GQRLSIEDSQMLLTC-------------NKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLI 1286
            +L+         +LF  H IDG +F  L E+D+ EM I+ IG RKR++ LI++W     Y +         I S     ND+++           R +  S+ + +S++  G+R+S+ +  +   C             N  L K+  S  Y   +F ITSFVMV+ HERLPDM+KYPPLPD++LDNLPYI WAF+A+E+VAV LL IW ++L FH++RFILLRR+ +LLGTVFLLRSVTM ITSLS PG HL + C+    + +  +++ RA EI+ GLG+++ G+RTCGDY+FSGHT  +T+LNFFITEYT   F+ LHTF+WILN+FG+FFILAAHEHYSIDVFVA Y++SRLFLYYHW ANN  LM +D+QRARIWFP+F +FES+  G++P +F  PF  L+
Sbjct:   21 WLKECGFKAPLCDLFEQHAIDGESFGLLNENDLREMGIEQIGLRKRILFLIDQW---RSYVKHQKPQSPGEIPSLVGPTNDLTVATHVRPFAPNSRIRTKSDRTYNSSLAYGERVSLFERPVAYRCLSSQSESYSVCENNPKLWKVAVSAFYAMFAFSITSFVMVLVHERLPDMSKYPPLPDILLDNLPYIPWAFEAAEVVAVALLAIWLAVLAFHRHRFILLRRYCSLLGTVFLLRSVTMFITSLSAPGRHLSTECRPFVFH-SFSERLLRAAEIFFGLGMTLRGVRTCGDYIFSGHTAVITMLNFFITEYTPANFHPLHTFTWILNVFGVFFILAAHEHYSIDVFVAVYITSRLFLYYHWLANNQFLMRQDKQRARIWFPLFAFFESESRGSVPPEFSNPFDGLL 423          
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Match: A0A0X3PU73 (SAM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR114585 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 6.342e-103
Identity = 204/407 (50.12%), Postives = 275/407 (67.57%), Query Frame = 3
Query:  144 YLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIES--NKVNDISIYV---------RKKELSESSVSSNI--GQRLSIEDSQMLLTC-------------NKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLI 1286
            +L+         +LF  H IDG +F  L E+D+ EM I+ IG RKR++ LI++W     Y +         I S     ND+++           R +  S+ + +S++  G+R+S+ +  +   C             N  L K+  S  Y   +F ITSFVMV+ HERLPDM+KYPPLPD++LDNLPYI WAF+A+E+VAV LL IW ++L FH++RFILLRR+ +LLGTVFLLRSVTM ITSLS PG HL + C+    + +  +++ RA EI+ GLG+++ G+RTCGDY+FSGHT  +T+LNFFITEYT   F+ LHTF+WILN+FG+FFILAAHEHYSIDVFVA Y++SRLFLYYHW ANN  LM +D+QRARIWFP+F +FES+  G++P +F  PF  L+
Sbjct:   21 WLKECGFKAPLCDLFEQHAIDGESFGLLNENDLREMGIEQIGLRKRILFLIDQW---RSYVKHQKPQSPGEIPSLVGPTNDLTVATHVRPFAPNSRIRTKSDRTYNSSLAYGERVSLFERPVAYRCLSSQSESYSVCENNPKLWKVAVSAFYAMFAFSITSFVMVLVHERLPDMSKYPPLPDILLDNLPYIPWAFEAAEVVAVALLAIWLAVLAFHRHRFILLRRYCSLLGTVFLLRSVTMFITSLSAPGRHLSTECRPFVFH-SFSERLLRAAEIFFGLGMTLRGVRTCGDYIFSGHTAVITMLNFFITEYTPANFHPLHTFTWILNVFGVFFILAAHEHYSIDVFVAVYITSRLFLYYHWLANNQFLMRQDKQRARIWFPLFAFFESESRGSVPPEFSNPFDGLL 423          
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Match: A0A182ZZV8 (SAM domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS243 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.264e-102
Identity = 207/410 (50.49%), Postives = 269/410 (65.61%), Query Frame = 3
Query:   96 LKVDL*KLMSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYRE-----------DYANTDNSNIESNKVNDISI----YVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIK-SNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            L +D   L+S   ++ YL  + + E  +    TH+IDG+AF  L + D++E+ I  +G RKR++        S  YR               N  NS +  N+     +    Y +    +    S      +  + ++ ++  N    K++ S LY+F+  GITSFVMVIAHERLPD++KYPPLPDL+LDN+PYI WAF+A+E V V+L ++W+ ILIFH+YR ILLRRFF + GTVFLLR VTM+ TSLSVPG HL   C      N T+  +  R LEIWLG+G+SI GI+TCGDYMFSGHTT LTLLNFFITEY+ R    +HTFSW+LNLFG+FFILA+HEHYSIDVFVA Y+SSRLFLYYH  ANN  L   D+ RA IWFP+FT+FE D  G +PN++EIPF+
Sbjct:    6 LTLDSPALLSTQGVQEYLCKHGVTEANLQSIRTHQIDGVAFCLLSDKDLLEIGITCVGQRKRIL------FASAQYRSFVMNNFNGHLFGVRNLKNSEMFDNESGKTQVFDFCYSKHNGCASRGDSPGFWSEVHHDSAEHVVETNPKPWKVLVSALYLFLVAGITSFVMVIAHERLPDISKYPPLPDLLLDNIPYIDWAFEAAEWVGVVLGLVWAVILIFHRYRCILLRRFFAISGTVFLLRCVTMISTSLSVPGEHLAEQCTPKAFINNTV--RFHRFLEIWLGMGMSIRGIQTCGDYMFSGHTTMLTLLNFFITEYSPRNIQVIHTFSWVLNLFGVFFILASHEHYSIDVFVAIYVSSRLFLYYHCLANNRILHQEDKNRAMIWFPLFTFFEYDVCGIVPNEYEIPFR 407          
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Match: A0A0R3W5F1 (SAM domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5345 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.879e-100
Identity = 193/378 (51.06%), Postives = 262/378 (69.31%), Query Frame = 3
Query:  144 YLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            +L +  ++ ET  LF  H IDG  F+ L  +D+ EM +  +G  KRL+ LI  W      R  +  +  S +     +D+      +     SVS              +   +  + K+I S +Y F+S G+TSFVMV+AHERLPD++KYPPLPD++LDNLPYI WAF+A+E++AV L  IW ++L FHK+R IL RRF +LLGTVFLLRSVTM+ITSLSVPG HL + C+     ++  ++ +RA EIW G+G+++ G+RTCGDYMFSGHTT +T+LNFFITEYTS R  +LH F+W+LN+FG+FFILAAHEHYSIDVF+A Y++SRLFLYYHWQANN  L+  D++RA+IWFP+ T+FESD  G +P++F  P +
Sbjct:   22 WLESQGVDAETRLLFEQHMIDGFTFSMLTINDLREMGVVKMGILKRLLFLIETW------RSRHQTSCCSCLSFPSEHDLDCPHYCESCRPFSVSP-------------ICELSPKIWKVIVSAIYAFLSLGVTSFVMVLAHERLPDISKYPPLPDILLDNLPYIPWAFEAAELIAVCLCFIWFTVLFFHKHRLILFRRFCSLLGTVFLLRSVTMIITSLSVPGKHLLTECRPF-VYESYRERFARAAEIWFGMGMTLRGVRTCGDYMFSGHTTVITMLNFFITEYTSCRLNRLHNFTWVLNVFGVFFILAAHEHYSIDVFIAIYITSRLFLYYHWQANNQHLLQCDKRRAQIWFPLLTFFESDVHGMVPHEFSNPLR 379          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:NCBI gene;Acc:103041834])

HSP 1 Score: 270.781 bits (691), Expect = 2.005e-84
Identity = 174/391 (44.50%), Postives = 244/391 (62.40%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWIL--SEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDS---QMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            S+ ++  +LR     +    L   H +DG +   L E D+    +E+KV+G  KRL+  + K     ++V  E   + D  + +     +           +S V S +G++    +    Q     + +  K + S +YV   FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   +IL  IW  +L+ HK+R ILLRR  +L+GTVF+LR +TM +TSLSVPG HL  T K+      +  K+ RA+ IW G G+++ G++TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PN++  PF
Sbjct:   10 SVKQVGRWLREEGFCDYVDLLCNKHRLDGTSLLTLTEYDLRSPPLELKVLGDIKRLMVSLRKLQKQNADVLEELGFSHDAHSPQGGAGAEWLCNGESVRDCDSVVDSLVGEQYQYSNGKHKQQSRRLDPEYWKTVLSSIYVVFVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGLILCNIWLLVLLLHKHRSILLRRMCSLMGTVFMLRCITMFVTSLSVPGQHLQCTGKMYGD---MWAKLQRAVAIWSGFGMTLTGVKTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFIHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQHSRRARIWFPMFSFFECNVNGPVPNEYCWPF 395          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Match: zgc:162183 (sphingomyelin synthase-related protein 1-like [Source:NCBI gene;Acc:103037475])

HSP 1 Score: 265.003 bits (676), Expect = 3.918e-82
Identity = 170/396 (42.93%), Postives = 242/396 (61.11%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSES-------SVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFIS--FGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S  ++  +L+     E    L V H +DG     L E+D+    +++ ++G  KRL   + +      +   +++T N    SN       +       +        SV    G R    + +    C  +      + ++V++S  FG+TSF+MV+ HE++PD+  YPPLPD+ LD++P I WAF  +E  AVIL  I    L+ HK+R IL RR  +L+GTVFLLR VTM +TSLSVPG HL  + K+      I  K+ RA+EIW GLG+S+ G+ TCGDYMFSGHT  LT+LNFFITEYT R+++ +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  ++  +L  +  +RARIWFP+F++ E +  G +PNQ+  PF 
Sbjct:   11 SCEQVSVWLKKEGFGEYVNLLCVKHRLDGAGLLSLTENDLRSPPLQLPLLGDIKRLTLALQRLQRQHTHSHTHSHTTNGVCLSNAPGPERRFCNGGVTGDGNGVATALSVVGEGGCR-GYSNGKCKRHCRLEPESWKTALIFVYVSLVFGMTSFIMVLVHEKVPDIHTYPPLPDIFLDSVPRIPWAFAMAEACAVILGCILLLTLLLHKHRCILFRRLCSLMGTVFLLRCVTMFVTSLSVPGRHLQCSGKVYGD---IWVKLRRAVEIWAGLGMSLTGVHTCGDYMFSGHTIVLTMLNFFITEYTPRKWHLVHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLSSTPAL--QHSRRARIWFPLFSFSECNVNGPVPNQYAWPFP 400          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Match: zgc:162183 (sphingomyelin synthase-related protein 1-like [Source:NCBI gene;Acc:103037475])

HSP 1 Score: 263.848 bits (673), Expect = 5.990e-81
Identity = 169/393 (43.00%), Postives = 241/393 (61.32%), Query Frame = 3
Query:  132 KIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSES-------SVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFIS--FGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            ++  +L+     E    L V H +DG     L E+D+    +++ ++G  KRL   + +      +   +++T N    SN       +       +        SV    G R    + +    C  +      + ++V++S  FG+TSF+MV+ HE++PD+  YPPLPD+ LD++P I WAF  +E  AVIL  I    L+ HK+R IL RR  +L+GTVFLLR VTM +TSLSVPG HL  + K+      I  K+ RA+EIW GLG+S+ G+ TCGDYMFSGHT  LT+LNFFITEYT R+++ +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  ++  +L  +  +RARIWFP+F++ E +  G +PNQ+  PF 
Sbjct:   67 QVSVWLKKEGFGEYVNLLCVKHRLDGAGLLSLTENDLRSPPLQLPLLGDIKRLTLALQRLQRQHTHSHTHSHTTNGVCLSNAPGPERRFCNGGVTGDGNGVATALSVVGEGGCR-GYSNGKCKRHCRLEPESWKTALIFVYVSLVFGMTSFIMVLVHEKVPDIHTYPPLPDIFLDSVPRIPWAFAMAEACAVILGCILLLTLLLHKHRCILFRRLCSLMGTVFLLRCVTMFVTSLSVPGRHLQCSGKVYGD---IWVKLRRAVEIWAGLGMSLTGVHTCGDYMFSGHTIVLTMLNFFITEYTPRKWHLVHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLSSTPAL--QHSRRARIWFPLFSFSECNVNGPVPNQYAWPFP 453          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Match: zgc:91976 (phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:NCBI gene;Acc:103044873])

HSP 1 Score: 156.377 bits (394), Expect = 1.812e-41
Identity = 128/401 (31.92%), Postives = 208/401 (51.87%), Query Frame = 3
Query:  117 LMSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEI-KVIG-------TRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDI--SIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR--ARI-WFPMFTWFESDCPGTIPNQFEIPFK 1277
            L S+ ++  +L +  + E +  L     +DG A   L ESD     + +V G        R   + + N   + +  +   ++  N ++     N    +  +R  E      S  +   + +       +   + SK   +FLY    F  TS V+ + HER+P   + PPLPD   D    + WAF   E+  ++L+ +W    +  K+R I+ RRFF ++GT++L R VTM +T+L VPG H   + KL+ +    + ++ R L++  G GLSI G  + CGDY++SGHT  LTL   FI EY+ RRF+  H F   L+  G+FFIL AH+HY++DV VA+++++RLF +YH  AN   L  + Q    +R+ WF +F +FE +  G +P  +++P  
Sbjct:    7 LWSVEEVSEWLVDQGMTEYSEAL---RNVDGRALLQLSESDFRSPPLSRVTGDNGHQLLERVETLRIANHMEVHKNGKHGSSHHTNGHVSITIGNGAISNGKIRNVEPKNGFHSEPVQIHIPLPPEHERTSFPTEWSKTGVAFLYAVCCFVTTSVVISVVHERVPTKEESPPLPDKFFDVFDRVQWAFSICEINGMLLVSMWLIQWLLLKHRAIVGRRFFFIVGTLYLYRCVTMYVTTLPVPGMHFKCSPKLVGN---YEAQLWRILKMISGGGLSITGSHSMCGDYLYSGHTVMLTLTYLFIKEYSPRRFWWYHCFCLGLSAVGIFFILLAHDHYTVDVVVAYFITTRLFWWYHTMANQQILKQKSQGNTFSRVWWFFLFQYFEQNVQGIVPRNYQLPLP 401          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Match: zgc:91976 (phosphatidylcholine:ceramide cholinephosphotransferase 1 [Source:NCBI gene;Acc:103044873])

HSP 1 Score: 156.377 bits (394), Expect = 1.943e-41
Identity = 128/401 (31.92%), Postives = 208/401 (51.87%), Query Frame = 3
Query:  117 LMSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEI-KVIG-------TRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDI--SIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQR--ARI-WFPMFTWFESDCPGTIPNQFEIPFK 1277
            L S+ ++  +L +  + E +  L     +DG A   L ESD     + +V G        R   + + N   + +  +   ++  N ++     N    +  +R  E      S  +   + +       +   + SK   +FLY    F  TS V+ + HER+P   + PPLPD   D    + WAF   E+  ++L+ +W    +  K+R I+ RRFF ++GT++L R VTM +T+L VPG H   + KL+ +    + ++ R L++  G GLSI G  + CGDY++SGHT  LTL   FI EY+ RRF+  H F   L+  G+FFIL AH+HY++DV VA+++++RLF +YH  AN   L  + Q    +R+ WF +F +FE +  G +P  +++P  
Sbjct:    6 LWSVEEVSEWLVDQGMTEYSEAL---RNVDGRALLQLSESDFRSPPLSRVTGDNGHQLLERVETLRIANHMEVHKNGKHGSSHHTNGHVSITIGNGAISNGKIRNVEPKNGFHSEPVQIHIPLPPEHERTSFPTEWSKTGVAFLYAVCCFVTTSVVISVVHERVPTKEESPPLPDKFFDVFDRVQWAFSICEINGMLLVSMWLIQWLLLKHRAIVGRRFFFIVGTLYLYRCVTMYVTTLPVPGMHFKCSPKLVGN---YEAQLWRILKMISGGGLSITGSHSMCGDYLYSGHTVMLTLTYLFIKEYSPRRFWWYHCFCLGLSAVGIFFILLAHDHYTVDVVVAYFITTRLFWWYHTMANQQILKQKSQGNTFSRVWWFFLFQYFEQNVQGIVPRNYQLPLP 400          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Sea Lamprey
Match: zgc:162183 (zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30])

HSP 1 Score: 251.136 bits (640), Expect = 1.140e-77
Identity = 176/395 (44.56%), Postives = 238/395 (60.25%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEI--KVIGTRKRLVCLI-------NKWILSEVYREDYANTDNSNIE---SNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLS----KLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIP 1271
            +  +L    + E +  L   H +DG     L +++++   I  KV+G  KRL+  +           L +    +Y    N N+    +  + D     R ++     V+   G      +   L    + L     K + S +YV + FG T+FVMVI H+R+PDM  YPPLPD+ LDN+P I WAF  +E+  +IL  IWSS+L+FHK+R ILLRR F+L+GTVFLLR VTM +TSLSVPG HL  + KL         K+ RAL+IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT   ++ LHT SW+LNLFG+FFILAAHEHY+IDV VAFYL++RLFLYYH  A   +   R  +RAR+WFPMF + E    G +PNQ+  P
Sbjct:    1 VGTWLHKEGMGELSELLSDVHRLDGPGLLSLTQAELLAPPICMKVLGDAKRLIRAVASLRAATRGLSLMKPQHYNYQPAFNPNVPFLSALTLTDQGYGARPQQQHMQQVAER-GNDHRYTNGSYLKKSRRKLDPEYWKTLVSLVYVVLVFGATAFVMVIVHDRVPDMETYPPLPDIFLDNVPRIPWAFAMTEVCGLILTAIWSSVLVFHKHRSILLRRMFSLIGTVFLLRCVTMFVTSLSVPGVHLQCSGKLYSD---FGAKLERALKIWSGFGMTLTGVHTCGDYMFSGHTVILTMLNFFVTEYTPITWHYLHTLSWVLNLFGIFFILAAHEHYTIDVVVAFYLTTRLFLYYHTLAAAGT--SRHSRRARVWFPMFYFCECRVDGPVPNQYHYP 389          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004438.1 (pep scaffold:Pmarinus_7.0:GL489294:2043:4061:-1 gene:ENSPMAG00000004048.1 transcript:ENSPMAT00000004438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 6.152e-13
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 3
Query:  756 GTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRT-CGDYMFSGHTTCLTLLNFFITE 998
            GT++L R VT  IT+L VPG H H + K++     ++ ++ R +++  G GLS+ G  T CGDY++SGHT  LTL   F  E
Sbjct:   12 GTLYLYRCVTY-ITTLPVPGRHFHCSPKVLGD---VELQMRRVMKLIAGGGLSLTGAHTLCGDYLYSGHTVVLTLTCLFAQE 89          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Nematostella
Match: EDO42625 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Z2])

HSP 1 Score: 278.485 bits (711), Expect = 5.833e-88
Identity = 174/362 (48.07%), Postives = 237/362 (65.47%), Query Frame = 3
Query:  195 HEIDGIAFAHLKESDMIE-MEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            + IDG     L E+D+ + + I+V+G RKRL   INK  L + + +   N D  + + +     S Y+   + ++    SN    LS+ D         +  +   S LY F+ F +TSFVM + H+R+PDM KYPPLPD+ILD++P I WAF   E   ++L  +W ++L  HK+R IL+RR   L GTVFLLR VTM +TSLSVPG HL  + KL      +  K+ RA EI  G G+S+NG+R+CGDYMFSGHT  +TLLNFFITEYT R +Y LHT  W+LNLFG+FFILAAHEHYSIDV +AFY+SSRLFLYYH  AN+ S+  ++ +R ++WFP+F++FE +  G +PN++E P K
Sbjct:   37 NRIDGQVLLILTENDLKDSLGIRVLGDRKRLWLAINK--LQQEHSKSALNLDTYSRKKSLDFKDSAYISSSDSNDDEEGSN---SLSLADVS-------ETWRTFLSVLYAFLVFCLTSFVMTVVHDRVPDMKKYPPLPDIILDSVPLIPWAFTMCEFTGIVLWSMWVAVLFLHKHRMILIRRMMALAGTVFLLRCVTMFVTSLSVPGIHLECSGKLYGD---VWAKLHRAFEIMFGFGMSVNGVRSCGDYMFSGHTVVITLLNFFITEYTPRYWYYLHTACWVLNLFGIFFILAAHEHYSIDVLIAFYISSRLFLYYHTLANSLSIK-KEDKRTKVWFPLFSFFEENVNGRVPNEYEWPLK 382          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:NCBI gene;Acc:101175604])

HSP 1 Score: 267.7 bits (683), Expect = 3.794e-83
Identity = 172/389 (44.22%), Postives = 237/389 (60.93%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESS-------VSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            +  +LR+    +    L   H +DG +   L E D+    +E+KV+G  KRL+  I K     +   D        +  +       ++   + S  S       V     Q  + +  Q +   + +  K + S +YV   FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   VIL  IW  +L+ HK+R ILLRR  +L+GTVF+LR +TM +TSLSVPG HL  + K+      +  K+ RA+ IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PN++  PF
Sbjct:   14 VAKWLRDEGFCDYVDLLCYKHRLDGSSLLALSEYDLRSPPLELKVLGDIKRLMVSIRKLQKQNLDLLDELGVPFEGLSPSGSGGTLDWLCNGDSSRDSDGTDTAPVGEEYQQYTNGKYKQQMRRLDPEYWKTVLSSVYVVFVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGVILCNIWLLVLLLHKHRSILLRRLCSLMGTVFMLRCITMFVTSLSVPGQHLQCSGKMYGD---LWAKLQRAVAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFIHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGPVPNEYCWPF 397          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Match: SAMD8 (sterile alpha motif domain containing 8 [Source:NCBI gene;Acc:101175604])

HSP 1 Score: 267.7 bits (683), Expect = 4.679e-83
Identity = 172/389 (44.22%), Postives = 237/389 (60.93%), Query Frame = 3
Query:  135 IENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESS-------VSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            +  +LR+    +    L   H +DG +   L E D+    +E+KV+G  KRL+  I K     +   D        +  +       ++   + S  S       V     Q  + +  Q +   + +  K + S +YV   FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   VIL  IW  +L+ HK+R ILLRR  +L+GTVF+LR +TM +TSLSVPG HL  + K+      +  K+ RA+ IW G G+++ G+ TCGDYMFSGHT  LT+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PN++  PF
Sbjct:   19 VAKWLRDEGFCDYVDLLCYKHRLDGSSLLALSEYDLRSPPLELKVLGDIKRLMVSIRKLQKQNLDLLDELGVPFEGLSPSGSGGTLDWLCNGDSSRDSDGTDTAPVGEEYQQYTNGKYKQQMRRLDPEYWKTVLSSVYVVFVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGVILCNIWLLVLLLHKHRSILLRRLCSLMGTVFMLRCITMFVTSLSVPGQHLQCSGKMYGD---LWAKLQRAVAIWSGFGMTLTGVHTCGDYMFSGHTVVLTMLNFFVTEYTPRSWNFIHTLSWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQQSRRARIWFPMFSFFECNVNGPVPNEYCWPF 402          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000040965.1 (sphingomyelin synthase-related protein 1 [Source:NCBI gene;Acc:101167981])

HSP 1 Score: 265.003 bits (676), Expect = 6.826e-82
Identity = 171/411 (41.61%), Postives = 242/411 (58.88%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW-----------------------ILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSE--SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            S +++  +L++    +    L   H +DG++   L E D+    + + V+G  KRL   +++                        +L   +  D  +    N +    N   +  R +  S   SS ++         + Q+    + ++ K + S +YVF+ FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   ++L  ++  IL+ HK+R IL RR  +L+GTVFLLR  TM  TSLSVPG HL    +          KI RAL IW G G+++ G++TCGDYMFSGHT  +T+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PNQ+E PF
Sbjct:   12 SCNQVAQWLQDEGFGQYVELLCTQHRLDGLSLLALTEVDLRGPPLSLSVLGDIKRLTLALHRLQRRNHDQLEELGLRPSDSIPSGLLLGVEWSMDGKDWREFNGDYCLRNGTELVRRTRGGSRNVSSAATCHAHSNGRHEQQLAGRLDPEVWKTVISSIYVFLVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGLVLCYMFLLILLLHKHRSILFRRLCSLMGTVFLLRCCTMFATSLSVPGQHLKCASQTYGDTWG---KIQRALAIWSGFGMTLTGVQTCGDYMFSGHTVVITMLNFFVTEYTPRNWNLIHTISWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQHSRRARIWFPMFSFFECNVNGPVPNQYEWPF 417          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027799.1 (sphingomyelin synthase-related protein 1 [Source:NCBI gene;Acc:101167981])

HSP 1 Score: 265.003 bits (676), Expect = 6.826e-82
Identity = 171/411 (41.61%), Postives = 242/411 (58.88%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW-----------------------ILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSE--SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPF 1274
            S +++  +L++    +    L   H +DG++   L E D+    + + V+G  KRL   +++                        +L   +  D  +    N +    N   +  R +  S   SS ++         + Q+    + ++ K + S +YVF+ FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   ++L  ++  IL+ HK+R IL RR  +L+GTVFLLR  TM  TSLSVPG HL    +          KI RAL IW G G+++ G++TCGDYMFSGHT  +T+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PNQ+E PF
Sbjct:   12 SCNQVAQWLQDEGFGQYVELLCTQHRLDGLSLLALTEVDLRGPPLSLSVLGDIKRLTLALHRLQRRNHDQLEELGLRPSDSIPSGLLLGVEWSMDGKDWREFNGDYCLRNGTELVRRTRGGSRNVSSAATCHAHSNGRHEQQLAGRLDPEVWKTVISSIYVFLVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGLVLCYMFLLILLLHKHRSILFRRLCSLMGTVFLLRCCTMFATSLSVPGQHLKCASQTYGDTWG---KIQRALAIWSGFGMTLTGVQTCGDYMFSGHTVVITMLNFFVTEYTPRNWNLIHTISWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQHSRRARIWFPMFSFFECNVNGPVPNQYEWPF 417          
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000011949.2 (sphingomyelin synthase-related protein 1 [Source:NCBI gene;Acc:101167981])

HSP 1 Score: 264.618 bits (675), Expect = 7.825e-82
Identity = 172/412 (41.75%), Postives = 242/412 (58.74%), Query Frame = 3
Query:  123 SISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDM--IEMEIKVIGTRKRLVCLINKW-----------------------ILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSE--SSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFK 1277
            S +++  +L++    +    L   H +DG++   L E D+    + + V+G  KRL   +++                        +L   +  D  +    N +    N   +  R +  S   SS ++         + Q+    + ++ K + S +YVF+ FG TSFVMVI HER+PDM  YPPLPD+ LD++P I WAF  +E   ++L  ++  IL+ HK+R IL RR  +L+GTVFLLR  TM  TSLSVPG HL  T            KI RAL IW G G+++ G++TCGDYMFSGHT  +T+LNFF+TEYT R +  +HT SW+LNLFG+FFILAAHEHYSIDVF+AFY+++RLFLYYH  AN  +   +  +RARIWFPMF++FE +  G +PNQ+E PF 
Sbjct:   12 SCNQVAQWLQDEGFGQYVELLCTQHRLDGLSLLALTEVDLRGPPLSLSVLGDIKRLTLALHRLQRRNHDQLEELGLRPSDSIPSGLLLGVEWSMDGKDWREFNGDYCLRNGTELVRRTRGGSRNVSSAATCHAHSNGRHEQQLAGRLDPEVWKTVISSIYVFLVFGFTSFVMVIVHERVPDMRTYPPLPDIFLDSVPRIPWAFAMAEACGLVLCYMFLLILLLHKHRSILFRRLCSLMGTVFLLRCCTMFATSLSVPGQHLKCT------YGDTWGKIQRALAIWSGFGMTLTGVQTCGDYMFSGHTVVITMLNFFVTEYTPRNWNLIHTISWVLNLFGIFFILAAHEHYSIDVFIAFYITTRLFLYYHTLANTRA--YQHSRRARIWFPMFSFFECNVNGPVPNQYEWPFS 415          
BLAST of Sphingomyelin synthase-related protein 1 vs. Planmine SMEST
Match: SMESG000003119.1 (SMESG000003119.1)

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 389/391 (99.49%), Postives = 389/391 (99.49%), Query Frame = 3
Query:  120 MSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGTRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKXXXXXXXXXXXXXXXSWAFQASEMVAVXXXXXXXXXXXFHKYXXXXXXXXXXXXGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIFY 1292
            MSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIG RKRLVCLINKWILSEVYREDYANTDNSNIESNK NDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKYPPLPDLILDNLPYISWAFQASEMVAVILLIIWSSILIFHKYRFILLRRFFNLLGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIFY
Sbjct:    1 MSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIGIRKRLVCLINKWILSEVYREDYANTDNSNIESNKANDISIYVRKKELSESSVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAHERLPDMTKYPPLPDLILDNLPYISWAFQASEMVAVILLIIWSSILIFHKYRFILLRRFFNLLGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQKISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFYQLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYSLMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIFY 391          
The following BLAST results are available for this feature:
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMD86.663e-8748.40sterile alpha motif domain containing 8 [Source:HG... [more]
SAMD86.663e-8748.40sterile alpha motif domain containing 8 [Source:HG... [more]
SAMD81.515e-8548.40sterile alpha motif domain containing 8 [Source:HG... [more]
SGMS21.039e-4440.84sphingomyelin synthase 2 [Source:HGNC Symbol;Acc:H... [more]
SGMS21.039e-4440.84sphingomyelin synthase 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F53B1.23.392e-7240.62Sphingomyelin synthase-related 1 [Source:UniProtK... [more]
sms-12.725e-3130.34Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
sms-11.854e-3031.09Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
sms-12.313e-3031.09Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
sms-14.100e-3031.09Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SMSr1.764e-8447.83gene:FBgn0052380 transcript:FBtr0076870[more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1621834.240e-8543.97zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30][more]
zgc:1621831.042e-8343.47zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30][more]
zgc:1621831.042e-8343.47zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30][more]
zgc:919763.996e-4431.02zgc:91976 [Source:ZFIN;Acc:ZDB-GENE-041114-201][more]
zgc:919763.996e-4431.02zgc:91976 [Source:ZFIN;Acc:ZDB-GENE-041114-201][more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
plin11.290e-8845.95perilipin 1 [Source:Xenbase;Acc:XB-GENE-949442][more]
plin11.759e-8845.95perilipin 1 [Source:Xenbase;Acc:XB-GENE-949442][more]
tsfm4.772e-4238.87Ts translation elongation factor, mitochondrial [S... [more]
slc38a53.791e-4131.63solute carrier family 38 member 5 [Source:Xenbase;... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Samd85.088e-8748.53sterile alpha motif domain containing 8 [Source:MG... [more]
Samd85.684e-8648.53sterile alpha motif domain containing 8 [Source:MG... [more]
Sgms22.013e-4440.84sphingomyelin synthase 2 [Source:MGI Symbol;Acc:MG... [more]
Sgms22.013e-4440.84sphingomyelin synthase 2 [Source:MGI Symbol;Acc:MG... [more]
Sgms11.628e-4235.08sphingomyelin synthase 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96LT4|SAMD8_HUMAN3.200e-8648.40Sphingomyelin synthase-related protein 1 OS=Homo s... [more]
sp|Q9DA37|SAMD8_MOUSE3.976e-8548.53Sphingomyelin synthase-related protein 1 OS=Mus mu... [more]
sp|Q9VS60|SMSR1_DROME1.768e-8347.83Sphingomyelin synthase-related 1 OS=Drosophila mel... [more]
sp|Q20696|SMSR1_CAEEL4.314e-7140.62Sphingomyelin synthase-related 1 OS=Caenorhabditis... [more]
sp|Q4JM44|SMS2_RAT4.938e-4440.84Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4P4212.669e-10451.93SAM domain-containing protein OS=Paragonimus weste... [more]
A0A183TPJ56.075e-10350.12SAM domain-containing protein OS=Schistocephalus s... [more]
A0A0X3PU736.342e-10350.12SAM domain-containing protein OS=Schistocephalus s... [more]
A0A182ZZV82.264e-10250.49SAM domain-containing protein OS=Echinostoma capro... [more]
A0A0R3W5F12.879e-10051.06SAM domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMD82.005e-8444.50sterile alpha motif domain containing 8 [Source:NC... [more]
zgc:1621833.918e-8242.93sphingomyelin synthase-related protein 1-like [Sou... [more]
zgc:1621835.990e-8143.00sphingomyelin synthase-related protein 1-like [Sou... [more]
zgc:919761.812e-4131.92phosphatidylcholine:ceramide cholinephosphotransfe... [more]
zgc:919761.943e-4131.92phosphatidylcholine:ceramide cholinephosphotransfe... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1621831.140e-7744.56zgc:162183 [Source:ZFIN;Acc:ZDB-GENE-070410-30][more]
ENSPMAT00000004438.16.152e-1342.68pep scaffold:Pmarinus_7.0:GL489294:2043:4061:-1 ge... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO426255.833e-8848.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SAMD83.794e-8344.22sterile alpha motif domain containing 8 [Source:NC... [more]
SAMD84.679e-8344.22sterile alpha motif domain containing 8 [Source:NC... [more]
ENSORLT00000040965.16.826e-8241.61sphingomyelin synthase-related protein 1 [Source:N... [more]
ENSORLT00000027799.16.826e-8241.61sphingomyelin synthase-related protein 1 [Source:N... [more]
ENSORLT00000011949.27.825e-8241.75sphingomyelin synthase-related protein 1 [Source:N... [more]
back to top
BLAST of Sphingomyelin synthase-related protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000003119.10.000e+099.49SMESG000003119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034675 ID=SMED30034675|Name=Sphingomyelin synthase-related protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1866bp
AAATATTTTACGTGTTTCATTAATAATTTTAAGTTATAAAATTACATGTA
TATATTATTAGGTAAACTATTTATGCTTAACATTTTATTCAAAATTTAAA
AGTAGATTTATAAAAACTGATGTCAATTTCAAAAATTGAAAATTATTTAC
GAAATAATCATATTAATGAGGAAACAATTAATTTATTTGTAACTCATGAA
ATCGATGGAATAGCATTTGCTCATTTAAAAGAAAGTGATATGATTGAGAT
GGAAATTAAAGTGATTGGCACTCGAAAACGATTAGTGTGTTTAATTAATA
AATGGATTCTTTCCGAAGTGTATCGAGAGGATTATGCTAATACAGATAAC
TCAAACATTGAATCAAACAAAGTAAATGACATATCAATATATGTTCGGAA
AAAAGAACTCAGTGAAAGCAGTGTTAGTAGTAATATAGGACAAAGATTAT
CAATTGAAGATTCTCAAATGCTTCTTACTTGTAACAAAGATCTCTCAAAG
TTAATTGCTAGCTTTCTTTACGTATTTATTTCATTTGGAATAACGTCGTT
TGTAATGGTGATAGCTCACGAACGTTTACCGGACATGACAAAATATCCCC
CATTACCAGATCTTATATTAGACAATCTCCCGTACATTTCTTGGGCATTT
CAAGCCTCAGAAATGGTAGCAGTTATTTTGTTAATAATCTGGAGCTCTAT
TCTAATTTTTCACAAATATAGGTTTATTTTGTTGAGAAGATTTTTTAATT
TATTGGGAACGGTTTTCCTACTTCGTTCAGTAACAATGTTGATTACCTCA
TTGAGTGTACCTGGTACTCATTTGCATTCTACGTGTAAATTAATCAAATC
AAATCAGACAATAGATCAGAAAATTTCTCGTGCGCTTGAAATCTGGTTGG
GTTTAGGATTATCGATTAATGGAATTAGAACTTGTGGAGATTATATGTTC
AGCGGTCACACAACTTGTTTGACTTTATTAAATTTCTTCATTACTGAATA
CACCTCACGACGTTTCTATCAACTTCACACGTTCTCTTGGATTTTGAATT
TGTTTGGATTATTTTTCATTCTCGCTGCCCATGAGCATTATTCAATCGAT
GTGTTTGTGGCATTTTATCTCTCATCTCGATTGTTTCTCTATTATCATTG
GCAAGCTAACAATTATTCTCTCATGGTCCGCGATCAGCAAAGGGCTCGAA
TCTGGTTTCCAATGTTTACTTGGTTTGAGTCCGATTGTCCTGGAACTATT
CCAAATCAATTTGAAATACCGTTTAAATATTTAATTTTTTATTTAAAAAA
TTATTTTAAATCAACCAAGAAATTGAAAAAATAATTTTTCATGAAAAAAT
GTTTATTCATCATTCATGTTTTCTATTTTGTCATTAGATTGTATTTTTGT
CAGCGATTATTTTTTTTAAATTATTTTCTTGATGTCTATTAGAAAATTTA
TTATTATTTCCGGCTTGTTTTGTCATTTATAATTACATAATTATATATAT
ATATCGATTGATTCATTGAGATAATACAGTTTGTGAGTATTTGAATTGTA
ATATTGATTTATTTATGCCAATTCAAATTTTGTATCGATGCTTATAAAAA
GCTAACATTTCTTGGTAATAATAATTTTACTCGAATTTATAATTTACATA
GAACGAGTTAAGAGTGTGATCTATAATGATTCGAGAATCTATCAGATCAG
CAAGTTAAGGAGCATTTATATTCTTATAAGGCATTTCCTTTTCAAATGTT
GAAATTTCGTTATTTTTGTGGACAAACTTAATTTTTGATACTCCTAAACA
AAATTTAGTTATTTTGATCAAGTGATTTGTATTCAAAAAATTGTTTAATA
ATAAACAACTTCATTA
back to top

protein sequence of SMED30034675-orf-1

>SMED30034675-orf-1 ID=SMED30034675-orf-1|Name=SMED30034675-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MSISKIENYLRNNHINEETINLFVTHEIDGIAFAHLKESDMIEMEIKVIG
TRKRLVCLINKWILSEVYREDYANTDNSNIESNKVNDISIYVRKKELSES
SVSSNIGQRLSIEDSQMLLTCNKDLSKLIASFLYVFISFGITSFVMVIAH
ERLPDMTKYPPLPDLILDNLPYISWAFQASEMVAVILLIIWSSILIFHKY
RFILLRRFFNLLGTVFLLRSVTMLITSLSVPGTHLHSTCKLIKSNQTIDQ
KISRALEIWLGLGLSINGIRTCGDYMFSGHTTCLTLLNFFITEYTSRRFY
QLHTFSWILNLFGLFFILAAHEHYSIDVFVAFYLSSRLFLYYHWQANNYS
LMVRDQQRARIWFPMFTWFESDCPGTIPNQFEIPFKYLIFYLKNYFKSTK
KLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001660SAM
IPR025749Sphingomyelin_synth-like_dom
IPR013761SAM/pointed_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025749Sphingomyelin synthase-like domainPFAMPF14360PAP2_Ccoord: 271..343
e-value: 3.3E-25
score: 88.4
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 2..67
e-value: 1.7E-8
score: 36.1
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 3..61
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 5..59
e-value: 9.5E-5
score: 22.4
NoneNo IPR availablePANTHERPTHR21290SPHINGOMYELIN SYNTHETASEcoord: 23..382
NoneNo IPR availablePANTHERPTHR21290:SF25SPHINGOMYELIN SYNTHASE-RELATED PROTEIN 1coord: 23..382
NoneNo IPR availableCDDcd09487SAM_superfamilycoord: 17..61
e-value: 8.8532E-7
score: 43.7673
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
NoneNo IPR availableTMHMMTMhelixcoord: 325..344
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 128..150
NoneNo IPR availableTMHMMTMhelixcoord: 275..292
NoneNo IPR availableTMHMMTMhelixcoord: 173..195