Spectrin beta chain, non-erythrocytic 5

Overview
NameSpectrin beta chain, non-erythrocytic 5
Smed IDSMED30034660
Length (bp)12518
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin beta chain, non-erythrocytic 5 (SMED30034660) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin beta chain, non-erythrocytic 5 (SMED30034660) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spectrin beta chain, non-erythrocytic 5 (SMED30034660) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spectrin beta chain, non-erythrocytic 5 (SMED30034660) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034660

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034660SMESG000023006.1 Contig39386newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034660SMESG000023006.1 Contig39386uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034660SMESG000023006.1 Contig51445newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034660SMESG000023006.1 Contig51445uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034660SMESG000023006.1 dd_Smed_v6_2514_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034660SMESG000023006.1 dd_Smed_v6_2514_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30034660SMESG000023006.1 dd_Smed_v6_2514_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034660SMESG000023006.1 dd_Smed_v4_2514_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 555.829 bits (1431), Expect = 1.959e-159
Identity = 311/764 (40.71%), Postives = 484/764 (63.35%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANY 796          

HSP 2 Score: 278.485 bits (711), Expect = 9.640e-74
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  ++  + + + + + E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL N+R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  814 HAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHSGHPSEK-EIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-NERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 3 Score: 275.789 bits (704), Expect = 5.326e-73
Identity = 334/1497 (22.31%), Postives = 665/1497 (44.42%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDL-EDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L   +H +S + +  +  I E++ ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I ++++++  D +  + + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A
Sbjct:  664 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHS---GHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNRETASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 4 Score: 166.392 bits (420), Expect = 8.915e-40
Identity = 333/1731 (19.24%), Postives = 715/1731 (41.31%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKI---SLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRI----HQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E      + +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ SD   D     + + K K +  ++A Y   L  +    +       +   +   +  + +++ E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ S +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  ++R  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R       AR+   +    ++ +  L  + I+             DG +     L+ +     Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE-EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQE----GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREF-----ARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2068          

HSP 5 Score: 138.658 bits (348), Expect = 2.031e-31
Identity = 328/1691 (19.40%), Postives = 679/1691 (40.15%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESL-AFLNEINTQVKAD------RQINSVLAANEAI----QLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKL-LAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQ------QIWLTLLRESDDKNFWVDE--KLQQ--IKTLDKSANTLEEKLHLLQKYKA---------------LNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTE-PVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFL---NLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCV---KETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQ 8276
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +L+ +H+  + L  + H +   V+  L  I+E++K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W +++E   Q   Q  +  +   L+ +    L  +L+ + +Q+++D        +N +L   + +    ++ KK  E L +    L +     E  + DE       +Q+   ++LE  N+ K           H L+     ++IHQ N               D  L   E++ LA   +  HN+      V+ L     TL++    +        DD  +R Q +  +   + ++   Q      Q+W  L+ E++ ++  ++E  + QQ      +  A   E++L+++ + KA               L   +  +     QL   S  LV + HP+SE        + + +  L   +++R   L E   L     E+D +E W  E+E +  ++ELG D +H   LQ +  E       + + R+D +   A++L+        +A  I      +   W  L   ++     L  +++LH +Y++   I  +I+D+ K +  ++ G D ++VE L+R     E D+ AL  +  +L++ A  +      + +  I  ++ E+ +  + L    + R   L      +R+F +V+D     +  ++Q   I     P D  S    +  H  +K  ++ R       ++L + L   ++  +  I                 +E LL      KE  + W  R   L   +++H F       E WLL Q
Sbjct:  439 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMW-EVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQ-----EGKSTDEVDSKRLTVQTKFMELLEPLNERK-----------HNLL---ASKEIHQFNRDVE-----------DEILWVGERMPLATSTDHGHNLQT----VQLLIKKNQTLQK----EIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINS---GHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP-EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ---IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEI-----------------KEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQ 2036          

HSP 6 Score: 131.724 bits (330), Expect = 2.973e-29
Identity = 311/1521 (20.45%), Postives = 630/1521 (41.42%), Query Frame = 3
Query: 6633 EVKVKV--NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHE 10988
            E+KV V   ++   L   E LL KH     +I +  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS++++G D     SL  K   + E +   +     +D + + A+ L Q       E+ ++R R   I  R+  +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q   I   L   HS   S  +KEI           K + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  + + E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  N+ ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D   SRR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+
Sbjct:  546 EMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYR---PTLDTLHEQASALPQEHA----ESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQ---IARQL--MHSGHPS--EKEI-----------KAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQ 1954          

HSP 7 Score: 128.642 bits (322), Expect = 2.344e-28
Identity = 334/1679 (19.89%), Postives = 687/1679 (40.92%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYM-KGKEGDFNQ-RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL-----------QREVSPM---YKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M + K    +Q  G     +E + +K+  +  D+   + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      LD L   AS + ++     ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L    +P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L           Q +V  +   ++K+ ET S+ L     RL+   D +K           FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   +++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      +++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  493 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLM----RLKDNRDLQK-----------FLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2074          

HSP 8 Score: 107.457 bits (267), Expect = 6.193e-22
Identity = 166/820 (20.24%), Postives = 339/820 (41.34%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIE-YANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESL-ANHETV 6419
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + +D G        L  KHK +  EI  ++P +  L E    L +E +     DV  R   +++ +  + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+      K++    +     +D     + + +  L+  W +L + + N++ L L     Y       K++ AFLN     +       ++  A  AI+  + F  ++ AN E +
Sbjct:  424 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE--SPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLN---TRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNL-LSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI 1225          

HSP 9 Score: 100.908 bits (250), Expect = 5.997e-20
Identity = 193/949 (20.34%), Postives = 407/949 (42.89%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EIA    +++++ +QA  L  + H     +R   + +E  Y+ +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  454 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKH----TLVEAD-IGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKE-IKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1355          

HSP 10 Score: 92.4337 bits (228), Expect = 2.298e-17
Identity = 199/1041 (19.12%), Postives = 426/1041 (40.92%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSID-LFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHE-WDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +  +F +    +      K+ +L+ D  G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +  AN    +D +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  +K     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+ S+   +E +   +    H+ W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  457 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQD-YGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE---SPD---VRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLI-SEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1446          

HSP 11 Score: 89.7373 bits (221), Expect = 1.419e-16
Identity = 88/405 (21.73%), Postives = 186/405 (45.93%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  LNE    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A+  Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1290 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLNE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSS---LSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1679          

HSP 12 Score: 77.411 bits (189), Expect = 7.442e-13
Identity = 356/1856 (19.18%), Postives = 749/1856 (40.36%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFAS-QKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL-KIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQ-------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  S++ G D    + L  +     + I      + T +E A+ L   +++ S ++      ++  +  +      +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I   ++  + +      + EM      +   +F    +R Q       +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +    +   + ++  K+  ++    +L     +R   L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NIVT S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +         LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  ++    L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  285 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMF--LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQ--EGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIVTDSSSLSAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2062          

HSP 13 Score: 62.3882 bits (150), Expect = 2.752e-8
Identity = 77/369 (20.87%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  853 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1211          

HSP 14 Score: 58.151 bits (139), Expect = 5.729e-7
Identity = 77/394 (19.54%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   S +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1489 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1865          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 555.829 bits (1431), Expect = 2.043e-159
Identity = 311/764 (40.71%), Postives = 484/764 (63.35%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANY 796          

HSP 2 Score: 273.092 bits (697), Expect = 3.856e-72
Identity = 268/1309 (20.47%), Postives = 606/1309 (46.29%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKH--NILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  ++  + + + + + E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K    +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL N+R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D +    L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  814 HAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHSGHPSEK-EIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-NERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2077          

HSP 3 Score: 272.322 bits (695), Expect = 6.892e-72
Identity = 335/1499 (22.35%), Postives = 665/1499 (44.36%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKL--KRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDL-EDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L   +H +S + +  +  I E++ ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L  K+Q   +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I ++++++  D +  + + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A
Sbjct:  664 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHS---GHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNRETASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTV----------NHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2077          

HSP 4 Score: 163.696 bits (413), Expect = 5.335e-39
Identity = 335/1738 (19.28%), Postives = 720/1738 (41.43%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL----QAKLTE---PVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKI---SLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRI----HQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E      + +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ SD   D     + + K K +  ++A Y   L  +    +       +   +   +  + +++ E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ S +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L    QA + E    V  K+++E       Q+  Q L ++       D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  ++R  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E  T   +  R       AR+   +    ++ +  L  + I+             DG +     L+ +     Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE-EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEE------LQSQAQALSQE---GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHFTMLQERFREF-----ARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2070          

HSP 5 Score: 140.584 bits (353), Expect = 5.625e-32
Identity = 321/1686 (19.04%), Postives = 681/1686 (40.39%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESL-AFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEE-----TEKL-LAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQ------QIWLTLLRESDDKNFWVDE--KLQQ--IKTLDKSANTLEEKLHLL---------------QKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTE-PVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFL---NLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCV---KETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQ 8276
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +L+ +H+  + L  + H +   V+  L  I+E++K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W +++E   Q   Q  +  +   L+ +    L  +L+ + +Q+++D     + + N  I L K+ A  L N   V +K +                E+QS    + ++   T +        ++ + ++   +  +  +N          +++ F+ D+E+      E++ LA   +  HN+      V+ L     TL++    +        DD  +R Q +  +   + ++   Q      Q+W  L+ E++ ++  ++E  + QQ      +  A   E++L+++               +K++ L   +  +     QL   S  LV + HP+SE        + + +  L   +++R   L E   L     E+D +E W  E+E +  ++ELG D +H   LQ +  E       + + R+D +   A++L+        +A  I      +   W  L   ++     L  +++LH +Y++   I  +I+D+ K +  ++ G D ++VE L+R     E D+ AL  +  +L++ A  +      + +  I  ++ E+ +  + L    + R   L      +R+F +V+D     +  ++Q   I     P D  S    +  H  +K  ++ R       ++L + L   ++  +  I                 +E LL      KE  + W  R   L   +++H F       E WLL Q
Sbjct:  439 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMW-EVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVN--ILLKKQQATMLENQMEVRKKEIE---------------ELQSQAQALSQEGKSTDE------VDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQT----VQLLIKKNQTLQK----EIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINS---GHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP-EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ---IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEI-----------------KEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQ 2038          

HSP 6 Score: 127.102 bits (318), Expect = 7.466e-28
Identity = 311/1523 (20.42%), Postives = 629/1523 (41.30%), Query Frame = 3
Query: 6633 EVKVKV--NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVK--QHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHE 10988
            E+KV V   ++   L   E LL KH     +I +  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS++++G D     SL  K   + E +   +     +D + + A+ L Q       E+ ++R R   I  R+  +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q   I   L   HS   S  +KEI           K + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K  Q   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  + + E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q       L+  F +F RD   +  + ++  N+ ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D   SRR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+
Sbjct:  546 EMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYR---PTLDTLHEQASALPQEHA----ESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQ---IARQL--MHSGHPS--EKEI-----------KAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQ 1956          

HSP 7 Score: 127.102 bits (318), Expect = 7.657e-28
Identity = 334/1681 (19.87%), Postives = 689/1681 (40.99%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYM-KGKEGDFNQ-RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL-----------QREVSPM---YKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQL--KSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M + K    +Q  G     +E + +K+  +  D+   + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      LD L   AS + ++     ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L    +P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L           Q +V  +   ++K+ ET S+ L     RL+   D +K           FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +  + +    +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   +++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      +++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  493 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLM----RLKDNRDLQK-----------FLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2076          

HSP 8 Score: 107.457 bits (267), Expect = 6.460e-22
Identity = 166/820 (20.24%), Postives = 339/820 (41.34%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIE-YANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESL-ANHETV 6419
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + +D G        L  KHK +  EI  ++P +  L E    L +E +     DV  R   +++ +  + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+      K++    +     +D     + + +  L+  W +L + + N++ L L     Y       K++ AFLN     +       ++  A  AI+  + F  ++ AN E +
Sbjct:  424 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE--SPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLN---TRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNL-LSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI 1225          

HSP 9 Score: 100.908 bits (250), Expect = 6.099e-20
Identity = 193/949 (20.34%), Postives = 407/949 (42.89%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EIA    +++++ +QA  L  + H     +R   + +E  Y+ +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  454 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKH----TLVEAD-IGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKE-IKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1355          

HSP 10 Score: 90.8929 bits (224), Expect = 7.193e-17
Identity = 173/895 (19.33%), Postives = 369/895 (41.23%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSID-LFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGE 5714
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +  +F +    +      K+ +L+ D  G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +  AN    +D +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  +K     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E
Sbjct:  457 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQD-YGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE---SPD---VRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE 1305          

HSP 11 Score: 84.7297 bits (208), Expect = 4.424e-15
Identity = 88/407 (21.62%), Postives = 186/407 (45.70%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKH--NLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K    +++ Q++       ++  +++      KS +    +R T++T+   L   +  LNE    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A+  Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1290 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLNE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSS---LSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1681          

HSP 12 Score: 74.7146 bits (182), Expect = 5.039e-12
Identity = 359/1864 (19.26%), Postives = 750/1864 (40.24%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFAS-QKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL-KIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQ-------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGI---------ERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  S++ G D    + L  +     + I      + T +E A+ L   +++ S ++      ++  +  +      +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I   ++  + +      + EM      +   +F    +R Q       +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ            ++++  L  +   L Q     D +D   S +++++ K     +E L  L +++ + L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NIVT S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  + +   ++ REF  +     +  +         LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  ++    L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  285 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMF--LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVD---SKRLTVQTK----FMELLEPLNERKHNLLA-SKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIVTDSSSLSAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2064          

HSP 13 Score: 62.3882 bits (150), Expect = 2.846e-8
Identity = 77/369 (20.87%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  853 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1211          

HSP 14 Score: 55.8398 bits (133), Expect = 2.325e-6
Identity = 76/394 (19.29%), Postives = 168/394 (42.64%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   S +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY     L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1491 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGN----IGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1867          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 552.747 bits (1423), Expect = 2.801e-159
Identity = 309/758 (40.77%), Postives = 481/758 (63.46%), Query Frame = 3
Query:   60 KSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + R ++LQ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   29 EGRFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANY 783          

HSP 2 Score: 278.485 bits (711), Expect = 7.217e-74
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  ++  + + + + + E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL N+R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  801 HAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHSGHPSEK-EIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-NERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          

HSP 3 Score: 275.404 bits (703), Expect = 6.688e-73
Identity = 334/1497 (22.31%), Postives = 665/1497 (44.42%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDL-EDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L   +H +S + +  +  I E++ ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I ++++++  D +  + + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A
Sbjct:  651 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHS---GHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNRETASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          

HSP 4 Score: 166.392 bits (420), Expect = 8.717e-40
Identity = 333/1731 (19.24%), Postives = 715/1731 (41.31%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKI---SLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRI----HQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E      + +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ SD   D     + + K K +  ++A Y   L  +    +       +   +   +  + +++ E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ S +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  ++R  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R       AR+   +    ++ +  L  + I+             DG +     L+ +     Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  413 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE-EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQE----GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREF-----ARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2055          

HSP 5 Score: 139.043 bits (349), Expect = 1.615e-31
Identity = 328/1691 (19.40%), Postives = 679/1691 (40.15%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESL-AFLNEINTQVKAD------RQINSVLAANEAI----QLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKL-LAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQ------QIWLTLLRESDDKNFWVDE--KLQQ--IKTLDKSANTLEEKLHLLQKYKA---------------LNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTE-PVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFL---NLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCV---KETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQ 8276
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +L+ +H+  + L  + H +   V+  L  I+E++K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W +++E   Q   Q  +  +   L+ +    L  +L+ + +Q+++D        +N +L   + +    ++ KK  E L +    L +     E  + DE       +Q+   ++LE  N+ K           H L+     ++IHQ N               D  L   E++ LA   +  HN+      V+ L     TL++    +        DD  +R Q +  +   + ++   Q      Q+W  L+ E++ ++  ++E  + QQ      +  A   E++L+++ + KA               L   +  +     QL   S  LV + HP+SE        + + +  L   +++R   L E   L     E+D +E W  E+E +  ++ELG D +H   LQ +  E       + + R+D +   A++L+        +A  I      +   W  L   ++     L  +++LH +Y++   I  +I+D+ K +  ++ G D ++VE L+R     E D+ AL  +  +L++ A  +      + +  I  ++ E+ +  + L    + R   L      +R+F +V+D     +  ++Q   I     P D  S    +  H  +K  ++ R       ++L + L   ++  +  I                 +E LL      KE  + W  R   L   +++H F       E WLL Q
Sbjct:  426 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMW-EVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQ-----EGKSTDEVDSKRLTVQTKFMELLEPLNERK-----------HNLL---ASKEIHQFNRDVE-----------DEILWVGERMPLATSTDHGHNLQT----VQLLIKKNQTLQK----EIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINS---GHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP-EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQ---IEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEI-----------------KEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQ 2023          

HSP 6 Score: 131.339 bits (329), Expect = 3.518e-29
Identity = 311/1521 (20.45%), Postives = 630/1521 (41.42%), Query Frame = 3
Query: 6633 EVKVKV--NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHE 10988
            E+KV V   ++   L   E LL KH     +I +  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS++++G D     SL  K   + E +   +     +D + + A+ L Q       E+ ++R R   I  R+  +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q   I   L   HS   S  +KEI           K + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  + + E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  N+ ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D   SRR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+
Sbjct:  533 EMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYR---PTLDTLHEQASALPQEHA----ESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQ---IARQL--MHSGHPS--EKEI-----------KAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQ 1941          

HSP 7 Score: 129.028 bits (323), Expect = 1.887e-28
Identity = 334/1679 (19.89%), Postives = 687/1679 (40.92%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYM-KGKEGDFNQ-RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL-----------QREVSPM---YKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M + K    +Q  G     +E + +K+  +  D+   + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      LD L   AS + ++     ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L    +P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L           Q +V  +   ++K+ ET S+ L     RL+   D +K           FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   +++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      +++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  480 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLM----RLKDNRDLQK-----------FLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2061          

HSP 8 Score: 108.227 bits (269), Expect = 3.904e-22
Identity = 145/707 (20.51%), Postives = 295/707 (41.73%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKK----DAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDD 6110
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + +D G        L  KHK +  EI  ++P +  L E    L +E +     DV  R   +++ +  + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+
Sbjct:  411 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE--SPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLN---TRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDN 1100          

HSP 9 Score: 100.523 bits (249), Expect = 7.230e-20
Identity = 193/949 (20.34%), Postives = 407/949 (42.89%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EIA    +++++ +QA  L  + H     +R   + +E  Y+ +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  441 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKH----TLVEAD-IGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKE-IKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1342          

HSP 10 Score: 96.2857 bits (238), Expect = 1.388e-18
Identity = 296/1649 (17.95%), Postives = 661/1649 (40.08%), Query Frame = 3
Query: 5661 EAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI----DNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKY----PNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE--------WMTKNEHILIKQNCLRD---IHQINSST-----AFQEVKVKVNNFDLDLEE--TEKLLAKHRNFAHNIS---VTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDI--DDNLDANHSIKISLKQK--EIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKT------------------LMNNRKIKENRIMD------------------LCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVI----LNNLKSLSTVEDVTENIDAKR--------------------------SISSLVSAREQKTV-----KGSLLEILEKLRKDQISDIKLA------EGKYKSVIDG--------FSSLNEKL-MRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE-IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLIS-VEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATR---------AQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNK-------LVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDW 10178
            E W+ E Q++   + FG DL  +E    +  +    I   E+RV+     A +L        + I + ++++   W+ LL     +  + +    + K       F +M+ I    D + +   ++D      G + + Q       ++     ++  ++ +A K         P +  +I + + ++ + +Q+L + A ++  +LE  R     + ++ E   ++ E    + +D     + +    +   + F + ++      ++ +                    + +DM+ + +   + + E        W    +   I++  L +   +HQ  +          ++   V++ D+  +E  T+ L+ KH++ A  I+    T D +   +  +P     +H +  ++        +R +++ +  R  +  L +      +  E+D    W+DEK Q +  + +    LE+   +  ++++L  E++        +   + +L+ + HP  +E K     +  +W Q      ++  AL  A  +  +  E +  ++W REK  ++ S  +LG+DL   M+LQ KLT         EA++  + + A +L   ++    +A  I SR   I   W+ +K  L+  +  L EA KL  +  +L      +      +  +D  + +   EKL  +   I+ +++   E + K+R   ++      DA +   + L+Q+   +     +L  + + R + L+ S+ Y + ++D K        Q  ++  +  P   + A  A+K  ++  T                  L+++  I  +RI +                  L  +LK++R++       Q  S+   ++++ T Q+      +   + W K Q  + E      +L+  E E   L+++  + + +    L  L  +  V + T    A+R                           I S    ++  +V     K  +LE   ++RK +I +++        EGK    +D         F  L E L  R H +L+S KE+ + ++ VED I W+  +M +A+  ++   +  +   +KK++    E++ ++P I    +  + +++++ + S E I +++ DL      L   ++ + +RL E  +  ++        +W++E E    S     D  S V  LK+ Q+ +E  +  + E +  + + +  ++ +++  +  I  + + ++  +  L +  +     L +   L++ + +V     WI ++  +A   E+G           +HVT++ E              + ++++   A +L +  H     I   +  L  ++  L    + R   L A+    +F  D  EI  R+ DK   L   E G D+ +   L +   +   +I    +   +L E  + +   Y     + ++  +N+       L++  E    + +   +   ++  +R+   ++ W+++    +  +E  +D      L+         ++A  +       +GK L+  K+  S EI+     +TE+   + D ++ R E L+  LEVH F R+A+    W
Sbjct:  422 ETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKI------FQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIK-------------------EGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALP----QEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNM-QIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL---ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQY---MFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLW-INEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLAS-KEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQI-LEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDY--------EHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPE-ELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRD---LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAW 2019          

HSP 11 Score: 93.2041 bits (230), Expect = 1.294e-17
Identity = 196/1040 (18.85%), Postives = 421/1040 (40.48%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSID-LFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +  +F +    +      K+ +L+ D  G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +  AN    +D +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  +K     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+  +      +      +   W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  444 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQD-YGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAE---SPD---VRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1433          

HSP 12 Score: 89.3521 bits (220), Expect = 1.674e-16
Identity = 88/405 (21.73%), Postives = 186/405 (45.93%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  LNE    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A+  Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1277 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLNE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSS---LSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1666          

HSP 13 Score: 77.411 bits (189), Expect = 8.100e-13
Identity = 354/1850 (19.14%), Postives = 744/1850 (40.22%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFAS-QKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL-KIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAES-LANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI-SVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  S++ G D    + L  +     + I      + T +E A+ L   +++ S ++      ++  +  +      +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I +  +D  K   +     +      Y  +            +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +    +   + ++  K+  ++    +L     +R   L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+  +    +NIVT S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +         LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  ++    L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  272 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASAL-PQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQ--EGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFER---SQNIVTDSSSLSAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2049          

HSP 14 Score: 62.3882 bits (150), Expect = 2.982e-8
Identity = 77/369 (20.87%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  840 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1198          

HSP 15 Score: 57.7658 bits (138), Expect = 6.112e-7
Identity = 77/394 (19.54%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   S +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1476 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1852          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 507.679 bits (1306), Expect = 2.202e-157
Identity = 284/657 (43.23%), Postives = 426/657 (64.84%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISA 2003
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S 
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSG 689          

HSP 2 Score: 71.633 bits (174), Expect = 2.663e-11
Identity = 59/247 (23.89%), Postives = 120/247 (48.58%), Query Frame = 3
Query: 8910 SWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINN--RFLQ-LGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESI----KKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKK 9629
            +W++E +++    N+G DL +VE   ++   IE DI +++E++Q++   A  +  EN +   DI+  +A  +N  R  + L E L+     L     L +   ++ Y +DW+ +   L   ++ G  L   +  +++H  + ++I  +A+ +  +    +K A D E         IR    ++E  Y+ LC    ER  +L  ++   +F  ++ E E  + +K  +L++ + G D  S + L+ K
Sbjct:  436 TWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYH---DIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSK 679          

HSP 3 Score: 70.8626 bits (172), Expect = 5.042e-11
Identity = 59/273 (21.61%), Postives = 125/273 (45.79%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEING 5120
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSG 689          

HSP 4 Score: 57.3806 bits (137), Expect = 5.738e-7
Identity = 62/251 (24.70%), Postives = 109/251 (43.43%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVK-----------RRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTI--------VCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK 7337
            V  +NF  DL   E    KH     +I+  ++RV+A+      L+   + D   I +  D+ ++           RRQ+L       E  L  Q+I+  +L   D    W+DE    + + D   + L  +  LLQK+  + A+I         +   + +  T+     E +K          V ++   + +L   + +R + L+E++ L  FF E+   E W REKE ++S+++ G DL   M L +K
Sbjct:  445 VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRL-------EMNLGLQKIFQEMLYIMD----WMDEMKVLVLSQDYGKHLLGVE-DLLQKHTLVEADIGIQAERVRGVNASAQKFATD----GEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSK 679          

HSP 5 Score: 53.9138 bits (128), Expect = 8.101e-6
Identity = 52/256 (20.31%), Postives = 121/256 (47.27%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMT-NKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLD---------FLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            ++  + G    A +   +KH  ++  + A  +R   +   +R+    L+++N    +R T   +  N+      L E+ + RR++L+ N    K+ +++    +W+ +E+KV+  +++ G     V  L+++H + E++I          ++  ++ S  +F  DGE +K  D          +   +  L ++ +ERR  L+++    K++ +  + + WI E   ++ + + G D  +   L+ +H A  +E+S
Sbjct:  445 VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARE----LEAENYHDIKRIT--ARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWM-DEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAE-----RVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMS 688          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Human
Match: SPTB (spectrin beta, erythrocytic [Source:HGNC Symbol;Acc:HGNC:11274])

HSP 1 Score: 529.25 bits (1362), Expect = 8.314e-152
Identity = 312/765 (40.78%), Postives = 478/765 (62.48%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESE---ISAHL-PIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEI 2315
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+KDLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL+LGLIWTIILRFQIQ+++++T+ G E +SAKDALLLWCQ KT GY +V++ +F  SW+DGLAFNALIH H P+LID+ KL   N + NL  AF +AE++L I  LLDPEDV  E PD+KSI+TYV + Y  F+KMK      KRVGK++ +A+E  +MIE Y  L  +LL WI++ I  LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  + + NN K Y P +G L+ ++  AW++LE+AE+ RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   ++   N G  +   EA   K E +  +    +ER + L++LA  LE  NYH +  I+ R  +I   W  LQ+L+ S +Q     LA        + +I    D +K  + S + GKH L  +DLL+KH L++  +    D+   I   +  F +    Q   P   Q ++ ++ +L      L+ ++  R+ QL+Q+    K   +++E ++W+  + ++ ++ + G D  SVL L R+H+ +E E   + AHL  IF +       +++ QF    +I   +  +S  W  L+ + +  +  L+DA    ++  DA+D + W+ +   L+  ++ G DEGAT+AL K+H   LEE+
Sbjct:   36 SARLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDW-MDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQPCDP---QVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGM---VARKQF-GHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEEL 792          

HSP 2 Score: 233.032 bits (593), Expect = 4.779e-60
Identity = 269/1193 (22.55%), Postives = 531/1193 (44.51%), Query Frame = 3
Query: 3291 KSKVSNRYKEIIN-QWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDR--PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFI----DKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLAT--YDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQ-QFSKELENMKTQLDDISMAANKLKIKYPN-NSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKAD---RQINSV---LAANEAIQL-----GKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-WMTKNEHI-LIKQNCL--RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMK 6785
            +S+   +Y++ +N +W+    L  ++ ++++ A  +  +    +E  + I  K  ++ +  ++G D      ++RK   L RD+ AI++R++  +     +  ++P +   + ++ K +++L+  LQ +L+ +++ L     +  F+ D  + +  L+     + ++ +P+ +   E  +QQ   +K EI+  + +  ++K     V++ +  P    +   L  LD    +L      R   L   L  Q+F K+  Q E+I+S Q   L  + P  S++  E  ++   +    +    DK+ + V S +K   E   N  S+KI  +   + D+  K + K     + L ++LE   F +N  EL+ WI+DKLL  ++ +Y +  NL  K  KH+A  AE+ S+   LE I   G  L+         V   L+ +   W +L A T++K + L  A       +  AD+ +    +E  +++   G DL S   ++ K   +E ++  + E L +L  +   M ++G     ++  E R L+L    L PL  +R   L+ +    Q + D++ E  W+EE  P A   DYG +L        K++ L  EI GH P V ++L+ G+ L  E + +  +D+E R   L+  WDRL + A  R  +L  +   +Q+  D ++   WI E+  YV  SD ++  D+    +M  + +    A   Y   +K ++    G           PE  E + +   +   ++   +    +++  LEN       + E  ++E WI EK+ +A S E G+D   +  LRD++    + +  +G++RV   N    +L+ + +S +  IA  ++ +   W  LL     +     A+ ++H++  T  +   +++  +  L        +      R+   F +EL  +  Q+      A +L+  Y    ++ I  +   ++  WQ L++    +  QL    D    +   ++ L+++  I  Q++     R ++SV   +  ++ I        K F+  L   E++LQ+    S                 +I + L++    ++ +NE W  + E + ++ + C   RD     +    QE  +   +F   ++  EKL+ +H  F  + +   +R  AL    PT  E+K
Sbjct:  921 RSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAE--GNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFAQVPSMGEEG--GDADLSIEKRFLDL----LEPL-GRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLV-EAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVI-SD-EIPKDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGH-----PE-GEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQAS----------------EEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEK--PTTLELK 2077          

HSP 3 Score: 152.91 bits (385), Expect = 1.034e-35
Identity = 199/950 (20.95%), Postives = 408/950 (42.95%), Query Frame = 3
Query: 7152 EKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKL-RQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYR---YFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTF------LETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKR-SISSLVSAREQKTVKGSLLEILEKLRKDQISD-IKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN--YYLYI--RESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSY 9950
            E + Q+++++  R   L+EA DL   F E DA E W  EKE  ++  E+   L+    +Q +        +    +ID +   AN L++      P +  ++     + +RW   +  +   +  ++ A ++HNY  +    S  I D+ K+V+  KD G D+  +  ++RK +G+ERD+ A+  +   L R+++ + D+        I  +QK +++  + L    + + D L    +   + + + D +A   ++    + +     P     A   L+ H  +K  ++  +    R+ +   K+          I  Q +   P    L    E L +        W  R + L + +    F       E   + +++ L   +  D +      +   ED   +++  R  + S V +  +   +G+L         D+I + ++L E +++         NEK      +L    ELQ   Q  ++   WI +K+L + D +Y++  NL NK  KH+ FV+E+ ++E  ++     GK+L+ E    +  + +K+  L     EL+  +  K + L          +       WI+  E    S + G DL SV ++  +   +E  +N  KE+L  +  +  +M  E     +D+      I  RFL L E L      L  +    +   D+  E  W+++++ LA   + G++L     F+K++ TL +EI      +E + ++ + L +        +     +L++S++RL  A   R  +L      QQ+  D  E E  + ++ L + + E   DE+  + ++K+       ++    N  +L+ +   + +    + +++++ LQ ++ +    ++      K  L   Y+L+   RE++++  WI  + ++    E G+D+D    L ++F  +
Sbjct:  828 ELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGH---PRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDS-HPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSIT---QKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKV----------IQGQTD---PEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLY-------SDKIKEKVQLIEDRHRKN-------NEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFAQVPSMGEEGG--DADLS-----IEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIR-LQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDF 1735          

HSP 4 Score: 129.798 bits (325), Expect = 1.108e-28
Identity = 201/1037 (19.38%), Postives = 427/1037 (41.18%), Query Frame = 3
Query: 2916 DKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQ--RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLA-SIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAF---IDKIDNRVQSLSKRKTELK-PNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDL-EFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEK---LQKHKALEAEIKSNISSLEKIHDCGNDLIK-RNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLAN---KHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSD-------NFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGE-DRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKF 5957
            D + I+ + + L + F EL  +A  RK  LE S    +FF E D    ++K KE  ++    G   T +  +++K++A  D+L                 + +D  LE+  ++    +           ++  R KE+  QW++L  L    +K+L+ A +   F    D+L+  +     +L+ ++VG D+ +   L +K ++ L +++  +  ME  +    G  + +    + V  +++ + +LY ++    + R+  L  A +++    ++   E  + E    +    +P  +  +E    + + L  E+  +   +D +   A S+V    P    +      L+ + ++ +   ++R + +  AL    +  +C++    I+ +   ++S        D+   +     L+     +  I  RV +L +   +L   +P+ ++   +  K L+++ +   +    + DL  ++ +   F ++ ++   W+     A+  E+  +  +LPE    LQ+H  ++ EI  +  S +++ + G  +I+ +  P+   +   L+ +D  W  L    E +   L Q     EF ++           E  +   +  + L +A++ I K       +E   + +       +++  +G+   + I ++++ +E R  K      + +  L+DNL+   F  +  +   WI +      L     S  +A  L N   KH+  + E+  H+  + N+   GK L  E  P +   V  + +AL   WD L+    ++   L  + +    L    D+  WI+     +   D   D          L S+N  LA     LK +    N  K+       L EL   V     E  D        F      L  ++  LE+ +  L    ++ +   W++E+  +A S ++G +LQ ++    + N  L++  LG   RV+   +   QL+++     +++      +Q  WDRL   A+ +  +   A E  ++
Sbjct:  604 DPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDEL-----------------RGLDAHLEQIFQEAHGMVARK---QFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPD-VTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKD--LGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPE--SLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWIND----KLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDE-KPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKD----------LTSVNRMLAK----LKRVEDQVNVRKEE------LGELFAQVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKK-NQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQY 1589          

HSP 5 Score: 98.9821 bits (245), Expect = 2.131e-19
Identity = 146/722 (20.22%), Postives = 302/722 (41.83%), Query Frame = 3
Query: 3918 PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDAL--------EAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLI--KRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREV--SPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDN----FESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSN-EFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK 6020
            P+D  + S + R     +SL++ E +R+  L++ L         A++F ++    E+ +S+    +   N    +  VE A K H  +       + RV++L     EL+     D ++I  R D +L   + L      ++  LE  L   K  ++     +W+D+ K   +  E  K L  + + LQKHK +EA+I      ++ I          K   P     ++D +  +++ +++L+     ++ +L Q+    +F   + +        E +  +   G DL S   L  KH   E EL     +L ++ Q+A  M     F    I   I+++  +  +L  L      NL+D   + QF  D D    W+++     +  D G+       L  KHK  + E+   + V+ +L +  +    E   SP    DV  R +AL++ + ++  QAD R+ +L  + +      + +   LW+ EK  ++ + +       + + +  L+ +       D  +K +    +G        N L E     +++  +  D+    +++F+  +++++ A+++     N+  +  E   WI +K K+ +S  + G DL  +  ++ + +   + +   + RV      + QL+ S   + E+I   Q+ ++  W  L      +        ++  F +   DF   ++I   ++ S+
Sbjct:  383 PHDGKLVSDINR---AWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSP----DVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEME-------MPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAA---NSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASE 1087          

HSP 6 Score: 90.8929 bits (224), Expect = 5.901e-17
Identity = 202/975 (20.72%), Postives = 407/975 (41.74%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLK------DRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHA-------NLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKV---LDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD--KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASE-QSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLW--ITEKSYYVNQSDKDL-DNDQIANRIMKLK-SINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAE-------EIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCR 6254
            S NQ+L  +  DN G+D  + E  K+K + +  D  A + R+   + L   ++K    +   +  +   I  L+  LQ  L+ R+  L     + K   D   +   ++E+   + +    K +  VE  +Q+ + ++ +I +     DK+K++ +  LK       +P D   I   +  L+   + L +    R   L+ +    KF+ E D+ ES I ++     S++    +  V    + H         L A +++I      +  RK    P     +I  R  +V    D++  L   C     D EN   F +F  +A++L  W+ D  +LL+ E+   +D        +KHK    E++ +   +E +        +      D V   L+ + E ++++ A  + ++++L +A +  + F E  A  L   +  E  +   ++ + L   + +  + +IL+ E++T M  +  +   A+ + + GH     +      L  R      LV++R   +   L+ H +  D ++  +WI ++ +   +  D GR L   + +  K   L  ++   +  V  L    + L  +  P  K+D+  R K L++ W  L++    ++  L   +  + FL D +D   W  IT+K+       + L + +Q+  +   +K  I+    +Y  + ++      G  D   +  +L + +E +   +N     +ES       + + L  C  F  FQ +  + EA +  ++      E  + L+  E    ++   L S+E   D+V +  ++ N+L+   N  S++I   +E +Q   DR      + N K   A        E+  F + C++ +  +N D +          A +   K +  Q F  EL + +  L++I     +L  + P  + L+ ++++ L+ LW +L     +K   L   R
Sbjct:  439 SENQRL--VAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAI---QGDKVKAITAATLKFTEGKGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHP-----QIEARIKEVSAQWDQLKDLAAFCKKNLQDAEN---FFQFQGDADDLKAWLQDAHRLLSGEDVG-QDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPD-VTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEK-EKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLM-DSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDP--EYLLLGQRLEGLDTGWNALGRMWES-------RSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKI---KEKVQLIEDR----HRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWIN-DKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAAR 1379          

HSP 7 Score: 82.4185 bits (202), Expect = 2.228e-14
Identity = 192/967 (19.86%), Postives = 401/967 (41.47%), Query Frame = 3
Query: 6822 DCVKRRQKLHDNYRDI--ESKLSNQQI-----WLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEA-DNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED--IDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAK-ALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQW-----LLTQNKKCDVILN----------NLKSLSTVEDVTENIDA--------KRSISSLVSA------REQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSD 9599
            D   R Q L + Y+ +  ++ L  Q++       T+  E+D    W+ EK + +  ++   +TLE+   +  ++  L+ E+     + + + + +  LV + HP+S E K    ++  +W    +   +R  A+  A  +  +  + +    W  +K  +V S  +LG DL   +++Q KL+         +AR+D + + + QL+       PE  ++I  R K +   W  L+  L+  ++ L E  +L  +  +L      +    K V  +D    +   E+L ++  GI+ +++   + + +++++ +  I    D  + + +  + + +      L  + + RS  L     + +  KDAK A   +S Q+  L ++   P+  ++A   ++  ++    M N + K    +D   KL  + N+ +  I    E V   +D+     E       + Q A       L + ++L  FL+ C+    W     L +Q+   D   N           +  L++ E   ENIDA        K   ++LVS       R    ++ +  E  + L   + SD++L            + LN+ +  +   L S+   ++L+           N+ML A     ED+VN+       +E + E+ A  P +            E   + + I ++ +DL   L   K       K+L  +  + + +R +E    W+ E   + +S +YG +L +V+   ++   ++ +I  H  +++ + +    ++        D+ E+   + + + +L E        L DA    +++ D      WI ++      +EI      A   +K+H+     +    ++I+ +  +A+ L    H   +QI   +  ++  Y  L +  EER  KL    +  Q   +  ++E  +++K L+ ++ E G D
Sbjct:  818 DVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMP-DTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSH----PEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLL-LGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEP-PDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKI---KEKVQLIEDRHRKNNE-------KAQEA----SVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRL---------QTHADLNKWISAMEDQLRSDDPGKDLTSV---------NRML-AKLKRVEDQVNV------RKEELGELFAQVPSMG----------EEGGDADLSIEKRFLDLLEPLGRRK-------KQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQD 1721          

HSP 8 Score: 79.337 bits (194), Expect = 1.926e-13
Identity = 66/254 (25.98%), Postives = 124/254 (48.82%), Query Frame = 3
Query: 10347 FERDLEAVNSQIEKSNNESNRLQEIYPDAK-DHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDS 11105
            FER+L  +  Q+++  + + RLQ  Y   K + I +K +EV   W  L  A   +R +L +T     +    +DLLSW ++   +I + E  P DV+  ELL+        EI+++S+  +  ++ G+ +        + + EK   +    K M +   +R E     +++ +F  + +  E+WL+  E  + S D     +V  +E+  K HE + K   S   +F A+++ T LE   ++R+  ER A+++
Sbjct: 1841 FERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQER-PRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGD--FGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLE--LKERQIAERPAEET 2089          

HSP 9 Score: 74.7146 bits (182), Expect = 4.595e-12
Identity = 89/384 (23.18%), Postives = 175/384 (45.57%), Query Frame = 3
Query: 8256 EQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITW---IRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSV----EIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDL 9386
            E WL ++N++     N    L+ VE   +  +A   I +  +A E++    +L ++ ++L K+   D K    +  +++  +S L E L    Q L +   LQ+L Q +   I W   I+  +L A    +   + + + ++KH+   +++ A + D   AI       +E           I +++  L+   +EL  M+  +  +L ++ + +K+   ++   SWI E E+I+ S +YG DL SV  L+R+    E ++      L+ I +EA  M+    +    I  +   ++ ++ QL +       NL DAE  ++F  D      W+QD  +L + E++G          K+H   + E+      +E +++QA+  
Sbjct:  435 ETWL-SENQRLVAQDNFGYDLAAVEAAKKKHEA---IETDTAAYEERV--RALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKH--LLEVEDLLQKHKLMEADI-AIQGDKVKAITAATLKFTEGKGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGF 809          

HSP 10 Score: 72.0182 bits (175), Expect = 2.911e-11
Identity = 154/751 (20.51%), Postives = 316/751 (42.08%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDI---LNDDNVGFDKESNENLKRKFQNLLRDI----DAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLA-SIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENAL-KTHANLAAFIDKIDNRVQSLSKRKTELKPNP----DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLE-FAKFDE-NANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESG-KDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDD 5312
            +E  KKK+EAI  D AA   R+  + DL                   A+ L    +  D+ +++ R   I+  W  L +L   + + LE   ++    K   ++  SI+   +I   L     G      E+L +K + +  DI    D +K+         +G K   P +   + ++I  ++  + +L N    RK  L  +  + KF  +  E E  + E   I  +    KD++SV    ++ +  + E+  ++A+L+++   A  +V + +     I + +  +  +   LKD      K+L+DA    +F  + D +++ + Q   +L S       +    AL K H +   F+++++     +   + + +  P    DS  + +R   + +   ++  +   ++  L+  L+ +  F E +A EL  W+ +K   + E    D     E +Q +   L+ E+K+ ++ ++ ++   N L++  HP+   VK     ++ +W+       ++ + +  A     +  +  +  +   D  + +  T  LG DL    ++  K + LE ++      +  L++++ ++       KE+I    + LE     L   +  +   L +  +   F  D+D    W+   + +    D   SLP+A +L  +H  +  EI+GH+     + ESG K +Q +  P Y   +  R + L   W+ L +  + R H L      ++F  D
Sbjct:  457 VEAAKKKHEAIETDTAAYEERVRALEDL-------------------AQELEKENYH-DQKRITARKDNILRLWSYLQELLQSRRQRLETTLAL---QKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEG-KGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWL-QDAHRLLSGEDVGQDEGATRALGKKHKD---FLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACEL--WMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLL-LGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKD 1176          

HSP 11 Score: 68.5514 bits (166), Expect = 3.578e-10
Identity = 41/158 (25.95%), Postives = 79/158 (50.00%), Query Frame = 3
Query: 1821 QRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRH 2294
            +R++QL+ +    ++ RDLE+E  W+   + +  + + G +  +V   +++++  ++EI  H P    +      L +   I   ++ + L  L   W  L    + R   L+DA E Q+YY DA++++ WI E    V++ E   DE     ++KRH
Sbjct: 1469 RRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRH 1626          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 699/2985 (23.42%), Postives = 1373/2985 (46.00%), Query Frame = 3
Query: 2928 IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSG-RITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQ-------IIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDK--LLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVN-LLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGT--KRIQQFSKELENMKTQLDDISMAANKLKIKYP-NNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKT---KQAL----NEWMTKNEHI--LIKQNCL-RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDK---NFWVDEK---LQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVT-NQHPKSEEFKTIVCNILE-KWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISL--KQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEG---------KYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV---KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKE----RIAKDSLWNDDPNTNIKRRETQKVYQEQN--ANDSLHRGNSGSK----IPPVKPVVEDVRSRKLLKKQ---ASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALL 11699
            +  +Q +++  + ELK LA  R+  L  +    +F++ECD F  + K  E       S    +   ++K++ +  D+  N G ++ +I+D+       + ++ E   +                K+  R  +I   W+ L +L+  +   LE    +  F+ T +  RE +  K + L+          N N  +  QNL RD+  ++ ++   + L   VKK +P E   +  KI E+  L+  L    +++            F       E  L ++ G IE         + P DV+  E  +++   L  +I   +  ++  + L   +L+  P  S +   L  L  +M SL+D   +RD  LK  L+ Q F +E ++I++        L+  N   SV+ VEN LK H +L A +D  + R+++ S+   ++    + DS  I  R   VL +   +      +K  LE  LE+ +    A+E+  W+ +K  L+   +++      +P +L KH+A EAEI +N   +++I+  G+ L+ + H +   V+ I++ ++ +W  L     +K  +L QA++Q   +  L D   K D ++  + +   G DL S K L+ KH +LE E+      L+ ++ +  +MA DGH+D + I   + +L  R A +     +R  +L ++  WHQ  FDVD ELQWI E +P A+  D GR+L +A+ +  K ++L  E+N H   +   LL++G+ ++R  S      ++ +S  L+  W  L+K    R+  +D     +Q+L D  ++  W+ EK   +   D   D D     + K +++  D+ TY   L+ +        ++ R     P  VE   K+ +E    F++      D++NALE+      +  E +++   I+E  ++A S EF ED + +++L+ +++   + ++ G +R  +C   AN +L+     + ++   QE ++  W+ L  +   +++K   AEE+H+F++   +F   +  D ++   +   R+     +  +  +   KE+ N + +L  +   A +LK  YP  N++ I      L   W++L    + +   L    D      K+++ LA+ +   + +++D  IN +  A        + +  +   E    +LV+  E +   +   +            E +NKT   K AL    +EW  +N  +   ++ +   R+  QI +S   +   ++       + + E    +   F   +S  D+R   L      L + +H +  NI S++   V    KL    +DIE++ +  +    L     D      W+DEK   +++ + L   + +++EK+  LQ ++AL AE++A++P  +Q++ +  +L   +++PK        C+ L  KW+QL      +S AL+EA+DLL F   ++ V AW  EKE LVS  ++G D++HC  L  +L        VDE  +D I +   +L+++        D ++   + +  +W +L   L  Y+  L  A ++H +  ++    ++I +++  +K  D+G D  SVE L RKQ+ +ERD++A+++K   +   +D    L+    ++ ++    K++++  EQL+   + R++ LN S++ +K + D K +   + Q    +     P DS  A   L+ H E K  ++ R               E+  ++     + N+  P    ++    + + +   + +  W   +  L + ++   + +     EQWL   +K+  V    L          +  DA   +    SA E+   K S  E ++ L K+  +D  ++ G         + + V    + L + + +   ML   K+  E  ++  + I WI  K+ +A D ++ D  NL +K++KH  F SE+  NE  +      G++L+++NH  S ++  ++++L +   EL+T S  K +RL E  +     R+VE    W+++ E    S ++G D++S E L ++   ++ +I    + +  + ++A  +  + +    D  +Q+  +  R+  L E ++    NL DA+  +++      +L+W+ D+M LA+  E G SL  A    K+H TL  E+ TR  ++   +++ +D+  + HFA   I+     L ++   L  +   R + L    +  ++ ++  E E  L ++  L  + E G D+    + +++L  L  E+++  +   +L ++   +     +    +    + L+    ++      +R  I +   Y+ ++R+++++  W++ +      E+YG+D +DC  +IE+F+S  + L A   ++  ++   + L+   +P+   I    + +      + +    RK+AL GA +VH F +EA+ +++W+                +  EA    M+ +     +SR     L+ V+       +F   ++AV  Q+ +  +E+ RL   +PD + H+  +  ++E+    +  A  +   KL   + LQ +  +Y++++ W K     +TS E LP DVA  E L+   +E+ LE+  +   ++   + G  +  ++  + Q ++EK + ++K W  +C+    R ELYE+N+D++K+      L+SWL +   L+   D +   SV   E   ++ +D++  +E++  K D +KR T +E+ F + + KE    RIA+D         + KRR+T K+ ++ N  AN    R    ++    + P  P  E+  +  + +K+    +    D+ P  I+       I DI    + +  ++    + K      SF+T++   +++ +   D+     G+ +                      G   RKQ   S G +A +RSWK YY  L G  L ++KD+   L
Sbjct:  906 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPS-PEHVAAFRRKFDKLEADMKTNGGTQLKHINDI------ANDLISEGHGQS--------------RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLD---------RNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMF-------ESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSA--SSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNR-----PH-VERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWM-ADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASE-----------EIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNI-SMWQSNVHEELKLL--RQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPKIAN----RCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGR---SSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKL--IAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGR--------------SEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWL--SDKETQVARGEL---------GDTTDAVEMLIKGHSAFEETVRKQS--EKIDALTKN--ADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWL----------------QDKEATGVAMEQED----LSR---ADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTS-EQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGD-DWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAED---------DQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRP-SPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQ-------IGDILASSSTVAPLQSGVEMTK----TPSFNTRRTQSIRKGSRWEDM-----GAID--------------------MKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFL 3721          

HSP 2 Score: 543.117 bits (1398), Expect = 3.272e-154
Identity = 343/898 (38.20%), Postives = 516/898 (57.46%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVI-LENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIE--TESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIENDMIEIP-VEDDYDNXXXXXXXXXXXXXXXXTANMWYLAISDYKARDSNGRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLK 2726
            E+SR++ LQ++R  IQKKTFTKW NS L RA+ ++ DLF+D+ DG +LM L+E+IS   LGK NRG +RVQ +EN+NK L +++ K I LENIGAEDI+D N RLILGLIWTIILRFQI  ++IE   E GE+K AKDALLLWCQ KT GY NV I++F  SWR+GLAFNALIH+H P+L+D+++L+P  H  NL  AF +AEK+L I  LLD EDVDV RPD+KSI+TYVS  Y  FAK KTE TGA+R+  IV   +    M +DYE +   LL WI+  I  L  R FPNSLN M++E  +F ++RT EKPPK+ E+  ++   F I  K+K  + K Y P +GL + ++E AW  L+ AE+ R++ +  EL RQE+LEQ A +F+KKA LR+SWL  +  VL  M  G +    E  + K++ ++ +I   ++RF+ L  +   L +  YH  D +     +I +RW +L  L+  ++     L  L+S+LR I T+  E   L+P + + D+GKH +  +DLL KH+L+D Q+ A     ++++  + +++          +Q   L+ +L  ++   N L E+ + RR  L++  +  + ++D EEE  WL+ + K+ T      D ++V +    ++  E E+  H       +   +     + + +G+    I + L  ++  W  L        N L +A   Q+Y+ DA +++ WI E  PLV + + G DEGA ++L++RH  L EEI  + ++D+ RL+E+ + +   +       + V+              E + + +P VE  Y+                                + NG  +S  K EV  +L+K++ EWW    +D  +GY PANY K
Sbjct:   38 ERSRIRTLQDERVHIQKKTFTKWCNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRH------KEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWA-----RSKGMIAGGERLVQNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY-KSDISRLEEMQSQLANSAFHTATTSQSVQ--------------ETEEVNVPQVEMSYNY-------------------------------EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCK 876          

HSP 3 Score: 98.2117 bits (243), Expect = 1.581e-19
Identity = 208/1052 (19.77%), Postives = 425/1052 (40.40%), Query Frame = 3
Query: 2901 NELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSL--EGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGR-LDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--------SKRKTELKPNPDSEKI--------NNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVL----PELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIAD-SNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKS-QNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDF 5978
            +E H     IE +Q ++N ++  L+ L + R + LE +     F   C+S  E+M  K    ++  +    ++ +++  + + D +AA          LE L  ++     E+    + KI        D                    L+  +EK L  E     ++F     ++   I +   ++ +D    D    E L +K   L   I   K  +E  + LG  + +  P  ++ V E+++ +      L++   +R   L    ++  F  +S+  +         +E   +   V SVE  +++   L+ +++  EA L+     A  ++K +  DS       R +  + ++++    +R K L+ +LE Q+  +E D++   +  +    +   +  L+   + + L  H    A I   + R+Q +        SK+  E   +P+ EKI         +   +V +K  +L      K +D   +   AK DE    L+    D+ L        DL ++ + LQKH  LE E+    + L  I + G  +    H   D +   +  + +++  +    + ++  L ++    +   ++   L+     + +  +   G  L  A +++ K   LE+E+      + K+  +A E+ K  H     I  +  +LE   ++L  L+  R + +   +K  Q+ FD  +   W+ E R +    DYG     A KL +KH+ L  ++  ++  +  L     +L     P  ++  + R   L  ++D L K A+DR++ L+ +    +++ +  D+G  I E++  V  S      ++ A     LK +    + +D   + + + +  F       N +    P     V KK       + +    +  + + L   ++   F  ++ E E W+ +  K+A+   + G D++ +  L     +  K I   + R+    E A +L K+     +E+I   Q+ ++ EW+ L      +     AA ++H FN   +D 
Sbjct: 1001 SEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAA----------LEKLAAAVKKDHPEEAAAIERKIAELRALHAD-------------------LLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYE---SPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNS--KDQGL--------DLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVER-FQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSI-EENLRVAMS------EEFAEDYEHLKELQ---SKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMAD--KMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDL 1996          

HSP 4 Score: 88.5817 bits (218), Expect = 1.254e-16
Identity = 66/264 (25.00%), Postives = 134/264 (50.76%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQ 2351
             D ++ +++S D G+  L+ + L++K + +  ++   SD   ++  K+R+    ++      D       Q + +    +GL+E  Q RRE L     + + ++  EE+  WLS+ + + ++ E+G    S L L ++H   E E+       N  +    D+ + +      I K LD LS     L+     RR+LL++A +  +YY +  +++QW+ E  PL +++E G D+   ++ ++R T L +E+ +F +N++ RL+
Sbjct: 2849 LDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKAREL--RVQGSAAADD----CLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELF-KNEIDRLK 3105          

HSP 5 Score: 83.5741 bits (205), Expect = 4.369e-15
Identity = 57/258 (22.09%), Postives = 130/258 (50.39%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDF-LDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
             D ++  +NS D G    + KDLL+KH +++ ++    ++ + I  + +   +D     +   D+  +   QL      + G    +Q+R+  L ++  +H+L+ D++ E  W++ +  + ++++ G      L ++++ E  E+E++ H    +K+ + A +L K       +I      L   W+ L+++   RR ++    + Q+Y  DA + + W+ E    + +++ GNDE A + L+ +H AL E+++ + +
Sbjct: 1470 LDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDG----HYDADRIHSTVGQLLQRYAAMKG---PAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ 1720          

HSP 6 Score: 75.8702 bits (185), Expect = 9.217e-13
Identity = 72/348 (20.69%), Postives = 151/348 (43.39%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSG--KLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAA-KDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLV 2237
            KF ++A     WL E     +  + G  +++ +  I + E    E+    ER   ++    +L  + +    +I+ + +D+Q  W  + ++ N  KQA +G  ++         I     + +     +   DL +  LA+ K  L++H+     +KA+  +  ++ +++    +S       PD R  LE +  ++   +  + E +++  E+L+   +     ++  E   W+ N    MT+++   D AS   L+RRH+ Y  E+    P  +        + ++  +   EI + +D L + W  L  I  +R  L ++  + QK+  +AE    W+ E   L+
Sbjct: 3155 KFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF------PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLL 3496          

HSP 7 Score: 67.0106 bits (162), Expect = 4.723e-10
Identity = 85/366 (23.22%), Postives = 165/366 (45.08%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEE-ENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTV-------EGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEI-RKLELRCAK---LTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYG--RSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIA 5396
            +F + A     W+    + +EE E+ +    + + L+K +A+  +I +     + +    N+L    + + D V+ + + I ++W +L    E +++ L   +       +L  +LR  DT+       E  ++   +G  L   + L+GKH++L++++      L+KL Q A+   +     KE   D + RKL+   A+   L  L   R   L+      QF  D ++E+ W+ E+ +   T  + G   ++P    L   +K +  E+  H      ++  G+ L +  +   K+D++ R   +   W+RL    D   + L  + + +Q+  D N+   WI EK   V +SD DL  D+ A
Sbjct:  424 RFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLN-------DLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIR----HKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLL---YKNVEMEMQTHWARSKGMIAGGERLVQ--NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLV-KSD-DLGRDEGA 771          

HSP 8 Score: 58.9214 bits (141), Expect = 1.302e-7
Identity = 56/326 (17.18%), Postives = 143/326 (43.87%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKK-----------------TYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQ 3830
            H+D  +I  KQ +L  LF +L      R+  +  ++  H+F ++ D   ++++ KE        G    D + I +++E+ + +LAA   R+  +              +ED+      + S  P+    + ++ +  ++   W  +N++  +++++L GA  +  F++  D++       L+ L D          E+L R       D+ ++K++++R      G+K                  ++P   +++  +  ++++    +  A +K    L +  ++  +  + +E  Q +  +   + ++ +P+DV+S E+ +++
Sbjct: 3116 HHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQ-----------RAQEDL------LRSGHPYG---ASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQI-------LNWLQDKEATGVAMEQEDLSRA------DLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRR 3408          

HSP 9 Score: 53.9138 bits (128), Expect = 3.741e-6
Identity = 114/511 (22.31%), Postives = 208/511 (40.70%), Query Frame = 3
Query:  726 ILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNL---LQWI-QKKIIKLN---GRDFPNSLNEMQK-EMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIK--EVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ--ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDG---EIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQW 2213
            I + V  L   +A MK      +R G      L+ SR+   + +LV ++   LQWI +KK I  +   GR    +LN ++K E LE             AE +    ++ +++L+  E   +H+  S  +  K  E+E AW  L+K    R  V+   +  Q        ++   A+  ESW+NE  + L + + G         ++K   +  ++ T ++  +KL+   + L  +N    +    R  ++   +  L  L   ++   +     +            +E ++      S +  + Y   K+L  K +    ++K  S+RF      +   L     +   P  R  ++ Q + L    N L E  + R  +L      H+  RD++E + W+++++  M  ++ G D   V  L + HE  + EI    P   KL   A  L KT   P G   +I      L Q W  L+    +R+++L+ A++   +     D   W
Sbjct: 1531 IHSTVGQLLQRYAAMK--GPAQRRKGD-----LDESRL---WHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLE-------------AEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQ--------QYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAM--SEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAIL-----RRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMP-RDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKT--YPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAW 1999          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 699/2985 (23.42%), Postives = 1373/2985 (46.00%), Query Frame = 3
Query: 2928 IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSG-RITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQ-------IIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDK--LLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVN-LLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGT--KRIQQFSKELENMKTQLDDISMAANKLKIKYP-NNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKT---KQAL----NEWMTKNEHI--LIKQNCL-RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDK---NFWVDEK---LQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVT-NQHPKSEEFKTIVCNILE-KWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISL--KQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEG---------KYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV---KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKE----RIAKDSLWNDDPNTNIKRRETQKVYQEQN--ANDSLHRGNSGSK----IPPVKPVVEDVRSRKLLKKQ---ASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALL 11699
            +  +Q +++  + ELK LA  R+  L  +    +F++ECD F  + K  E       S    +   ++K++ +  D+  N G ++ +I+D+       + ++ E   +                K+  R  +I   W+ L +L+  +   LE    +  F+ T +  RE +  K + L+          N N  +  QNL RD+  ++ ++   + L   VKK +P E   +  KI E+  L+  L    +++            F       E  L ++ G IE         + P DV+  E  +++   L  +I   +  ++  + L   +L+  P  S +   L  L  +M SL+D   +RD  LK  L+ Q F +E ++I++        L+  N   SV+ VEN LK H +L A +D  + R+++ S+   ++    + DS  I  R   VL +   +      +K  LE  LE+ +    A+E+  W+ +K  L+   +++      +P +L KH+A EAEI +N   +++I+  G+ L+ + H +   V+ I++ ++ +W  L     +K  +L QA++Q   +  L D   K D ++  + +   G DL S K L+ KH +LE E+      L+ ++ +  +MA DGH+D + I   + +L  R A +     +R  +L ++  WHQ  FDVD ELQWI E +P A+  D GR+L +A+ +  K ++L  E+N H   +   LL++G+ ++R  S      ++ +S  L+  W  L+K    R+  +D     +Q+L D  ++  W+ EK   +   D   D D     + K +++  D+ TY   L+ +        ++ R     P  VE   K+ +E    F++      D++NALE+      +  E +++   I+E  ++A S EF ED + +++L+ +++   + ++ G +R  +C   AN +L+     + ++   QE ++  W+ L  +   +++K   AEE+H+F++   +F   +  D ++   +   R+     +  +  +   KE+ N + +L  +   A +LK  YP  N++ I      L   W++L    + +   L    D      K+++ LA+ +   + +++D  IN +  A        + +  +   E    +LV+  E +   +   +            E +NKT   K AL    +EW  +N  +   ++ +   R+  QI +S   +   ++       + + E    +   F   +S  D+R   L      L + +H +  NI S++   V    KL    +DIE++ +  +    L     D      W+DEK   +++ + L   + +++EK+  LQ ++AL AE++A++P  +Q++ +  +L   +++PK        C+ L  KW+QL      +S AL+EA+DLL F   ++ V AW  EKE LVS  ++G D++HC  L  +L        VDE  +D I +   +L+++        D ++   + +  +W +L   L  Y+  L  A ++H +  ++    ++I +++  +K  D+G D  SVE L RKQ+ +ERD++A+++K   +   +D    L+    ++ ++    K++++  EQL+   + R++ LN S++ +K + D K +   + Q    +     P DS  A   L+ H E K  ++ R               E+  ++     + N+  P    ++    + + +   + +  W   +  L + ++   + +     EQWL   +K+  V    L          +  DA   +    SA E+   K S  E ++ L K+  +D  ++ G         + + V    + L + + +   ML   K+  E  ++  + I WI  K+ +A D ++ D  NL +K++KH  F SE+  NE  +      G++L+++NH  S ++  ++++L +   EL+T S  K +RL E  +     R+VE    W+++ E    S ++G D++S E L ++   ++ +I    + +  + ++A  +  + +    D  +Q+  +  R+  L E ++    NL DA+  +++      +L+W+ D+M LA+  E G SL  A    K+H TL  E+ TR  ++   +++ +D+  + HFA   I+     L ++   L  +   R + L    +  ++ ++  E E  L ++  L  + E G D+    + +++L  L  E+++  +   +L ++   +     +    +    + L+    ++      +R  I +   Y+ ++R+++++  W++ +      E+YG+D +DC  +IE+F+S  + L A   ++  ++   + L+   +P+   I    + +      + +    RK+AL GA +VH F +EA+ +++W+                +  EA    M+ +     +SR     L+ V+       +F   ++AV  Q+ +  +E+ RL   +PD + H+  +  ++E+    +  A  +   KL   + LQ +  +Y++++ W K     +TS E LP DVA  E L+   +E+ LE+  +   ++   + G  +  ++  + Q ++EK + ++K W  +C+    R ELYE+N+D++K+      L+SWL +   L+   D +   SV   E   ++ +D++  +E++  K D +KR T +E+ F + + KE    RIA+D         + KRR+T K+ ++ N  AN    R    ++    + P  P  E+  +  + +K+    +    D+ P  I+       I DI    + +  ++    + K      SF+T++   +++ +   D+     G+ +                      G   RKQ   S G +A +RSWK YY  L G  L ++KD+   L
Sbjct: 1009 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPS-PEHVAAFRRKFDKLEADMKTNGGTQLKHINDI------ANDLISEGHGQS--------------RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLD---------RNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMF-------ESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSA--SSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNR-----PH-VERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWM-ADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASE-----------EIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNI-SMWQSNVHEELKLL--RQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPKIAN----RCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGR---SSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKL--IAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGR--------------SEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWL--SDKETQVARGEL---------GDTTDAVEMLIKGHSAFEETVRKQS--EKIDALTKN--ADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWL----------------QDKEATGVAMEQED----LSR---ADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTS-EQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGD-DWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAED---------DQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRP-SPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQ-------IGDILASSSTVAPLQSGVEMTK----TPSFNTRRTQSIRKGSRWEDM-----GAID--------------------MKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFL 3824          

HSP 2 Score: 543.117 bits (1398), Expect = 3.714e-154
Identity = 343/898 (38.20%), Postives = 516/898 (57.46%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVI-LENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIE--TESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIENDMIEIP-VEDDYDNXXXXXXXXXXXXXXXXTANMWYLAISDYKARDSNGRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLK 2726
            E+SR++ LQ++R  IQKKTFTKW NS L RA+ ++ DLF+D+ DG +LM L+E+IS   LGK NRG +RVQ +EN+NK L +++ K I LENIGAEDI+D N RLILGLIWTIILRFQI  ++IE   E GE+K AKDALLLWCQ KT GY NV I++F  SWR+GLAFNALIH+H P+L+D+++L+P  H  NL  AF +AEK+L I  LLD EDVDV RPD+KSI+TYVS  Y  FAK KTE TGA+R+  IV   +    M +DYE +   LL WI+  I  L  R FPNSLN M++E  +F ++RT EKPPK+ E+  ++   F I  K+K  + K Y P +GL + ++E AW  L+ AE+ R++ +  EL RQE+LEQ A +F+KKA LR+SWL  +  VL  M  G +    E  + K++ ++ +I   ++RF+ L  +   L +  YH  D +     +I +RW +L  L+  ++     L  L+S+LR I T+  E   L+P + + D+GKH +  +DLL KH+L+D Q+ A     ++++  + +++          +Q   L+ +L  ++   N L E+ + RR  L++  +  + ++D EEE  WL+ + K+ T      D ++V +    ++  E E+  H       +   +     + + +G+    I + L  ++  W  L        N L +A   Q+Y+ DA +++ WI E  PLV + + G DEGA ++L++RH  L EEI  + ++D+ RL+E+ + +   +       + V+              E + + +P VE  Y+                                + NG  +S  K EV  +L+K++ EWW    +D  +GY PANY K
Sbjct:  141 ERSRIRTLQDERVHIQKKTFTKWCNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRH------KEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWA-----RSKGMIAGGERLVQNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY-KSDISRLEEMQSQLANSAFHTATTSQSVQ--------------ETEEVNVPQVEMSYNY-------------------------------EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCK 979          

HSP 3 Score: 98.2117 bits (243), Expect = 1.434e-19
Identity = 208/1052 (19.77%), Postives = 425/1052 (40.40%), Query Frame = 3
Query: 2901 NELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSL--EGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGR-LDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--------SKRKTELKPNPDSEKI--------NNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVL----PELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIAD-SNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKS-QNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDF 5978
            +E H     IE +Q ++N ++  L+ L + R + LE +     F   C+S  E+M  K    ++  +    ++ +++  + + D +AA          LE L  ++     E+    + KI        D                    L+  +EK L  E     ++F     ++   I +   ++ +D    D    E L +K   L   I   K  +E  + LG  + +  P  ++ V E+++ +      L++   +R   L    ++  F  +S+  +         +E   +   V SVE  +++   L+ +++  EA L+     A  ++K +  DS       R +  + ++++    +R K L+ +LE Q+  +E D++   +  +    +   +  L+   + + L  H    A I   + R+Q +        SK+  E   +P+ EKI         +   +V +K  +L      K +D   +   AK DE    L+    D+ L        DL ++ + LQKH  LE E+    + L  I + G  +    H   D +   +  + +++  +    + ++  L ++    +   ++   L+     + +  +   G  L  A +++ K   LE+E+      + K+  +A E+ K  H     I  +  +LE   ++L  L+  R + +   +K  Q+ FD  +   W+ E R +    DYG     A KL +KH+ L  ++  ++  +  L     +L     P  ++  + R   L  ++D L K A+DR++ L+ +    +++ +  D+G  I E++  V  S      ++ A     LK +    + +D   + + + +  F       N +    P     V KK       + +    +  + + L   ++   F  ++ E E W+ +  K+A+   + G D++ +  L     +  K I   + R+    E A +L K+     +E+I   Q+ ++ EW+ L      +     AA ++H FN   +D 
Sbjct: 1104 SEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAA----------LEKLAAAVKKDHPEEAAAIERKIAELRALHAD-------------------LLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYE---SPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNS--KDQGL--------DLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVER-FQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSI-EENLRVAMS------EEFAEDYEHLKELQ---SKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMAD--KMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDL 2099          

HSP 4 Score: 88.1965 bits (217), Expect = 1.511e-16
Identity = 66/264 (25.00%), Postives = 134/264 (50.76%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQ 2351
             D ++ +++S D G+  L+ + L++K + +  ++   SD   ++  K+R+    ++      D       Q + +    +GL+E  Q RRE L     + + ++  EE+  WLS+ + + ++ E+G    S L L ++H   E E+       N  +    D+ + +      I K LD LS     L+     RR+LL++A +  +YY +  +++QW+ E  PL +++E G D+   ++ ++R T L +E+ +F +N++ RL+
Sbjct: 2952 LDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKAREL--RVQGSAAADD----CLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELF-KNEIDRLK 3208          

HSP 5 Score: 83.5741 bits (205), Expect = 4.529e-15
Identity = 57/258 (22.09%), Postives = 130/258 (50.39%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDF-LDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
             D ++  +NS D G    + KDLL+KH +++ ++    ++ + I  + +   +D     +   D+  +   QL      + G    +Q+R+  L ++  +H+L+ D++ E  W++ +  + ++++ G      L ++++ E  E+E++ H    +K+ + A +L K       +I      L   W+ L+++   RR ++    + Q+Y  DA + + W+ E    + +++ GNDE A + L+ +H AL E+++ + +
Sbjct: 1573 LDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDG----HYDADRIHSTVGQLLQRYAAMKG---PAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ 1823          

HSP 6 Score: 75.8702 bits (185), Expect = 9.551e-13
Identity = 72/348 (20.69%), Postives = 151/348 (43.39%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSG--KLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAA-KDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLV 2237
            KF ++A     WL E     +  + G  +++ +  I + E    E+    ER   ++    +L  + +    +I+ + +D+Q  W  + ++ N  KQA +G  ++         I     + +     +   DL +  LA+ K  L++H+     +KA+  +  ++ +++    +S       PD R  LE +  ++   +  + E +++  E+L+   +     ++  E   W+ N    MT+++   D AS   L+RRH+ Y  E+    P  +        + ++  +   EI + +D L + W  L  I  +R  L ++  + QK+  +AE    W+ E   L+
Sbjct: 3258 KFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF------PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLL 3599          

HSP 7 Score: 67.0106 bits (162), Expect = 4.934e-10
Identity = 85/366 (23.22%), Postives = 165/366 (45.08%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEE-ENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTV-------EGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEI-RKLELRCAK---LTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYG--RSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIA 5396
            +F + A     W+    + +EE E+ +    + + L+K +A+  +I +     + +    N+L    + + D V+ + + I ++W +L    E +++ L   +       +L  +LR  DT+       E  ++   +G  L   + L+GKH++L++++      L+KL Q A+   +     KE   D + RKL+   A+   L  L   R   L+      QF  D ++E+ W+ E+ +   T  + G   ++P    L   +K +  E+  H      ++  G+ L +  +   K+D++ R   +   W+RL    D   + L  + + +Q+  D N+   WI EK   V +SD DL  D+ A
Sbjct:  527 RFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLN-------DLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIR----HKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLL---YKNVEMEMQTHWARSKGMIAGGERLVQ--NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLV-KSD-DLGRDEGA 874          

HSP 8 Score: 58.5362 bits (140), Expect = 1.516e-7
Identity = 56/326 (17.18%), Postives = 143/326 (43.87%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKK-----------------TYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQ 3830
            H+D  +I  KQ +L  LF +L      R+  +  ++  H+F ++ D   ++++ KE        G    D + I +++E+ + +LAA   R+  +              +ED+      + S  P+    + ++ +  ++   W  +N++  +++++L GA  +  F++  D++       L+ L D          E+L R       D+ ++K++++R      G+K                  ++P   +++  +  ++++    +  A +K    L +  ++  +  + +E  Q +  +   + ++ +P+DV+S E+ +++
Sbjct: 3219 HHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQ-----------RAQEDL------LRSGHPYG---ASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQI-------LNWLQDKEATGVAMEQEDLSRA------DLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRR 3511          

HSP 9 Score: 53.9138 bits (128), Expect = 3.684e-6
Identity = 114/511 (22.31%), Postives = 208/511 (40.70%), Query Frame = 3
Query:  726 ILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNL---LQWI-QKKIIKLN---GRDFPNSLNEMQK-EMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIK--EVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ--ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDG---EIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQW 2213
            I + V  L   +A MK      +R G      L+ SR+   + +LV ++   LQWI +KK I  +   GR    +LN ++K E LE             AE +    ++ +++L+  E   +H+  S  +  K  E+E AW  L+K    R  V+   +  Q        ++   A+  ESW+NE  + L + + G         ++K   +  ++ T ++  +KL+   + L  +N    +    R  ++   +  L  L   ++   +     +            +E ++      S +  + Y   K+L  K +    ++K  S+RF      +   L     +   P  R  ++ Q + L    N L E  + R  +L      H+  RD++E + W+++++  M  ++ G D   V  L + HE  + EI    P   KL   A  L KT   P G   +I      L Q W  L+    +R+++L+ A++   +     D   W
Sbjct: 1634 IHSTVGQLLQRYAAMK--GPAQRRKGD-----LDESRL---WHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLE-------------AEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQ--------QYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAM--SEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAIL-----RRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMP-RDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKT--YPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAW 2102          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 699/2985 (23.42%), Postives = 1373/2985 (46.00%), Query Frame = 3
Query: 2928 IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSG-RITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQ-------IIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDK--LLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVN-LLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGT--KRIQQFSKELENMKTQLDDISMAANKLKIKYP-NNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKT---KQAL----NEWMTKNEHI--LIKQNCL-RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDK---NFWVDEK---LQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVT-NQHPKSEEFKTIVCNILE-KWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISL--KQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEG---------KYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV---KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKE----RIAKDSLWNDDPNTNIKRRETQKVYQEQN--ANDSLHRGNSGSK----IPPVKPVVEDVRSRKLLKKQ---ASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALL 11699
            +  +Q +++  + ELK LA  R+  L  +    +F++ECD F  + K  E       S    +   ++K++ +  D+  N G ++ +I+D+       + ++ E   +                K+  R  +I   W+ L +L+  +   LE    +  F+ T +  RE +  K + L+          N N  +  QNL RD+  ++ ++   + L   VKK +P E   +  KI E+  L+  L    +++            F       E  L ++ G IE         + P DV+  E  +++   L  +I   +  ++  + L   +L+  P  S +   L  L  +M SL+D   +RD  LK  L+ Q F +E ++I++        L+  N   SV+ VEN LK H +L A +D  + R+++ S+   ++    + DS  I  R   VL +   +      +K  LE  LE+ +    A+E+  W+ +K  L+   +++      +P +L KH+A EAEI +N   +++I+  G+ L+ + H +   V+ I++ ++ +W  L     +K  +L QA++Q   +  L D   K D ++  + +   G DL S K L+ KH +LE E+      L+ ++ +  +MA DGH+D + I   + +L  R A +     +R  +L ++  WHQ  FDVD ELQWI E +P A+  D GR+L +A+ +  K ++L  E+N H   +   LL++G+ ++R  S      ++ +S  L+  W  L+K    R+  +D     +Q+L D  ++  W+ EK   +   D   D D     + K +++  D+ TY   L+ +        ++ R     P  VE   K+ +E    F++      D++NALE+      +  E +++   I+E  ++A S EF ED + +++L+ +++   + ++ G +R  +C   AN +L+     + ++   QE ++  W+ L  +   +++K   AEE+H+F++   +F   +  D ++   +   R+     +  +  +   KE+ N + +L  +   A +LK  YP  N++ I      L   W++L    + +   L    D      K+++ LA+ +   + +++D  IN +  A        + +  +   E    +LV+  E +   +   +            E +NKT   K AL    +EW  +N  +   ++ +   R+  QI +S   +   ++       + + E    +   F   +S  D+R   L      L + +H +  NI S++   V    KL    +DIE++ +  +    L     D      W+DEK   +++ + L   + +++EK+  LQ ++AL AE++A++P  +Q++ +  +L   +++PK        C+ L  KW+QL      +S AL+EA+DLL F   ++ V AW  EKE LVS  ++G D++HC  L  +L        VDE  +D I +   +L+++        D ++   + +  +W +L   L  Y+  L  A ++H +  ++    ++I +++  +K  D+G D  SVE L RKQ+ +ERD++A+++K   +   +D    L+    ++ ++    K++++  EQL+   + R++ LN S++ +K + D K +   + Q    +     P DS  A   L+ H E K  ++ R               E+  ++     + N+  P    ++    + + +   + +  W   +  L + ++   + +     EQWL   +K+  V    L          +  DA   +    SA E+   K S  E ++ L K+  +D  ++ G         + + V    + L + + +   ML   K+  E  ++  + I WI  K+ +A D ++ D  NL +K++KH  F SE+  NE  +      G++L+++NH  S ++  ++++L +   EL+T S  K +RL E  +     R+VE    W+++ E    S ++G D++S E L ++   ++ +I    + +  + ++A  +  + +    D  +Q+  +  R+  L E ++    NL DA+  +++      +L+W+ D+M LA+  E G SL  A    K+H TL  E+ TR  ++   +++ +D+  + HFA   I+     L ++   L  +   R + L    +  ++ ++  E E  L ++  L  + E G D+    + +++L  L  E+++  +   +L ++   +     +    +    + L+    ++      +R  I +   Y+ ++R+++++  W++ +      E+YG+D +DC  +IE+F+S  + L A   ++  ++   + L+   +P+   I    + +      + +    RK+AL GA +VH F +EA+ +++W+                +  EA    M+ +     +SR     L+ V+       +F   ++AV  Q+ +  +E+ RL   +PD + H+  +  ++E+    +  A  +   KL   + LQ +  +Y++++ W K     +TS E LP DVA  E L+   +E+ LE+  +   ++   + G  +  ++  + Q ++EK + ++K W  +C+    R ELYE+N+D++K+      L+SWL +   L+   D +   SV   E   ++ +D++  +E++  K D +KR T +E+ F + + KE    RIA+D         + KRR+T K+ ++ N  AN    R    ++    + P  P  E+  +  + +K+    +    D+ P  I+       I DI    + +  ++    + K      SF+T++   +++ +   D+     G+ +                      G   RKQ   S G +A +RSWK YY  L G  L ++KD+   L
Sbjct:  906 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPS-PEHVAAFRRKFDKLEADMKTNGGTQLKHINDI------ANDLISEGHGQS--------------RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLD---------RNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMF-------ESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSA--SSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNR-----PH-VERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWM-ADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASE-----------EIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNI-SMWQSNVHEELKLL--RQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPKIAN----RCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGR---SSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKL--IAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGR--------------SEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWL--SDKETQVARGEL---------GDTTDAVEMLIKGHSAFEETVRKQS--EKIDALTKN--ADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWL----------------QDKEATGVAMEQED----LSR---ADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTS-EQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGD-DWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAED---------DQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRP-SPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQ-------IGDILASSSTVAPLQSGVEMTK----TPSFNTRRTQSIRKGSRWEDM-----GAID--------------------MKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFL 3721          

HSP 2 Score: 542.347 bits (1396), Expect = 4.945e-154
Identity = 343/898 (38.20%), Postives = 516/898 (57.46%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVI-LENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIE--TESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIENDMIEIP-VEDDYDNXXXXXXXXXXXXXXXXTANMWYLAISDYKARDSNGRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLK 2726
            E+SR++ LQ++R  IQKKTFTKW NS L RA+ ++ DLF+D+ DG +LM L+E+IS   LGK NRG +RVQ +EN+NK L +++ K I LENIGAEDI+D N RLILGLIWTIILRFQI  ++IE   E GE+K AKDALLLWCQ KT GY NV I++F  SWR+GLAFNALIH+H P+L+D+++L+P  H  NL  AF +AEK+L I  LLD EDVDV RPD+KSI+TYVS  Y  FAK KTE TGA+R+  IV   +    M +DYE +   LL WI+  I  L  R FPNSLN M++E  +F ++RT EKPPK+ E+  ++   F I  K+K  + K Y P +GL + ++E AW  L+ AE+ R++ +  EL RQE+LEQ A +F+KKA LR+SWL  +  VL  M  G +    E  + K++ ++ +I   ++RF+ L  +   L +  YH  D +     +I +RW +L  L+  ++     L  L+S+LR I T+  E   L+P + + D+GKH +  +DLL KH+L+D Q+ A     ++++  + +++          +Q   L+ +L  ++   N L E+ + RR  L++  +  + ++D EEE  WL+ + K+ T      D ++V +    ++  E E+  H       +   +     + + +G+    I + L  ++  W  L        N L +A   Q+Y+ DA +++ WI E  PLV + + G DEGA ++L++RH  L EEI  + ++D+ RL+E+ + +   +       + V+              E + + +P VE  Y+                                + NG  +S  K EV  +L+K++ EWW    +D  +GY PANY K
Sbjct:   38 ERSRIRTLQDERVHIQKKTFTKWCNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRH------KEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWA-----RSKGMIAGGERLVQNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY-KSDISRLEEMQSQLANSAFHTATTSQSVQ--------------ETEEVNVPQVEMSYNY-------------------------------EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCK 876          

HSP 3 Score: 97.8265 bits (242), Expect = 2.113e-19
Identity = 208/1052 (19.77%), Postives = 425/1052 (40.40%), Query Frame = 3
Query: 2901 NELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSL--EGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGR-LDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--------SKRKTELKPNPDSEKI--------NNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVL----PELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIAD-SNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKS-QNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDF 5978
            +E H     IE +Q ++N ++  L+ L + R + LE +     F   C+S  E+M  K    ++  +    ++ +++  + + D +AA          LE L  ++     E+    + KI        D                    L+  +EK L  E     ++F     ++   I +   ++ +D    D    E L +K   L   I   K  +E  + LG  + +  P  ++ V E+++ +      L++   +R   L    ++  F  +S+  +         +E   +   V SVE  +++   L+ +++  EA L+     A  ++K +  DS       R +  + ++++    +R K L+ +LE Q+  +E D++   +  +    +   +  L+   + + L  H    A I   + R+Q +        SK+  E   +P+ EKI         +   +V +K  +L      K +D   +   AK DE    L+    D+ L        DL ++ + LQKH  LE E+    + L  I + G  +    H   D +   +  + +++  +    + ++  L ++    +   ++   L+     + +  +   G  L  A +++ K   LE+E+      + K+  +A E+ K  H     I  +  +LE   ++L  L+  R + +   +K  Q+ FD  +   W+ E R +    DYG     A KL +KH+ L  ++  ++  +  L     +L     P  ++  + R   L  ++D L K A+DR++ L+ +    +++ +  D+G  I E++  V  S      ++ A     LK +    + +D   + + + +  F       N +    P     V KK       + +    +  + + L   ++   F  ++ E E W+ +  K+A+   + G D++ +  L     +  K I   + R+    E A +L K+     +E+I   Q+ ++ EW+ L      +     AA ++H FN   +D 
Sbjct: 1001 SEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAA----------LEKLAAAVKKDHPEEAAAIERKIAELRALHAD-------------------LLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYE---SPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNS--KDQGL--------DLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVER-FQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSI-EENLRVAMS------EEFAEDYEHLKELQ---SKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMAD--KMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDL 1996          

HSP 4 Score: 88.5817 bits (218), Expect = 1.453e-16
Identity = 66/264 (25.00%), Postives = 134/264 (50.76%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQ 2351
             D ++ +++S D G+  L+ + L++K + +  ++   SD   ++  K+R+    ++      D       Q + +    +GL+E  Q RRE L     + + ++  EE+  WLS+ + + ++ E+G    S L L ++H   E E+       N  +    D+ + +      I K LD LS     L+     RR+LL++A +  +YY +  +++QW+ E  PL +++E G D+   ++ ++R T L +E+ +F +N++ RL+
Sbjct: 2849 LDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKAREL--RVQGSAAADD----CLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELF-KNEIDRLK 3105          

HSP 5 Score: 83.5741 bits (205), Expect = 4.285e-15
Identity = 57/258 (22.09%), Postives = 130/258 (50.39%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDF-LDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
             D ++  +NS D G    + KDLL+KH +++ ++    ++ + I  + +   +D     +   D+  +   QL      + G    +Q+R+  L ++  +H+L+ D++ E  W++ +  + ++++ G      L ++++ E  E+E++ H    +K+ + A +L K       +I      L   W+ L+++   RR ++    + Q+Y  DA + + W+ E    + +++ GNDE A + L+ +H AL E+++ + +
Sbjct: 1470 LDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDG----HYDADRIHSTVGQLLQRYAAMKG---PAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ 1720          

HSP 6 Score: 75.8702 bits (185), Expect = 9.508e-13
Identity = 72/348 (20.69%), Postives = 151/348 (43.39%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSG--KLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAA-KDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLV 2237
            KF ++A     WL E     +  + G  +++ +  I + E    E+    ER   ++    +L  + +    +I+ + +D+Q  W  + ++ N  KQA +G  ++         I     + +     +   DL +  LA+ K  L++H+     +KA+  +  ++ +++    +S       PD R  LE +  ++   +  + E +++  E+L+   +     ++  E   W+ N    MT+++   D AS   L+RRH+ Y  E+    P  +        + ++  +   EI + +D L + W  L  I  +R  L ++  + QK+  +AE    W+ E   L+
Sbjct: 3155 KFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF------PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLL 3496          

HSP 7 Score: 66.6254 bits (161), Expect = 6.266e-10
Identity = 85/366 (23.22%), Postives = 165/366 (45.08%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEE-ENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTV-------EGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEI-RKLELRCAK---LTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYG--RSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIA 5396
            +F + A     W+    + +EE E+ +    + + L+K +A+  +I +     + +    N+L    + + D V+ + + I ++W +L    E +++ L   +       +L  +LR  DT+       E  ++   +G  L   + L+GKH++L++++      L+KL Q A+   +     KE   D + RKL+   A+   L  L   R   L+      QF  D ++E+ W+ E+ +   T  + G   ++P    L   +K +  E+  H      ++  G+ L +  +   K+D++ R   +   W+RL    D   + L  + + +Q+  D N+   WI EK   V +SD DL  D+ A
Sbjct:  424 RFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLN-------DLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIR----HKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLL---YKNVEMEMQTHWARSKGMIAGGERLVQ--NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLV-KSD-DLGRDEGA 771          

HSP 8 Score: 58.9214 bits (141), Expect = 1.216e-7
Identity = 56/326 (17.18%), Postives = 143/326 (43.87%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKK-----------------TYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQ 3830
            H+D  +I  KQ +L  LF +L      R+  +  ++  H+F ++ D   ++++ KE        G    D + I +++E+ + +LAA   R+  +              +ED+      + S  P+    + ++ +  ++   W  +N++  +++++L GA  +  F++  D++       L+ L D          E+L R       D+ ++K++++R      G+K                  ++P   +++  +  ++++    +  A +K    L +  ++  +  + +E  Q +  +   + ++ +P+DV+S E+ +++
Sbjct: 3116 HHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQ-----------RAQEDL------LRSGHPYG---ASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQI-------LNWLQDKEATGVAMEQEDLSRA------DLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRR 3408          

HSP 9 Score: 53.5286 bits (127), Expect = 4.529e-6
Identity = 114/511 (22.31%), Postives = 208/511 (40.70%), Query Frame = 3
Query:  726 ILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNL---LQWI-QKKIIKLN---GRDFPNSLNEMQK-EMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIK--EVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ--ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDG---EIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQW 2213
            I + V  L   +A MK      +R G      L+ SR+   + +LV ++   LQWI +KK I  +   GR    +LN ++K E LE             AE +    ++ +++L+  E   +H+  S  +  K  E+E AW  L+K    R  V+   +  Q        ++   A+  ESW+NE  + L + + G         ++K   +  ++ T ++  +KL+   + L  +N    +    R  ++   +  L  L   ++   +     +            +E ++      S +  + Y   K+L  K +    ++K  S+RF      +   L     +   P  R  ++ Q + L    N L E  + R  +L      H+  RD++E + W+++++  M  ++ G D   V  L + HE  + EI    P   KL   A  L KT   P G   +I      L Q W  L+    +R+++L+ A++   +     D   W
Sbjct: 1531 IHSTVGQLLQRYAAMK--GPAQRRKGD-----LDESRL---WHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLE-------------AEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQ--------QYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAM--SEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAIL-----RRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMP-RDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKT--YPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAW 1999          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 699/2985 (23.42%), Postives = 1373/2985 (46.00%), Query Frame = 3
Query: 2928 IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSG-RITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQ-------IIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDK--LLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVN-LLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGT--KRIQQFSKELENMKTQLDDISMAANKLKIKYP-NNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKT---KQAL----NEWMTKNEHI--LIKQNCL-RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDK---NFWVDEK---LQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVT-NQHPKSEEFKTIVCNILE-KWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISL--KQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEG---------KYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV---KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKE----RIAKDSLWNDDPNTNIKRRETQKVYQEQN--ANDSLHRGNSGSK----IPPVKPVVEDVRSRKLLKKQ---ASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALL 11699
            +  +Q +++  + ELK LA  R+  L  +    +F++ECD F  + K  E       S    +   ++K++ +  D+  N G ++ +I+D+       + ++ E   +                K+  R  +I   W+ L +L+  +   LE    +  F+ T +  RE +  K + L+          N N  +  QNL RD+  ++ ++   + L   VKK +P E   +  KI E+  L+  L    +++            F       E  L ++ G IE         + P DV+  E  +++   L  +I   +  ++  + L   +L+  P  S +   L  L  +M SL+D   +RD  LK  L+ Q F +E ++I++        L+  N   SV+ VEN LK H +L A +D  + R+++ S+   ++    + DS  I  R   VL +   +      +K  LE  LE+ +    A+E+  W+ +K  L+   +++      +P +L KH+A EAEI +N   +++I+  G+ L+ + H +   V+ I++ ++ +W  L     +K  +L QA++Q   +  L D   K D ++  + +   G DL S K L+ KH +LE E+      L+ ++ +  +MA DGH+D + I   + +L  R A +     +R  +L ++  WHQ  FDVD ELQWI E +P A+  D GR+L +A+ +  K ++L  E+N H   +   LL++G+ ++R  S      ++ +S  L+  W  L+K    R+  +D     +Q+L D  ++  W+ EK   +   D   D D     + K +++  D+ TY   L+ +        ++ R     P  VE   K+ +E    F++      D++NALE+      +  E +++   I+E  ++A S EF ED + +++L+ +++   + ++ G +R  +C   AN +L+     + ++   QE ++  W+ L  +   +++K   AEE+H+F++   +F   +  D ++   +   R+     +  +  +   KE+ N + +L  +   A +LK  YP  N++ I      L   W++L    + +   L    D      K+++ LA+ +   + +++D  IN +  A        + +  +   E    +LV+  E +   +   +            E +NKT   K AL    +EW  +N  +   ++ +   R+  QI +S   +   ++       + + E    +   F   +S  D+R   L      L + +H +  NI S++   V    KL    +DIE++ +  +    L     D      W+DEK   +++ + L   + +++EK+  LQ ++AL AE++A++P  +Q++ +  +L   +++PK        C+ L  KW+QL      +S AL+EA+DLL F   ++ V AW  EKE LVS  ++G D++HC  L  +L        VDE  +D I +   +L+++        D ++   + +  +W +L   L  Y+  L  A ++H +  ++    ++I +++  +K  D+G D  SVE L RKQ+ +ERD++A+++K   +   +D    L+    ++ ++    K++++  EQL+   + R++ LN S++ +K + D K +   + Q    +     P DS  A   L+ H E K  ++ R               E+  ++     + N+  P    ++    + + +   + +  W   +  L + ++   + +     EQWL   +K+  V    L          +  DA   +    SA E+   K S  E ++ L K+  +D  ++ G         + + V    + L + + +   ML   K+  E  ++  + I WI  K+ +A D ++ D  NL +K++KH  F SE+  NE  +      G++L+++NH  S ++  ++++L +   EL+T S  K +RL E  +     R+VE    W+++ E    S ++G D++S E L ++   ++ +I    + +  + ++A  +  + +    D  +Q+  +  R+  L E ++    NL DA+  +++      +L+W+ D+M LA+  E G SL  A    K+H TL  E+ TR  ++   +++ +D+  + HFA   I+     L ++   L  +   R + L    +  ++ ++  E E  L ++  L  + E G D+    + +++L  L  E+++  +   +L ++   +     +    +    + L+    ++      +R  I +   Y+ ++R+++++  W++ +      E+YG+D +DC  +IE+F+S  + L A   ++  ++   + L+   +P+   I    + +      + +    RK+AL GA +VH F +EA+ +++W+                +  EA    M+ +     +SR     L+ V+       +F   ++AV  Q+ +  +E+ RL   +PD + H+  +  ++E+    +  A  +   KL   + LQ +  +Y++++ W K     +TS E LP DVA  E L+   +E+ LE+  +   ++   + G  +  ++  + Q ++EK + ++K W  +C+    R ELYE+N+D++K+      L+SWL +   L+   D +   SV   E   ++ +D++  +E++  K D +KR T +E+ F + + KE    RIA+D         + KRR+T K+ ++ N  AN    R    ++    + P  P  E+  +  + +K+    +    D+ P  I+       I DI    + +  ++    + K      SF+T++   +++ +   D+     G+ +                      G   RKQ   S G +A +RSWK YY  L G  L ++KD+   L
Sbjct:  823 VADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEPS-PEHVAAFRRKFDKLEADMKTNGGTQLKHINDI------ANDLISEGHGQS--------------RKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLD---------RNPNDVKSLQNLERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMF-------ESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSA--SSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNR-----PH-VERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWM-ADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASE-----------EIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNI-SMWQSNVHEELKLL--RQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPKIAN----RCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGR---SSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKL--IAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGR--------------SEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWL--SDKETQVARGEL---------GDTTDAVEMLIKGHSAFEETVRKQS--EKIDALTKN--ADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWL----------------QDKEATGVAMEQED----LSR---ADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTS-EQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGD-DWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAED---------DQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRP-SPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQ-------IGDILASSSTVAPLQSGVEMTK----TPSFNTRRTQSIRKGSRWEDM-----GAID--------------------MKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFL 3638          

HSP 2 Score: 491.5 bits (1264), Expect = 1.623e-138
Identity = 317/852 (37.21%), Postives = 480/852 (56.34%), Query Frame = 3
Query:  195 ILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVI-LENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIE--TESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIENDMIEIP-VEDDYDNXXXXXXXXXXXXXXXXTANMWYLAISDYKARDSNGRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLK 2726
            +LM L+E+IS   LGK NRG +RVQ +EN+NK L +++ K I LENIGAEDI+D N RLILGLIWTIILRFQI  ++IE   E GE+K AKDALLLWCQ KT GY NV I++F  SWR+GLAFNALIH+H P+L+D+++L+P  H  NL  AF +AEK+L I  LLD EDVDV RPD+KSI+TYVS  Y  FAK KTE TGA+R+  IV   +    M +DYE +   LL WI+  I  L  R FPNSLN M++E  +F ++RT EKPPK+ E+  ++   F I  K+K  + K Y P +GL + ++E AW  L+ AE+ R++ +  EL RQE+LEQ A +F+KKA LR+SWL  +  VL  M  G +    E  + K++ ++ +I   ++RF+ L  +   L +  YH  D +     +I +RW +L  L+  ++     L  L+S+LR I T+  E   L+P + + D+GKH +  +DLL KH+L+D Q+ A     ++++  + +++          +Q   L+ +L  ++   N L E+ + RR  L++  +  + ++D EEE  WL+ + K+ T      D ++V +    ++  E E+  H       +   +     + + +G+    I + L  ++  W  L        N L +A   Q+Y+ DA +++ WI E  PLV + + G DEGA ++L++RH  L EEI  + ++D+ RL+E+ + +   +       + V+              E + + +P VE  Y+                                + NG  +S  K EV  +L+K++ EWW    +D  +GY PANY K
Sbjct:    1 MLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRH------KEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWA-----RSKGMIAGGERLVQNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAY-KSDISRLEEMQSQLANSAFHTATTSQSVQ--------------ETEEVNVPQVEMSYNY-------------------------------EGNGMRVS--KGEVLALLEKSTPEWWRALKRDGTEGYVPANYCK 793          

HSP 3 Score: 97.4413 bits (241), Expect = 2.765e-19
Identity = 208/1052 (19.77%), Postives = 425/1052 (40.40%), Query Frame = 3
Query: 2901 NELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSL--EGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGR-LDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--------SKRKTELKPNPDSEKI--------NNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVL----PELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIAD-SNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKS-QNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDF 5978
            +E H     IE +Q ++N ++  L+ L + R + LE +     F   C+S  E+M  K    ++  +    ++ +++  + + D +AA          LE L  ++     E+    + KI        D                    L+  +EK L  E     ++F     ++   I +   ++ +D    D    E L +K   L   I   K  +E  + LG  + +  P  ++ V E+++ +      L++   +R   L    ++  F  +S+  +         +E   +   V SVE  +++   L+ +++  EA L+     A  ++K +  DS       R +  + ++++    +R K L+ +LE Q+  +E D++   +  +    +   +  L+   + + L  H    A I   + R+Q +        SK+  E   +P+ EKI         +   +V +K  +L      K +D   +   AK DE    L+    D+ L        DL ++ + LQKH  LE E+    + L  I + G  +    H   D +   +  + +++  +    + ++  L ++    +   ++   L+     + +  +   G  L  A +++ K   LE+E+      + K+  +A E+ K  H     I  +  +LE   ++L  L+  R + +   +K  Q+ FD  +   W+ E R +    DYG     A KL +KH+ L  ++  ++  +  L     +L     P  ++  + R   L  ++D L K A+DR++ L+ +    +++ +  D+G  I E++  V  S      ++ A     LK +    + +D   + + + +  F       N +    P     V KK       + +    +  + + L   ++   F  ++ E E W+ +  K+A+   + G D++ +  L     +  K I   + R+    E A +L K+     +E+I   Q+ ++ EW+ L      +     AA ++H FN   +D 
Sbjct:  918 SEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKSLQNLERDLKPLEDKIAA----------LEKLAAAVKKDHPEEAAAIERKIAELRALHAD-------------------LLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERNP-RMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYE---SPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNS--KDQGL--------DLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVER-FQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSI-EENLRVAMS------EEFAEDYEHLKELQ---SKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMAD--KMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDL 1913          

HSP 4 Score: 88.5817 bits (218), Expect = 1.479e-16
Identity = 66/264 (25.00%), Postives = 134/264 (50.76%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQ 2351
             D ++ +++S D G+  L+ + L++K + +  ++   SD   ++  K+R+    ++      D       Q + +    +GL+E  Q RRE L     + + ++  EE+  WLS+ + + ++ E+G    S L L ++H   E E+       N  +    D+ + +      I K LD LS     L+     RR+LL++A +  +YY +  +++QW+ E  PL +++E G D+   ++ ++R T L +E+ +F +N++ RL+
Sbjct: 2766 LDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKAREL--RVQGSAAADD----CLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELF-KNEIDRLK 3022          

HSP 5 Score: 83.1889 bits (204), Expect = 4.944e-15
Identity = 57/258 (22.09%), Postives = 130/258 (50.39%), Query Frame = 3
Query: 1560 FDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDF-LDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
             D ++  +NS D G    + KDLL+KH +++ ++    ++ + I  + +   +D     +   D+  +   QL      + G    +Q+R+  L ++  +H+L+ D++ E  W++ +  + ++++ G      L ++++ E  E+E++ H    +K+ + A +L K       +I      L   W+ L+++   RR ++    + Q+Y  DA + + W+ E    + +++ GNDE A + L+ +H AL E+++ + +
Sbjct: 1387 LDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDG----HYDADRIHSTVGQLLQRYAAMKG---PAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQ 1637          

HSP 6 Score: 75.485 bits (184), Expect = 1.088e-12
Identity = 72/348 (20.69%), Postives = 151/348 (43.39%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSG--KLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAA-KDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLV 2237
            KF ++A     WL E     +  + G  +++ +  I + E    E+    ER   ++    +L  + +    +I+ + +D+Q  W  + ++ N  KQA +G  ++         I     + +     +   DL +  LA+ K  L++H+     +KA+  +  ++ +++    +S       PD R  LE +  ++   +  + E +++  E+L+   +     ++  E   W+ N    MT+++   D AS   L+RRH+ Y  E+    P  +        + ++  +   EI + +D L + W  L  I  +R  L ++  + QK+  +AE    W+ E   L+
Sbjct: 3072 KFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSF------PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLL 3413          

HSP 7 Score: 66.6254 bits (161), Expect = 6.114e-10
Identity = 85/366 (23.22%), Postives = 165/366 (45.08%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEE-ENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTV-------EGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEI-RKLELRCAK---LTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYG--RSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIA 5396
            +F + A     W+    + +EE E+ +    + + L+K +A+  +I +     + +    N+L    + + D V+ + + I ++W +L    E +++ L   +       +L  +LR  DT+       E  ++   +G  L   + L+GKH++L++++      L+KL Q A+   +     KE   D + RKL+   A+   L  L   R   L+      QF  D ++E+ W+ E+ +   T  + G   ++P    L   +K +  E+  H      ++  G+ L +  +   K+D++ R   +   W+RL    D   + L  + + +Q+  D N+   WI EK   V +SD DL  D+ A
Sbjct:  341 RFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLN-------DLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIR----HKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLL---YKNVEMEMQTHWARSKGMIAGGERLVQ--NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLV-KSD-DLGRDEGA 688          

HSP 8 Score: 58.9214 bits (141), Expect = 1.311e-7
Identity = 56/326 (17.18%), Postives = 143/326 (43.87%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKK-----------------TYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQ 3830
            H+D  +I  KQ +L  LF +L      R+  +  ++  H+F ++ D   ++++ KE        G    D + I +++E+ + +LAA   R+  +              +ED+      + S  P+    + ++ +  ++   W  +N++  +++++L GA  +  F++  D++       L+ L D          E+L R       D+ ++K++++R      G+K                  ++P   +++  +  ++++    +  A +K    L +  ++  +  + +E  Q +  +   + ++ +P+DV+S E+ +++
Sbjct: 3033 HHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQ-----------RAQEDL------LRSGHPYG---ASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQI-------LNWLQDKEATGVAMEQEDLSRA------DLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRR 3325          

HSP 9 Score: 53.5286 bits (127), Expect = 5.357e-6
Identity = 114/511 (22.31%), Postives = 208/511 (40.70%), Query Frame = 3
Query:  726 ILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNL---LQWI-QKKIIKLN---GRDFPNSLNEMQK-EMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIK--EVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ--ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDG---EIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQW 2213
            I + V  L   +A MK      +R G      L+ SR+   + +LV ++   LQWI +KK I  +   GR    +LN ++K E LE             AE +    ++ +++L+  E   +H+  S  +  K  E+E AW  L+K    R  V+   +  Q        ++   A+  ESW+NE  + L + + G         ++K   +  ++ T ++  +KL+   + L  +N    +    R  ++   +  L  L   ++   +     +            +E ++      S +  + Y   K+L  K +    ++K  S+RF      +   L     +   P  R  ++ Q + L    N L E  + R  +L      H+  RD++E + W+++++  M  ++ G D   V  L + HE  + EI    P   KL   A  L KT   P G   +I      L Q W  L+    +R+++L+ A++   +     D   W
Sbjct: 1448 IHSTVGQLLQRYAAMK--GPAQRRKGD-----LDESRL---WHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLE-------------AEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQ--------QYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAM--SEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAIL-----RRNPPFARDVVKKQ-EALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMP-RDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKT--YPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAW 1916          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 480.33 bits (1235), Expect = 2.461e-136
Identity = 288/771 (37.35%), Postives = 465/771 (60.31%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSK-VILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIE-TESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDIL---KPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFL--DSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEEN 2333
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + KV DL+ D+RDGK+L+ L+ V+S   L K   G +R+  +ENV K L++++++ V LEN+G+ DIVDGN RL LGLIWTIILRFQIQ++  E  ++ E +SAK+ALLLWCQ KT GY NV++K+F  SWRDGLAFNALIH H P+L+DY  L   N   NL  AF  AE +L +   LD EDV+V++PD+KSI+TYV + Y  F K+K +N   KR+GK+++  +E  +MI  YE L  +LL+WI  KI  LN R F N+L  +Q+++ EF +YRT EKPPKF E+  ++  LF +    + NN + + P EG LI ++  AW +LEKAEH RE+VL+ EL+RQE+LEQ A +FN+KA +RE+WL E   +++  N G  + + EA   K E +  +I   +ER Q +  +A  LE+ NYH +  I+ R  ++   W  L  L+ +++    +L   ++I +    + +  D++   K ++ S DLG H +  +DLL+KH L++  +  + +R N    +++ F   D        P +  T++ +   L      L +++ +R+ +L+ N    +   D+ E ++ +  + +V+++ +TG D  +V  L+ +H+  E+ +       ++L +S  +L          I   L  +      L+ + + R+  L    E  +++ DA+D  +++ +   ++ +++ G DEG  Q L+K+H  + +E+  F+++
Sbjct:   22 SARLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRV---RLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQH 789          

HSP 2 Score: 244.973 bits (624), Expect = 4.950e-64
Identity = 277/1318 (21.02%), Postives = 572/1318 (43.40%), Query Frame = 3
Query: 2964 CELKGLARARKINLEGSNLCHQFFKECDSFMEYM--KGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILND-DNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDR--PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPD--SEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREV---SPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLND----KQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIE-LGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKD-FSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDL-IVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTK-QALNEWMTKNEH---ILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIP-TLKEMKHFDYDNINSLFDDCVKRRQKLH 6851
             EL+ L++ RK  L  +   ++ + + DS   ++  KGK       G    ++E +K +++ +  D+     ++T ++DL                   A+ L N+  P +   + +R  ++  +W +L  +   K   LE A  ++ F     E    I  K  +L D D +  D      L+R+   + RD+ AI+++++      D +++  P E   + E IK I  ++  L   + + +  L+ AG++ +F+ D    +  L      + ++  P+ ++  E  + Q   ++ EI+    +  K++++   V +D+  P    +   L  L +  + L+     R   L   L  Q F ++  Q E ++SQQ   L   +   S++  EN LK H +    +D  D +++++     +L  +    ++KI+ +   + ++      K       L++ L   +F  + +EL EWI++K++  ++E Y+D   +  K  +H+A ++E+ +N   L+++     +L          +   ++ +  +W +L   TE+K +KL  A+ Q  + +++AD+      +E  M       DL +    + K +++E+E+  + +++ +L +   ++ +    + ENI      ++ +  +L   ++ R   L+      QF  DVD E  WI E    A   + G SLPD  +L    + L  EI+ H+P +  +  +G++L  E     P ++K ++     L+  W  L++   DRK  L  S    QFL D  +   W++E+  Y+ Q ++  D     N+I K + +  D+  +   ++ ++   + F           E    +T++        E   A L D    ++  LE   +      EI ++  WI +K+ +A S E G+D + ++ L++R+    +  E +G +RV   N+  + L+   ++ +  IA  ++ +   W+ LL     +    +A+  +HKF   C+D  S ++   +       +D +++   +++ Q + K++  +  Q+  I   A +L+  Y  +  L I      +   W+ L    + +  +L    D     + +++ L +++E+  ++ +  +   V      +   +     +   E      +S   DL N +   +     S+I+  L K    + + +  W  + E+   IL      RD     S    QE  +    +  +LEET KL+ KH  F  +    ++R  AL       LKE +H +        ++  KRR   H
Sbjct:  822 AELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDL-------------------ARQLLNVEHP-NSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQE----LRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKF----------VEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYAS-----SEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHRE--------EETAKRRGPAH 2092          

HSP 3 Score: 184.111 bits (466), Expect = 1.308e-45
Identity = 321/1526 (21.04%), Postives = 653/1526 (42.79%), Query Frame = 3
Query: 6597 DIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELV--TNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKD-FGSDIDSVEKLRRKQNGIERDLNALNEKFAKL-RQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSK---SANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVK---ETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAK-------RSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDI----QAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDI---NSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKEL-VKNLQ-NKL-VXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXL-EKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKE 11087
            D+ ++      QE  +   +   D+     LLAKH+N  +N+   +  +  L V    L++      DNI     +      KL +     + +L+    +     ++DD + ++ + L+ + + D   +    +L LL+K+  ++ E+   +   + L  K+  L     +HP   + +  +   L++  +L + SQ R   L +A  L   + + D+VE+W  EK  L++    G D++    ++ +        +  EA++  +   A QLL    +  P +D+I  R   + +RW  L++ ++  +N L  A +L  +  +       I+D+ ++++  D   +D+  V KL+R+ + +ERDL A+  K   L ++A+DI+         +   + + I++D++++     Q  D LN   R  +   D     D+     +L +  +W   ++   ++    +   E + L+N        I       K+ R +       Q      TD Q   +++ L    +   E Q  W+ RQ+ L++ + L  FL              K+ +V+L+  ++    +D+ ++++         +   + + A ++K     +    ++L +D          K +++ +   +  EK   + + L     LQ+     ++   WI  KM+ A D  Y D   +++K  +H+ F SE+ AN+  +     AAI+ G     E H +   I  ++ +L  Q  EL+  ++ K ++L +  ++  + + +     W  + E      +   DL +V    ++Q  IE ++     H +QL  ++ + + +  +      +I+     +  +  +L   L +    L   +  ++F  DV  E  WI +++ LA  + +G SL +  R  K    L +EI      I  I    ++L D  H        +   L ++++ L  A ++R   L  ++   QF  D  E E  ++++ L +   E+G DE S  N +KK E L  +ID  +     L+ K      +    T+++ V+  Q  KL   ++++ + +R  ++  L  Y   RE +++L WI ++ ++   +E G+DY+    L ERF  + +      ++ +   N G   ++   +  +  I      + E    L +    R + L+ +  +H F  +  D +                  EKT       M  D     + R+ +   ++ RK +N    + +D+ A+  Q+ +   ++  L++ Y  D    I  +  EV K W  L+   + + ++L +T  L  ++   +DLL W      ++ S E  P DV+G ELL+      K EID++ +  N  I  G D+ +   Y    +E+K   +      M      R E  +  +++ +F  +    ESWL   E  + S  ++  +++ E  +  K HE + K   +++ +F A+++ T  E    Q +E+E
Sbjct:  636 DVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQL-LLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHP---DIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLL---NVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIER--------ERPQEAQAIREDIKRI----HQVWDILNKKVREHEAKLDEAG--DLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQ------TDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDA-----------KQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFG--DQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDD-KPEYHGT---IDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDE---LENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCL--------------SRIMEKTHA-----MPDD-----LGRDSSSVGALSRKHQN----YLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQER-PKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLIS--KEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHREEE 2083          

HSP 4 Score: 109.768 bits (273), Expect = 4.889e-23
Identity = 219/1157 (18.93%), Postives = 481/1157 (41.57%), Query Frame = 3
Query: 2922 ENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYI----SDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQ-IIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKID---NRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPE-------KLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQ--LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLI-TEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITE-----KSYYVNQSDKDLDNDQIANRIMK-LKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK--TKDRNAIDFGTKRIQQFSKELENMKTQ-LDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE 6308
            +NI  + AE+     +LK L+ +RK  L G    +QFF + D    Y+      ++    +++             +D+  + G +  +     D+   +Q+ D    + I+   AK  S      +   +  R    + Q  +L  L   +++ L  A S+       D +   I++K  +L     G D E  E +K +F  L +D+   ++++     L   +        + +  +  +++  + +L++ +++++N+L  A  +  F  D +E    + +   ++E+   +  D+S V    ++L  ++ ++  ++A LD L   A  + ++RP ++  I   + R+      L  K  + +  L +A + Q+F ++ D  ++ ++    ++ S     S+ + E  L  HA +   ID       +++++  R T+ + +P    +  R   + +   +L      ++  L   L    F  +A +       +++  ++ENY    ++P+       +L++H+     + +N   +  +   G+ L +  H   D +    + IDE+        ++  KKL  A    +F  +  D LR++  +E  M  AQ     D  +  S   +H   +SEL    E L +LK  A  +  D       I  +I +L  +  +L     ++   L D  +   +   +    +W  +     T  D    L   V +A + + LI TE+      +  L+E    L+ E+ P   ++++    A+++   RL+   DDR+  L+      QF  D +D  LWI+E     K+  + +S  D       +R+ K L+ ++ ++  ++  +  I +N     D             A  KK  E    ++  + ++ D++  L   +    F  +  E EAW+ E++     +E G+D    ++   +       I+   D ++     A++ ++ ++  +E+I   Q  ++  +  L   + ++  + +   E++  ++   D    +    +   S+   +D   +    +R QQF+++ EN+ ++ + + +   + L      ++  I    D+LN  W+ L+E  + +   LE  R     Y   ++ L+ + E
Sbjct:  703 DNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYL------YDTLRVMSS-------------EDVGKDEGTVQLLLKKHDDVHDELQNFD----QHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQA------EVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSD-CDELREW--IEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGDLT-TVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLE-ELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPD------CHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANG------PAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIME 1813          

HSP 5 Score: 106.686 bits (265), Expect = 3.854e-22
Identity = 187/900 (20.78%), Postives = 384/900 (42.67%), Query Frame = 3
Query: 3096 GSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILND-------DNVGFDKESNENLKRKFQNLLRDIDAIKSRM-------ERFKYL----GDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDR--PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIE-------SIISQQNCKLDSINPQLSV---DDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD--KLLAIEEENYKDLFNLPEKLQKHK--ALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL-QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDT-CRKINVLPELVEAVTKKFNE-TSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEK 5681
            G+  + +E   KK+EAI  D+ A   R+  +  +   +++ +                      D++K++ R + ++  W  L +L   +   LE + +I        ++   +   LD+++D       +++G      E+L +K   L  DI+ I  R+       +RF+      G G K   P E   ++E+   +   Y +L +   +RK  L +   + +F  D  E E  + E   ++ +    +D+ +V   + + +  +  +  +E  LD+L  ++   L+D   P   NI   L  + D +  LK+    R + L   +E  +F+ + D ++        ++S ++   D    QL +   DDV + L+   N    I  +  + +SL +   E + +PD   I  R D  L +  +L      +K  L + L   K   +A+ +  WID+  KLLA      +D+  +  ++ KH+   LE ++K+  + +  ++D    L+   HP  D +      ++ +W +L    + K  +L +A     F  +  + +    D    +  +  L NDL     L  + +++E +L      L  L ++A ++ ++   + + I ++I+++      L   V +  + L +     +F  D+D    W+   +      +  +SL +A +L N+H  +  EI+G+      +   G  + Q +  P Y   +  R   L++ W+ L++  D+R+H L    N + FL D     + ++++  Y+ + D     +Q  N++ + +     +   D  ++ +      F D  C+  +   + +    +  +E    N E  +  L   ++AL + Q FL+  DE+ E   WI+EK
Sbjct:  437 GNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYH--------------------DQAKINERKENVLQLWNYLFQLLLARRVRLELSMAI-------QKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYK---PVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRL-DVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQ---NFDQHIKVLHAKAESLPQ---EAREHPD---IRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPG-RDIEEV--EIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMF-LRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGM----FGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDAL-SLQQFLSDCDELRE---WIEEK 1284          

HSP 6 Score: 102.449 bits (254), Expect = 8.673e-21
Identity = 146/737 (19.81%), Postives = 313/737 (42.47%), Query Frame = 3
Query: 8880 KWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQAR-----DLEDRNHFAKDQIRA--ERTN-LENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKK----------LESLYLEIDMESSNFVKLSEKTS-NMST------DYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKD----------YDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNH 10985
            ++ R+ E   +W+ E +++    N+GNDL SVE   ++   IE DI +++E++Q++   A  +  EN +  + I E+   +   +  L + L      L  +  + +   D+   LD + D       E++G+ L + +  +++H  L S+I    + + +   QA+     D  D + +   +     ER++ L+  Y+ L +   ER  +L  NK   QF  DV E+E  + ++  +L++ + G D  +  +L+ K          LE     +D+        S   S N+        DY NK KEL  + + +L                 + YY +  +++++  ++ +   ++  E+ GKD          +DD    ++ FD + + L+A    +             ++P  R+  +T      E+  L    ++RK+ L  AL ++    +A+ +  W             +P    +E E                          +++ F   E+D++   +++   N+ + +L  +     D I+ +  ++   W  L+  V+QKRN+L    +L+ + +  ++ ++W + +   +   +AL  D++G   L    +  + ++ +   +L+ L K  DDI+       Q + E    I ++W  +   +       ++  DL++F+ +++  ++WL   +  + S  E+  +S+ E E+    H
Sbjct:  412 RFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLA--------------GGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEA--------REHPDIRQRLDTTLKQKAELENLS---QLRKQRLIDALSLYKLYSDADSVESW--IDEKGKLLATLVPGRDIEEVEI-------------------------MKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVAS--EEEPQSLAEAEQLLNQH 1094          

HSP 7 Score: 97.4413 bits (241), Expect = 2.640e-19
Identity = 192/990 (19.39%), Postives = 413/990 (41.72%), Query Frame = 3
Query: 3402 FNKTGDELRESI---NQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVL-KDRPNDSNITSA-LGRLDD-------KMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHAN-------LAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIK--RNHPKKDAVKDILKTIDEKWKK---LNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHR-----PSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKN---ISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT-KDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQL 6242
            FN+   E+RE+    NQ+L  ++ DN G D  S E   +K + +  DI A + R++    +   ++     +   +NE+ + +  L+  L   L  R+  L  +  + K  +D       ++++   + ++ +   +  VE  +Q+   L+ +IN++   ++   + A      D P+ S       G +D+       + K L D   +R + L+D     +F+ +  ++E  I +Q   L S +    +  V + L  H N       L  ++D++D     +S ++ + +  P S+ I  R  ++ D +NKL      +K  L   +E+ +F  +A+++  ++ D L  +  E+  KD   +   L+KH  +  E+++    ++ +H     L +  R HP      DI + +D   K+   L   ++ ++++L  A    +   +   +    D    ++ T   G D+   + +  + + LE +++ Q   +  +   A ++    H + ++IL    KL  R A+L  +V+Q+ + L+   +   F  D  + + WIE+         A  ND    L   +KL  +   +  ++   +  + +L +   D++RE  P   + +    K +   WD L K+  + + KLD + + ++FL D +    W+T     V   ++                    LA  + LL     I    +G+ +  +K+  + + V           + ++     + +E  +   +++Q+ L    +   F  +  + E  + +++     ++  + L+Q E+   R    + +++  +++++      +QL +  +  +++I     ++          A +   K   A  + +F   C +  + +    I    +T +D   I     R Q F  EL   K +LD +  AA  L    P     I  +I+ L   W +L +   +KG +L
Sbjct:  413 FNRKA-EMRETWLTENQRL--VSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLD-----VSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHP------DIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTND----LSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERE-RPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEP-----------------QSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKL 1366          

HSP 8 Score: 92.8189 bits (229), Expect = 6.623e-18
Identity = 169/877 (19.27%), Postives = 374/877 (42.65%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQR------GSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKS---LKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY--KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKK-DAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDE-IRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKD-VETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKD 5492
            ++D+  I +++  + +L+  L  L  AR++ LE S    + F +    ++ M     D   R      G+   D+E + +K+  +  D+     R+       S+ Q+      +  R  D    S    PV+   +  R   +  ++++L  L  ++++ LE    +  F     EL   I ++  +L+  + G D  +  +L  K +N   ++  ++  ++R    G  ++       + +  ++ EI D   KL+     RK  L      ++F  D+ + ++ L +   ++ ++ + KD  +V+  +++ + +  E+   + ++  L + A  + ++     +I     RLD  +K    L++    R + L DAL   K Y + D +ES I ++   L ++ P   +++VE        L   +   + +V +++    +L    +P+S+ I +R +K+  +  +L      K+ +LE       F  +  E   WI+DK   +E+ +    DL  + +  ++   +E ++ +  + L+ +H   +D I+R  P++  A+++ +K I + W  LN    + E KL +A +   F  +L          +  + + +    L  A+ L+ +H  +  E++   E+  K++     + +D    +   L + +  L+    +L  + + R   L   L    F  D  Q    + +       +D  +SL  A     +H+  IT ++ +   +  +   G  L ++    Y  D +  +++ + +      ++A +   KL  + + +QFL D +++  WI EK     Q +   D   I ++ ++ ++   +LA     L  + H      D
Sbjct:  479 YHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMD----DIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVN-----NSIAQA------QRFRNPDGPDGSGYK-PVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQ---RLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADD-IERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQD--GHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRA-QDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGD 1332          

HSP 9 Score: 82.4185 bits (202), Expect = 9.641e-15
Identity = 379/1974 (19.20%), Postives = 773/1974 (39.16%), Query Frame = 3
Query: 4101 NPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKL-----HGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQKHKALEAEIKS----NISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADIL-RKFDTVEGMMKTAQ-------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSP---MYKK----DVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTC--RKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHE--WDRLLTFASQKNAKFDAAEEIHKFN-----KTCKDFSDMVNIDN--------ISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDIS-MAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE--------WMTKNEHILIK----------QNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREK------EFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEA-DNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWL------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTV--KGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLN-EKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIA-SDANYEDRVNLSNKVKKHREFVSEVE-ANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTS---DIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVK 9743
            N Q + D  EN L     LA F+D  D  V             PD + I           NKL      GK  GK I+  +END    +++  +++L EWI+ K+  + E ++++ L  +  +L +      + K         LE +       ++ N+ +    ++  ++  I+  W+ L     ++E  L +   + E  E LA    RK +  E  +   Q        GNDL S ++   KH  +E+++    E +  +   A E+  + + D+  I +    +      L  L+  R   L+ ++   +   D+   L  +++ +      D G  L D   L  KH  L ++IN     V N +   +  +    P    YK      ++ RS  L+  +  L   A +RK +L+ +    QF  D  ++   I E+   ++ +D   D   +++ + K K+   +L   +  L  +  +    +D       N+ P L E       +  +  +   AS   ++  L    ++  F  +  +V+ ++ +  ++  S + G+D   ++ L       LK      D V    +N +Q +K  ++++E +   QE  +H     RL T   QK A+ +   ++ K          K +SD  ++++        ++     +D   ++    R     ++++N + ++ +++ +A   L +++PN+ D I+   + LN  W QL +  +QK  +LE            +E++ ++ +    ++    + + L+    ++L ++ +    +   +  KL S                +  + DD+  +R +  QA+ E        W   N+ +             Q  LRD+    +     + +V        L E E+LL +H      I    +  K +      + +      D  +  +    +R   L + + +++    N+Q  L+        LR++      + ++   +   D    +LE+  + L++++     + A++ +   + +   +L  + H  +++      NI E+      ++Q+    LK+A  L  F  + D +  W  EK      E    A  + S      + Q++L         ++ R+D +   A  L   K    PE    I  + + + ++WD L+   E    +L +A +   Y   +  + +        +  +D   D+ +V    +KQ+ IE ++    +   +L + E   + L  +    I   +  +++ L++L      R   L      F+  +D     D  L  +E + ++   N  +S     ++   L+ L N     E  I  +C   +E        +  +  +  P  ++   +QE L S  +E + A   R+  L E  + H FL  C   E W+      + Q+++     +    +   E +  +ID        ++ +  K V  K  L E            I++ + + + +  G   L+ E+  R+ + L    EL  L ++++D + WI +K ++A S  N +D  ++    ++ ++F  + E      +  A D    LI   H  +  I      L+   + L  + D + + L  +    K+       +S I E        + G D  SV  L R+  +   DI +  EQ+  I+ +A  +   + Y      DI  + + +   +  L       ++ L D   L++F + V   L W+ +  +  N +E    ++  +  +  H +L +EI  R ++  +     RDL +R H+A  +I  +   L      +    E+R+  L       QFA D    E  L  +   L + E G + +  + L+KK E+       +   F+ L + T+    + Q++ +E  K
Sbjct:  219 NLQSAFDTAENQL----GLAKFLDAEDVNVD-----------QPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAE-----IRDYINKLKELSAS---RKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLL-------LKK----HDDVHDELQNFDQHIKVLHAKAESLP--QEAREHPDIRQRLDTTLKQK-AELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDD-ILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSG--VMKLQRRLSMMERDLGAIQAKLDS----------------LHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQ------DQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAK-DDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELA-------ANKERLDQLKHAAINLGDDK----PEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVD---DEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQE--------LIDEGHANGPAFEK--KIQE-LRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTE-----------QIQVRQAQIEKLYAGLQDLSKERRKRLEETL----ELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPD-DLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAEL--RDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHREEETAK 2086          

HSP 10 Score: 67.3958 bits (163), Expect = 2.755e-10
Identity = 83/359 (23.12%), Postives = 158/359 (44.01%), Query Frame = 3
Query: 1242 LNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERF-------QKLKELAINLESNNYHS--KDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQ--INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEIS---AHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGND 2261
            +++I S L + + G  + + E  + K  L+ ++IN   ER        Q+ +      + + Y       I  R+  +Q R+K+L DL   ++    D+ +L              +E  I + +  ++STD G+  +    LL KH   +  L+ L    ++++   ++  D     S N+ P        +L  +   IN L E+S  R+E+L     Y++   D ++   +L + ++VM++++ G D  +V  L+++H+    E+     H+ + +  K  +L     +  PD  I + LD   +    LE +   R+  L DA    K Y+DA+  + WI E   L+     G D
Sbjct:  530 MDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRN-PDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLC-----QFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPP--------RLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHA-KAESLPQEAREH-PD--IRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRD 870          

HSP 11 Score: 61.2326 bits (147), Expect = 2.410e-8
Identity = 70/341 (20.53%), Postives = 148/341 (43.40%), Query Frame = 3
Query: 1335 NEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILK---PQINST---DLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            +E+   KER  +LK  AINL  +       I  +  ++  +W +L+     K      A+  +L             ++E ++ +   P   +T    + K +L   ++++K   +D QL  +  +  +++    D L+++K+  L       ++ QL+ L   ++        RR+ L++     +  RD+++EK W+S  + +   +  G       RL +  ++  +EI  H P  N++  +  +L            K +  L   W  L+    +R+  L ++ +  ++  D  +++ W++E    ++  E G DE +T+  IK+H  L  +I  F
Sbjct: 1311 SELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHID-QLMEMEPQLEELH---PDELENIKAHRLA------VQEQLQRLQAPLD-------DRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKF 1634          

HSP 12 Score: 60.8474 bits (146), Expect = 3.125e-8
Identity = 73/382 (19.11%), Postives = 165/382 (43.19%), Query Frame = 3
Query: 1200 ATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSL-----DFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
            A +F +     + W++E + +    N G ++ +        +L++NEI+  +    ++      L    + +  A   +  ++++ W++L++ +  ++ D G+       L             +  +   + GK   + K+ ++KH  +   +   +D    +  K+  F++    ++   +Q Q  + Q++ L     GL ++S++RR++L++    + L R++++   W++++  V  ++E G DY  V  L  R + +  +      I ++   +A D   T  I  G           D L++ W NL  +   R  +L+ +    K+Y D  D    I E     +  + G D  +  AL ++H   L++I+   E
Sbjct: 1478 AFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEE---KSPLTEQIQVRQAQIEKLYA---GLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTEN---IGSERVANANDGCDT-LIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTH-AMPDDLGRDSSSVGALSRKHQNYLKDIAAIGE 1848          

HSP 13 Score: 58.5362 bits (140), Expect = 1.631e-7
Identity = 40/139 (28.78%), Postives = 70/139 (50.36%), Query Frame = 3
Query: 11544 STTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKD-KIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKLQQNKRLSSLEIQTAEKSKSVSVEPELCET 11957
               Q   F G + RK    S   KAA RSW+  YA L  + L++YKD K    + H  P ++  +   ++ V   Y+K+  V+ ++L   +E+  Q  S+ +  +WL++LQ    +++ + Q  E S+S ++  E   T
Sbjct: 2113 GAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDPKHRDESVHGEPPMA--LPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQ----VATGQAQLEEASRSQTLPAEGSAT 2245          

HSP 14 Score: 56.225 bits (134), Expect = 6.789e-7
Identity = 62/330 (18.79%), Postives = 149/330 (45.15%), Query Frame = 3
Query: 1233 ESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKL----AFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQ 2207
            ESW++E   +L  +  G  I+  E   ++ + +  ++   + +   + +LA  L +  + + D I  R + +  RW +L+D+++ K+ +  +      F I    T+  I  +  +L+   +S  L         L  + ++++  L A+  + + ++ ++ D       +   P + Q +   +K +    + LN+  ++   +L +  +  + +RDL+  + WL+   + + ++E     A   +L+ +H     EI  +   + K++     +++ Q  P    + + L  L +GW  L+R+   R++LL      Q +  DA+ ++
Sbjct:  852 ESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLE---DSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDI------ERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAE 1172          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073072)

HSP 1 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 852/3171 (26.87%), Postives = 1528/3171 (48.19%), Query Frame = 3
Query: 2604 GRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLKEFE-------APKMRXXXXXXXXXXXXXXXXWFPIDSDVAKNYLAKKNRKSMHAEIFKGPTVRNQNELHYDKEN---IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNP--DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF----KDTCRKINVLPELVEAVTKKFNETSDNFES-FRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANE-AIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQN----C-LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKS---ANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVP--PTDDQLNTVQENLLSC--VKETQN-AWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNN---LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEID----------------MESSNF--VKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQR---------KEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSL--HRGNSGS--KIPPV-KPVVEDVRSRKLLKKQASAGQLDIQPTF--------IRPIKFSTAIAD---IDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKL 11870
            G+ + + K EV  +  K +D+WW V   + ++G+ PANY++E E        PK  K K  +  K   +V++  P+             ++     +   P V+ +       EN   +EK+Q  +N+ + EL+ +A+ R   LE S     F++ECD F ++MK KE     R   + + EG+   K+K+E  I DL+A S R+          + ID  ++   R+  +++           K+  R ++I   W++LN  K  +EKSLEGASS++LFN+T DE +  +++K+  L+   +  D  + + L+R+ QNL R++  ++ ++ R  YLG+ VK  YP E + VN + +E+ D++ ++Q      +N + +      F N +K     ++ +   +      +DV +    +++   L  +I   +    ++  L   +   +PN +   + + RL  +  ++     ++ K L   ++ Q F +E D+I++        L+  N   S+D+VE  LK H +    +   D  ++  S    +L  N   DS+ I +R ++VL K   +  +   +K  L+   +F KF   A++L  W+ DK     +ENY+DL NLP KLQKH+A E E+++N   L  +   G  L++  + +   V+  +  ++++WK L   +EDK +KL QA+ Q E N +L D  +K D ++  +++  +GNDL S K LI K  ILESE+    + +A+L     +MA  GHF+ +NI    ++L+ R   L     +R + L+++L +H+F F++D E QWI EH P+A  N+ G++L  A  L  KHKKL  EI GH+P++   L +G+ L  +  P  ++ VE+  + L+  W  LE+   +R  KLD+S   +Q+L D  +I  W+ E++  +  ++   D D  A  + K K+I ++L TY  ++  + H+            + +    +L+E + K  ++ +   +     SL   +  LE+            EVE WI E+++ A S ++G+D + ++ L+++++     +E+G DRV  C   A +L+ S++  + E+   QE ++  W+ LL   +Q+  K  AA EIH+F++   +    +   N +L  +  +D N+     ++ + F  +L  ++ QL  +   + +L+ KYP+N+  I ++ D +   W  L E +  +G +L    D       +++ +++ + +   ++A+  ++    A    IQ    + E +   E   + L   S+ +         + ++     ML++R K   A N+     + I+++Q     C LRD  QI++ ++ Q+  +  ++F   +E+ +  + KH  F   I   +++V  L      L E +H+D  NI ++    + RRQK+ D       KL +  ++   +R+  +  +W++EK ++++    S      L+EK+  LQK++A  AE++A++   +++      L++ QH  S E K  +  +LE W  LL+E ++R   L+EA+D L F  +LD +EAW R+KE +V A++ G DL+HC +L  KL +     +VD+ R+  I Q A++L+ +  +PA +  ++  R K     W  L+  L AY+  L  A ++H +  ++   +D+I ++   +   D G D+ +VE L R++  +ERD++A+ +K  +    AE +        +  I  K +E+      L  L+ +R   LN +Y   K V D K L        + +N +  P+      T L++H E K  +                  E R    + +  Q E +   P   Q + V++ LL    + +T N AW++R   L E  QL  F    E  E WL  +    +  LNN     S + VE + +  D       L+ A    T++     ILE     +  D  L   K   ++     L E      Q L+   +LQE  + + +   W+  K+ +A D NY +  NL +K++KH  F +E+ +N P +Q+ I  G+RLI  +H +  EI ++V  L+    +LK  S  K  +L +      + R V+ F +W++E E    S +YG DL +V  L ++   +E D+  H E    ++++ +      ++L  +I E++ +   R+  L E L     NL D+  L +F  D   EL W+ +K  +A  +++G+SL       K+H +L +E+ ++   I+++ ++ + +   NHFA +Q++ +   L+    +L +    R  +LL     Q F  +  E +  + +K  +L++ + G DE S     KKLE L  E+                 +E ++F    ++EK + +  +Y++  + L K  +++L E K                + Y+RE+EE+  W+ +Q  +   E+YG+D +    LI  F+S+   LNAN+ ++      G +LI E NP+   I++      +    LKD    R++AL GA +VH + R A++ I                            + ++K  ++IS ++ Q L  ++ L      FE +L  +  Q++    E+ +L EIYPDAK+HI  K +E  + W  LK     ++NKL++ ++LQ +  +Y+DL++W      KIT+ E L   VAG+ELL+  + +H  EI ++ +   K   +G  +     ++   VE+K   +Q   + +   L  RRE+YE N+D + F+ +   LE W+   E  +K  D K   S+P++E+  + HED+ K V +++ KF AIKR T LE+LF+ +         +EKER+ K+ L        +K+RE Q++  E+   +    HR N+ S  K P    P+V   ++     +  +  Q+ ++P F        ++    S    D       D  +   E +    K  K   SF+T++R    R N         Q     D+        P    Q     G + RK  L S G KA VRSWK ++  L G  + ++KD+   L Q +      NI  A     + Y K+ +V  +KL D SEF  +  S +    W+ K+
Sbjct:  844 GQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPV-------------KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRV----------EEIDGAVDTFRRQGHSQL----------DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP-EREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLES-----------DEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGE-IEAREDKFRYLNELSDSMVQTGHYAAAD-VEEKCAAMLDERQKLHAAWNK-----KKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA-DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEI------------------EGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANK----EAFLNNDDLGDSYTAVERLLKKHD---EFEKLLHADHVDTLQKFANSILE----GEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLR-LAKERESRLGECK--------------KLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQ---------------------------LINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPE-LANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLK--DTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERL------EQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSG--PQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKN---------QKGEGFDL--------PPVEIQ-----GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKI 3850          

HSP 2 Score: 535.028 bits (1377), Expect = 1.358e-151
Identity = 331/767 (43.16%), Postives = 471/767 (61.41%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMII----ETESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKL--SPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSD---RFNQ--INYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            E  R++ LQE+R  IQKKTFTKWMNS L +A  +V+DLF DL DG  L+ L+E+IS+  LGK N G +RV  IENVNK+L ++ +KV LE+IGAEDIVDGN RLILGLIWTIILRFQIQE+ I    E ES EK+SAKDALLLWCQ KT GY  V+I DF  SWR GL FNALIH+H P+L +YS +  S  ++  NL  AF  A  EL IP+LLD ED+D  RPD+KSILTYV+S Y +FA+MK E    KR+  IV   ++  R    YE L  NLL WI++K ++L  RD PNSL  +Q+E+L FKEYRT+EKPPK+ ERS I+   F I    K  N   Y P +G L+ ++E AW  LE AEH RE+ LR ELLRQE+LEQ   KF KK+ LRE +L E++ VL++      ++  +A + K E ++ +I    ERF  L  +A  L+  NYH K+ +  R  ++  +W++L +L+ +++ +  +++ L+++LR I +       L+ Q  S D+G H L  ++LL+ H+L + Q+    +   RFN+  + YKS +  D+             L  +L +L    + L   S  RR +L++  N+H  M D + E++WL ++ ++     T  D  +VL L ++H+  E EI +  P   ++  +   L   Q     EI   +D L++ W  LE +   RR  L+DA E  ++Y DA +++ W+ E   LV +++ GNDE + QAL++RH  L  E++ +
Sbjct:   11 ENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPR---YLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAA-----------LLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763          

HSP 3 Score: 95.9005 bits (237), Expect = 1.058e-18
Identity = 71/302 (23.51%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1425 ISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + +R +D+  RWK L  L   K     + A      R++   + + D L   + S D+G    + KDL+ K  +++ ++     +  ++     D        +QN+        E   K L      L + +Q+RR +L+++ NYHK + +L+ E  W++  +    + E G +      L ++H+  E+EI  H P+ NK  ++   L   Q     ++      L Q W +LER   ER   L  + + Q+Y  DA + + W+ E   ++ + E G D  +   L+ +H  +  E+  +
Sbjct: 1472 VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNI--------EAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTY 1765          

HSP 4 Score: 83.5741 bits (205), Expect = 4.947e-15
Identity = 82/351 (23.36%), Postives = 154/351 (43.87%), Query Frame = 3
Query: 1296 NFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK----QADSGKLAFXXXXXXXXXXXXMEF----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            N +++I K      E+ +   R Q +      L   ++ +KD I+ +   ++  W KL+    +K    Q     LAF  S+         EF    D ++ Q++S D GK   A  +LL+KH  ++  +    +  +Q+  K   F  +         +R T+  +        N L+E    RRE L+ + +  + +RD E+E  WL+ +  V  +++ G    SV  L ++H   E+E+++  P+   L      + +       ++    + L +    L  + + RR  L DA E Q +Y +A ++  W+ E  P++ + + G DE + Q   K+   L  E++ F
Sbjct: 2811 NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVD--------EFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIR------RYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAF 3147          

HSP 5 Score: 81.6481 bits (200), Expect = 1.954e-14
Identity = 83/352 (23.58%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 4446 LQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQ------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTN 5480
            L+KH+A+ A+I + +     +     +L + N+  K+ V+   + +  KW++L    E++   L Q S       NL ++LR+   T E + +  Q      +G  L   + L+  H++ E ++ T  E L +  ++A       H D   +   +  LE   ++L      R + L++   +H F  D D E  W+ + +         + L   + L  KHK L  EI   KP    +  +GK L  E  P    ++++R  +L + W  LE   + R+ +L+ +A   QF  D N+   W+ EK   VN  D   D       + + + +  +L  Y   + N++   +
Sbjct:  432 LKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMS-------NLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPR-SSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          

HSP 6 Score: 77.7962 bits (190), Expect = 3.150e-13
Identity = 111/497 (22.33%), Postives = 217/497 (43.66%), Query Frame = 3
Query:  861 VRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVE---KPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEE-----LVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDL---LEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            V+ L  W+   I K+N    P+++N+ + + LE  + R VE   +   FA      E+L +   +Q+ +N++ Y      L + +  AW     +E AR++    +L            F  +    E WL    + LNN + G +    E  + K +     L A+ ++T       L++ A ++        D I  + + I  R +KL +L   ++    +       L+       E D    Q     L ++Y    +L   ++KH   D +L + S R   + ++    +   +  +   D+   +  Q++ L GD   L   SQ ++++L+Q  +     R ++E  NW+      +++++ G D A+V  L+++HE  E++++ H  + ++LK       + +     EIH+      + +  L      RR  L+D+   Q++  DAED  QW+AE   +  +++ G    + Q L K+H +L  E++
Sbjct: 2576 VKELELWVNDMIKKMNNTQSPSTINDCETQ-LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-----SERARDLTEAHQLQL----------FKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT-------LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERK----QRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI---RGDHFAKDE---IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039          

HSP 7 Score: 64.3142 bits (155), Expect = 3.824e-9
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 6906 LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
             + + D++  W+ +K Q+I     +A  L   L L QK+KAL  EI + +P+  Q+      L+  QHP+S E ++ + ++ E W  L +  + R   L++A +   F+ + +  E+W  EK  LV++ + G+D     +L
Sbjct:  610 FMEDYDNEESWLVDK-QRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQAL 749          

HSP 8 Score: 62.7734 bits (151), Expect = 9.447e-9
Identity = 52/214 (24.30%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIH--KSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI 2216
            + ++D G+       L+ K + VD  ++    R   IN       D L +Q   P   Q+++ + K+ + +   L       R  L      H   RD+++  + ++ +   M++ +TG D A+V  LIRR E  E ++SA     ++ + +A  L K ++   G  H  + L+ L + W NL+ +  +R+++L +AY   K+ +D ++ + W+
Sbjct: 2375 VQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHIN----QLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIK-KYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWV 2583          

HSP 9 Score: 60.8474 bits (146), Expect = 4.265e-8
Identity = 33/134 (24.63%), Postives = 71/134 (52.99%), Query Frame = 3
Query: 8670 KKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI 9071
            +KH+    E+++ +P        GKRLI E H  S EI  ++  L    + L+ + + + ++L +  + +++        SW+NE   +  S +YGND  S + L ++  D++ ++N++   + ++ ++AD +I
Sbjct:  645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 778          

HSP 10 Score: 56.6102 bits (135), Expect = 8.335e-7
Identity = 75/403 (18.61%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNE 2432
            W+ + ++V  + + G  +++ E  I   E   + +N  + R +   E    L   N   + +I ++  + +  W++L+DL++++Q   A + ++     +      +  E D     + S D G+   + + L  KH + + +L  +  + + +        ++ K   + PD ++ +E +          L E +  R+ +L Q         +  +   W++  +  +T  E  +  A    L+   + +++EI      F K   +   L K +     E+   +  L      L+   ++RR + +   + Q +  DAE  +QWI+   P + + + G+     + L++RH    + ++  EE    +KR+  L  L      +H +  E++ KL + E
Sbjct: 3216 WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD---ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSV------LAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLF-----RHQLEQEKISKLQEKE 3604          

HSP 11 Score: 54.6842 bits (130), Expect = 2.927e-6
Identity = 77/366 (21.04%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 6669 LEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRR-QKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED 7733
            L + +  L KH   + +I    +R   L+     L        D  N    + V+RR Q++   +R +   L NQ++ L+       LLRE       V E  QQ  + D   + L  +  LLQ +     +++ +    ++   ++    +++H  +      + ++ E + +LL  S  R + L+EA++   F ++ D  E+W  +K+ +        DL   +SLQ K   L + +  ++    ++   +    +L+  +    P +  I+SR  ++   W  L+  +E  + +L +A + + +Y +       + +++ LV  +D+G+D  S + L ++   ++ +LNA +     L Q  D
Sbjct:  425 LRQVDATLKKHEAISADILARVERFNDLTAMAEEL--------DRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVE-ELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQM---STAGKRLIGEQH---PRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0332057)

HSP 1 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 852/3171 (26.87%), Postives = 1528/3171 (48.19%), Query Frame = 3
Query: 2604 GRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLKEFE-------APKMRXXXXXXXXXXXXXXXXWFPIDSDVAKNYLAKKNRKSMHAEIFKGPTVRNQNELHYDKEN---IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNP--DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF----KDTCRKINVLPELVEAVTKKFNETSDNFES-FRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANE-AIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQN----C-LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKS---ANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVP--PTDDQLNTVQENLLSC--VKETQN-AWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNN---LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEID----------------MESSNF--VKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQR---------KEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSL--HRGNSGS--KIPPV-KPVVEDVRSRKLLKKQASAGQLDIQPTF--------IRPIKFSTAIAD---IDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKL 11870
            G+ + + K EV  +  K +D+WW V   + ++G+ PANY++E E        PK  K K  +  K   +V++  P+             ++     +   P V+ +       EN   +EK+Q  +N+ + EL+ +A+ R   LE S     F++ECD F ++MK KE     R   + + EG+   K+K+E  I DL+A S R+          + ID  ++   R+  +++           K+  R ++I   W++LN  K  +EKSLEGASS++LFN+T DE +  +++K+  L+   +  D  + + L+R+ QNL R++  ++ ++ R  YLG+ VK  YP E + VN + +E+ D++ ++Q      +N + +      F N +K     ++ +   +      +DV +    +++   L  +I   +    ++  L   +   +PN +   + + RL  +  ++     ++ K L   ++ Q F +E D+I++        L+  N   S+D+VE  LK H +    +   D  ++  S    +L  N   DS+ I +R ++VL K   +  +   +K  L+   +F KF   A++L  W+ DK     +ENY+DL NLP KLQKH+A E E+++N   L  +   G  L++  + +   V+  +  ++++WK L   +EDK +KL QA+ Q E N +L D  +K D ++  +++  +GNDL S K LI K  ILESE+    + +A+L     +MA  GHF+ +NI    ++L+ R   L     +R + L+++L +H+F F++D E QWI EH P+A  N+ G++L  A  L  KHKKL  EI GH+P++   L +G+ L  +  P  ++ VE+  + L+  W  LE+   +R  KLD+S   +Q+L D  +I  W+ E++  +  ++   D D  A  + K K+I ++L TY  ++  + H+            + +    +L+E + K  ++ +   +     SL   +  LE+            EVE WI E+++ A S ++G+D + ++ L+++++     +E+G DRV  C   A +L+ S++  + E+   QE ++  W+ LL   +Q+  K  AA EIH+F++   +    +   N +L  +  +D N+     ++ + F  +L  ++ QL  +   + +L+ KYP+N+  I ++ D +   W  L E +  +G +L    D       +++ +++ + +   ++A+  ++    A    IQ    + E +   E   + L   S+ +         + ++     ML++R K   A N+     + I+++Q     C LRD  QI++ ++ Q+  +  ++F   +E+ +  + KH  F   I   +++V  L      L E +H+D  NI ++    + RRQK+ D       KL +  ++   +R+  +  +W++EK ++++    S      L+EK+  LQK++A  AE++A++   +++      L++ QH  S E K  +  +LE W  LL+E ++R   L+EA+D L F  +LD +EAW R+KE +V A++ G DL+HC +L  KL +     +VD+ R+  I Q A++L+ +  +PA +  ++  R K     W  L+  L AY+  L  A ++H +  ++   +D+I ++   +   D G D+ +VE L R++  +ERD++A+ +K  +    AE +        +  I  K +E+      L  L+ +R   LN +Y   K V D K L        + +N +  P+      T L++H E K  +                  E R    + +  Q E +   P   Q + V++ LL    + +T N AW++R   L E  QL  F    E  E WL  +    +  LNN     S + VE + +  D       L+ A    T++     ILE     +  D  L   K   ++     L E      Q L+   +LQE  + + +   W+  K+ +A D NY +  NL +K++KH  F +E+ +N P +Q+ I  G+RLI  +H +  EI ++V  L+    +LK  S  K  +L +      + R V+ F +W++E E    S +YG DL +V  L ++   +E D+  H E    ++++ +      ++L  +I E++ +   R+  L E L     NL D+  L +F  D   EL W+ +K  +A  +++G+SL       K+H +L +E+ ++   I+++ ++ + +   NHFA +Q++ +   L+    +L +    R  +LL     Q F  +  E +  + +K  +L++ + G DE S     KKLE L  E+                 +E ++F    ++EK + +  +Y++  + L K  +++L E K                + Y+RE+EE+  W+ +Q  +   E+YG+D +    LI  F+S+   LNAN+ ++      G +LI E NP+   I++      +    LKD    R++AL GA +VH + R A++ I                            + ++K  ++IS ++ Q L  ++ L      FE +L  +  Q++    E+ +L EIYPDAK+HI  K +E  + W  LK     ++NKL++ ++LQ +  +Y+DL++W      KIT+ E L   VAG+ELL+  + +H  EI ++ +   K   +G  +     ++   VE+K   +Q   + +   L  RRE+YE N+D + F+ +   LE W+   E  +K  D K   S+P++E+  + HED+ K V +++ KF AIKR T LE+LF+ +         +EKER+ K+ L        +K+RE Q++  E+   +    HR N+ S  K P    P+V   ++     +  +  Q+ ++P F        ++    S    D       D  +   E +    K  K   SF+T++R    R N         Q     D+        P    Q     G + RK  L S G KA VRSWK ++  L G  + ++KD+   L Q +      NI  A     + Y K+ +V  +KL D SEF  +  S +    W+ K+
Sbjct:  844 GQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPV-------------KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRV----------EEIDGAVDTFRRQGHSQL----------DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP-EREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLES-----------DEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGE-IEAREDKFRYLNELSDSMVQTGHYAAAD-VEEKCAAMLDERQKLHAAWNK-----KKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA-DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEI------------------EGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANK----EAFLNNDDLGDSYTAVERLLKKHD---EFEKLLHADHVDTLQKFANSILE----GEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLR-LAKERESRLGECK--------------KLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQ---------------------------LINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPE-LANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLK--DTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERL------EQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSG--PQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKN---------QKGEGFDL--------PPVEIQ-----GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKI 3850          

HSP 2 Score: 535.028 bits (1377), Expect = 1.358e-151
Identity = 331/767 (43.16%), Postives = 471/767 (61.41%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMII----ETESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKL--SPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSD---RFNQ--INYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            E  R++ LQE+R  IQKKTFTKWMNS L +A  +V+DLF DL DG  L+ L+E+IS+  LGK N G +RV  IENVNK+L ++ +KV LE+IGAEDIVDGN RLILGLIWTIILRFQIQE+ I    E ES EK+SAKDALLLWCQ KT GY  V+I DF  SWR GL FNALIH+H P+L +YS +  S  ++  NL  AF  A  EL IP+LLD ED+D  RPD+KSILTYV+S Y +FA+MK E    KR+  IV   ++  R    YE L  NLL WI++K ++L  RD PNSL  +Q+E+L FKEYRT+EKPPK+ ERS I+   F I    K  N   Y P +G L+ ++E AW  LE AEH RE+ LR ELLRQE+LEQ   KF KK+ LRE +L E++ VL++      ++  +A + K E ++ +I    ERF  L  +A  L+  NYH K+ +  R  ++  +W++L +L+ +++ +  +++ L+++LR I +       L+ Q  S D+G H L  ++LL+ H+L + Q+    +   RFN+  + YKS +  D+             L  +L +L    + L   S  RR +L++  N+H  M D + E++WL ++ ++     T  D  +VL L ++H+  E EI +  P   ++  +   L   Q     EI   +D L++ W  LE +   RR  L+DA E  ++Y DA +++ W+ E   LV +++ GNDE + QAL++RH  L  E++ +
Sbjct:   11 ENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPR---YLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAA-----------LLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763          

HSP 3 Score: 95.9005 bits (237), Expect = 1.058e-18
Identity = 71/302 (23.51%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1425 ISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + +R +D+  RWK L  L   K     + A      R++   + + D L   + S D+G    + KDL+ K  +++ ++     +  ++     D        +QN+        E   K L      L + +Q+RR +L+++ NYHK + +L+ E  W++  +    + E G +      L ++H+  E+EI  H P+ NK  ++   L   Q     ++      L Q W +LER   ER   L  + + Q+Y  DA + + W+ E   ++ + E G D  +   L+ +H  +  E+  +
Sbjct: 1472 VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNI--------EAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTY 1765          

HSP 4 Score: 83.5741 bits (205), Expect = 4.947e-15
Identity = 82/351 (23.36%), Postives = 154/351 (43.87%), Query Frame = 3
Query: 1296 NFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK----QADSGKLAFXXXXXXXXXXXXMEF----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            N +++I K      E+ +   R Q +      L   ++ +KD I+ +   ++  W KL+    +K    Q     LAF  S+         EF    D ++ Q++S D GK   A  +LL+KH  ++  +    +  +Q+  K   F  +         +R T+  +        N L+E    RRE L+ + +  + +RD E+E  WL+ +  V  +++ G    SV  L ++H   E+E+++  P+   L      + +       ++    + L +    L  + + RR  L DA E Q +Y +A ++  W+ E  P++ + + G DE + Q   K+   L  E++ F
Sbjct: 2811 NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVD--------EFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIR------RYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAF 3147          

HSP 5 Score: 81.6481 bits (200), Expect = 1.954e-14
Identity = 83/352 (23.58%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 4446 LQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQ------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTN 5480
            L+KH+A+ A+I + +     +     +L + N+  K+ V+   + +  KW++L    E++   L Q S       NL ++LR+   T E + +  Q      +G  L   + L+  H++ E ++ T  E L +  ++A       H D   +   +  LE   ++L      R + L++   +H F  D D E  W+ + +         + L   + L  KHK L  EI   KP    +  +GK L  E  P    ++++R  +L + W  LE   + R+ +L+ +A   QF  D N+   W+ EK   VN  D   D       + + + +  +L  Y   + N++   +
Sbjct:  432 LKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMS-------NLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPR-SSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          

HSP 6 Score: 77.7962 bits (190), Expect = 3.150e-13
Identity = 111/497 (22.33%), Postives = 217/497 (43.66%), Query Frame = 3
Query:  861 VRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVE---KPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEE-----LVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDL---LEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            V+ L  W+   I K+N    P+++N+ + + LE  + R VE   +   FA      E+L +   +Q+ +N++ Y      L + +  AW     +E AR++    +L            F  +    E WL    + LNN + G +    E  + K +     L A+ ++T       L++ A ++        D I  + + I  R +KL +L   ++    +       L+       E D    Q     L ++Y    +L   ++KH   D +L + S R   + ++    +   +  +   D+   +  Q++ L GD   L   SQ ++++L+Q  +     R ++E  NW+      +++++ G D A+V  L+++HE  E++++ H  + ++LK       + +     EIH+      + +  L      RR  L+D+   Q++  DAED  QW+AE   +  +++ G    + Q L K+H +L  E++
Sbjct: 2576 VKELELWVNDMIKKMNNTQSPSTINDCETQ-LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-----SERARDLTEAHQLQL----------FKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT-------LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERK----QRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI---RGDHFAKDE---IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039          

HSP 7 Score: 64.3142 bits (155), Expect = 3.824e-9
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 6906 LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
             + + D++  W+ +K Q+I     +A  L   L L QK+KAL  EI + +P+  Q+      L+  QHP+S E ++ + ++ E W  L +  + R   L++A +   F+ + +  E+W  EK  LV++ + G+D     +L
Sbjct:  610 FMEDYDNEESWLVDK-QRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQAL 749          

HSP 8 Score: 62.7734 bits (151), Expect = 9.447e-9
Identity = 52/214 (24.30%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIH--KSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI 2216
            + ++D G+       L+ K + VD  ++    R   IN       D L +Q   P   Q+++ + K+ + +   L       R  L      H   RD+++  + ++ +   M++ +TG D A+V  LIRR E  E ++SA     ++ + +A  L K ++   G  H  + L+ L + W NL+ +  +R+++L +AY   K+ +D ++ + W+
Sbjct: 2375 VQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHIN----QLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIK-KYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWV 2583          

HSP 9 Score: 60.8474 bits (146), Expect = 4.265e-8
Identity = 33/134 (24.63%), Postives = 71/134 (52.99%), Query Frame = 3
Query: 8670 KKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI 9071
            +KH+    E+++ +P        GKRLI E H  S EI  ++  L    + L+ + + + ++L +  + +++        SW+NE   +  S +YGND  S + L ++  D++ ++N++   + ++ ++AD +I
Sbjct:  645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 778          

HSP 10 Score: 56.6102 bits (135), Expect = 8.335e-7
Identity = 75/403 (18.61%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNE 2432
            W+ + ++V  + + G  +++ E  I   E   + +N  + R +   E    L   N   + +I ++  + +  W++L+DL++++Q   A + ++     +      +  E D     + S D G+   + + L  KH + + +L  +  + + +        ++ K   + PD ++ +E +          L E +  R+ +L Q         +  +   W++  +  +T  E  +  A    L+   + +++EI      F K   +   L K +     E+   +  L      L+   ++RR + +   + Q +  DAE  +QWI+   P + + + G+     + L++RH    + ++  EE    +KR+  L  L      +H +  E++ KL + E
Sbjct: 3216 WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD---ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSV------LAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLF-----RHQLEQEKISKLQEKE 3604          

HSP 11 Score: 54.6842 bits (130), Expect = 2.927e-6
Identity = 77/366 (21.04%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 6669 LEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRR-QKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED 7733
            L + +  L KH   + +I    +R   L+     L        D  N    + V+RR Q++   +R +   L NQ++ L+       LLRE       V E  QQ  + D   + L  +  LLQ +     +++ +    ++   ++    +++H  +      + ++ E + +LL  S  R + L+EA++   F ++ D  E+W  +K+ +        DL   +SLQ K   L + +  ++    ++   +    +L+  +    P +  I+SR  ++   W  L+  +E  + +L +A + + +Y +       + +++ LV  +D+G+D  S + L ++   ++ +LNA +     L Q  D
Sbjct:  425 LRQVDATLKKHEAISADILARVERFNDLTAMAEEL--------DRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVE-ELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQM---STAGKRLIGEQH---PRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0300017)

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 850/3171 (26.81%), Postives = 1527/3171 (48.16%), Query Frame = 3
Query: 2604 GRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLKEFE-------APKMRXXXXXXXXXXXXXXXXWFPIDSDVAKNYLAKKNRKSMHAEIFKGPTVRNQNELHYDKEN---IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNP--DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF----KDTCRKINVLPELVEAVTKKFNETSDNFES-FRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANE-AIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQN----C-LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKS---ANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVP--PTDDQLNTVQENLLSC--VKETQN-AWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNN---LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEID----------------MESSNF--VKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQR---------KEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSL--HRGNSGS--KIPPV-KPVVEDVRSRKLLKKQASAGQLDIQPTF--------IRPIKFSTAIAD---IDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKL 11870
            G+ + + K EV  +  K +D+WW V   + ++G+ PANY++E E        PK  K K  +  K   +V++  P+             ++     +   P V+ +       EN   +EK+Q  +N+ + EL+ +A+ R   LE S     F++ECD F ++MK KE     R   + + EG+   K+K+E  I DL+A S R+          + ID  ++   R+  +++           K+  R ++I   W++LN  K  +EKSLEGASS++LFN+T DE +  +++K+  L+   +  D  + + L+R+ QNL R++  ++ ++ R  YLG+ VK  YP E + VN + +E+ D++ ++Q      +N + +      F N +K     ++ +   +      +DV +    +++   L  +I   +    ++  L   +   +PN +   + + RL  +  ++     ++ K L   ++ Q F +E D+I++        L+  N   S+D+VE  LK H +    +   D  ++  S    +L  N   DS+ I +R ++VL K   +  +   +K  L+   +F KF   A++L  W+ DK     +ENY+DL NLP KLQKH+A E E+++N   L  +   G  L++  + +   V+  +  ++++WK L   +EDK +KL QA+ Q E N +L D  +K D ++  +++  +GNDL S K LI K  ILESE+    + +A+L     +MA  GHF+ +NI    ++L+ R   L     +R + L+++L +H+F F++D E QWI EH P+A  N+ G++L  A  L  KHKKL  EI GH+P++   L +G+ L  +  P  ++ VE+  + L+  W  LE+   +R  KLD+S   +Q+L D  +I  W+ E++  +  ++   D D  A  + K K+I ++L TY  ++  + H+            + +    +L+E + K  ++ +   +     SL   +  LE+            EVE WI E+++ A S ++G+D + ++ L+++++     +E+G DRV  C   A +L+ S++  + E+   QE ++  W+ LL   +Q+  K  AA EIH+F++   +    +   N +L  +  +D N+     ++ + F  +L  ++ QL  +   + +L+ KYP+N+  I ++ D +   W  L E +  +G +L    D       +++ +++ + +   ++A+  ++    A    IQ    + E +   E   + L   S+ +         + ++     ML++R K   A N+     + I+++Q     C LRD  QI++ ++ Q+  +  ++F   +E+ +  + KH  F   I   +++V  L      L E +H+D  NI ++    + RRQK+ D       KL +  ++   +R+  +  +W++EK ++++    S      L+EK+  LQK++A  AE++A++   +++      L++ QH  S E K  +  +LE W  LL+E ++R   L+EA+D L F  +LD +EAW R+KE +V A++ G DL+HC +L  KL +     +VD+ R+  I Q A++L+ +  +PA +  ++  R K     W  L+  L AY+  L  A ++H +  ++   +D+I ++   +   D G D+ +VE L R++  +ERD++A+ +K  +    AE +        +  I  K +E+      L  L+ +R   LN +Y   K V D K L        + +N +  P+      T L++H E K  +                  E R    + +  Q E +   P   Q + V++ LL    + +T N AW++R   L E  QL  F    E  E WL  +    +  LNN     S + VE + +  D       L+ A    T++     ILE     +  D  L   K   ++     L E      Q L+   +LQE  + + +   W+  K+ +A D NY +  NL +K++KH  F +E+ +N P +Q+ I  G+RLI  +H +  EI ++V  L+    +LK  S  K  +L +      + R V+ F +W++E E    S +YG DL +V  L ++   +E D+  H E    ++++ +      ++L  +I E++ +   R+  L E L     NL D+  L +F  D   EL W+ +K  +A  +++G+SL       K+H +L +E+ ++   I+++ ++ + +   NHFA +Q++ +   L+    +L +    R  +LL     Q F  +  E +  + +K  +L++ + G DE S     KKLE L  E+                 +E ++F    ++EK + +  +Y++  + L K  +++L E K                + Y+RE+EE+  W+ +Q  +   E+YG+D +    LI  F+S+   LNAN+ ++      G +LI E NP+   I++      +    LKD    R++AL GA +VH + R A++ I                            + ++K  ++IS ++ Q L  ++ L      FE +L  +  Q++    E+ +L EIYPDAK+HI  K +E  + W  LK     ++NKL++ ++LQ +  +Y+DL++W      KIT+ E L   VAG+ELL+  + +H  EI ++ +   K   +G  +     ++   VE+K   +Q   + +   L  RRE+YE N+D + F+ +   LE W+   E  +K  D K   S+P++E+  + HED+ K V +++ KF AIKR T LE+LF+ +         +EKER+ K+ L        +K+RE Q++  E+   +    HR N+ S  K P    P+V   ++     +  +  Q+ ++P F        ++    S    D       D  +   E +    K  K   SF+T++R    R N   +                   + P    Q     G + RK  L S G KA VRSWK ++  L G  + ++KD+   L Q +      NI  A     + Y K+ +V  +KL D SEF  +  S +    W+ K+
Sbjct:  895 GQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPV-------------KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRV----------EEIDGAVDTFRRQGHSQL----------DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP-EREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLES-----------DEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGE-IEAREDKFRYLNELSDSMVQTGHYAAAD-VEEKCAAMLDERQKLHAAWNK-----KKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA-DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEI------------------EGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANK----EAFLNNDDLGDSYTAVERLLKKHD---EFEKLLHADHVDTLQKFANSILE----GEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLR-LAKERESRLGECK--------------KLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQ---------------------------LINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPE-LANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLK--DTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERL------EQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSG--PQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKNQKGE-----------------GFDLPPVEIQ-----GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKI 3901          

HSP 2 Score: 534.643 bits (1376), Expect = 1.768e-151
Identity = 331/767 (43.16%), Postives = 471/767 (61.41%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMII----ETESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKL--SPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSD---RFNQ--INYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            E  R++ LQE+R  IQKKTFTKWMNS L +A  +V+DLF DL DG  L+ L+E+IS+  LGK N G +RV  IENVNK+L ++ +KV LE+IGAEDIVDGN RLILGLIWTIILRFQIQE+ I    E ES EK+SAKDALLLWCQ KT GY  V+I DF  SWR GL FNALIH+H P+L +YS +  S  ++  NL  AF  A  EL IP+LLD ED+D  RPD+KSILTYV+S Y +FA+MK E    KR+  IV   ++  R    YE L  NLL WI++K ++L  RD PNSL  +Q+E+L FKEYRT+EKPPK+ ERS I+   F I    K  N   Y P +G L+ ++E AW  LE AEH RE+ LR ELLRQE+LEQ   KF KK+ LRE +L E++ VL++      ++  +A + K E ++ +I    ERF  L  +A  L+  NYH K+ +  R  ++  +W++L +L+ +++ +  +++ L+++LR I +       L+ Q  S D+G H L  ++LL+ H+L + Q+    +   RFN+  + YKS +  D+             L  +L +L    + L   S  RR +L++  N+H  M D + E++WL ++ ++     T  D  +VL L ++H+  E EI +  P   ++  +   L   Q     EI   +D L++ W  LE +   RR  L+DA E  ++Y DA +++ W+ E   LV +++ GNDE + QAL++RH  L  E++ +
Sbjct:   62 ENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPR---YLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAA-----------LLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 814          

HSP 3 Score: 95.9005 bits (237), Expect = 1.088e-18
Identity = 71/302 (23.51%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1425 ISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + +R +D+  RWK L  L   K     + A      R++   + + D L   + S D+G    + KDL+ K  +++ ++     +  ++     D        +QN+        E   K L      L + +Q+RR +L+++ NYHK + +L+ E  W++  +    + E G +      L ++H+  E+EI  H P+ NK  ++   L   Q     ++      L Q W +LER   ER   L  + + Q+Y  DA + + W+ E   ++ + E G D  +   L+ +H  +  E+  +
Sbjct: 1523 VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNI--------EAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTY 1816          

HSP 4 Score: 83.5741 bits (205), Expect = 5.965e-15
Identity = 82/351 (23.36%), Postives = 154/351 (43.87%), Query Frame = 3
Query: 1296 NFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK----QADSGKLAFXXXXXXXXXXXXMEF----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            N +++I K      E+ +   R Q +      L   ++ +KD I+ +   ++  W KL+    +K    Q     LAF  S+         EF    D ++ Q++S D GK   A  +LL+KH  ++  +    +  +Q+  K   F  +         +R T+  +        N L+E    RRE L+ + +  + +RD E+E  WL+ +  V  +++ G    SV  L ++H   E+E+++  P+   L      + +       ++    + L +    L  + + RR  L DA E Q +Y +A ++  W+ E  P++ + + G DE + Q   K+   L  E++ F
Sbjct: 2862 NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVD--------EFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIR------RYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAF 3198          

HSP 5 Score: 82.0333 bits (201), Expect = 1.787e-14
Identity = 83/352 (23.58%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 4446 LQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQ------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTN 5480
            L+KH+A+ A+I + +     +     +L + N+  K+ V+   + +  KW++L    E++   L Q S       NL ++LR+   T E + +  Q      +G  L   + L+  H++ E ++ T  E L +  ++A       H D   +   +  LE   ++L      R + L++   +H F  D D E  W+ + +         + L   + L  KHK L  EI   KP    +  +GK L  E  P    ++++R  +L + W  LE   + R+ +L+ +A   QF  D N+   W+ EK   VN  D   D       + + + +  +L  Y   + N++   +
Sbjct:  483 LKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMS-------NLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPR-SSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 826          

HSP 6 Score: 77.411 bits (189), Expect = 3.734e-13
Identity = 111/497 (22.33%), Postives = 217/497 (43.66%), Query Frame = 3
Query:  861 VRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVE---KPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEE-----LVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDL---LEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            V+ L  W+   I K+N    P+++N+ + + LE  + R VE   +   FA      E+L +   +Q+ +N++ Y      L + +  AW     +E AR++    +L            F  +    E WL    + LNN + G +    E  + K +     L A+ ++T       L++ A ++        D I  + + I  R +KL +L   ++    +       L+       E D    Q     L ++Y    +L   ++KH   D +L + S R   + ++    +   +  +   D+   +  Q++ L GD   L   SQ ++++L+Q  +     R ++E  NW+      +++++ G D A+V  L+++HE  E++++ H  + ++LK       + +     EIH+      + +  L      RR  L+D+   Q++  DAED  QW+AE   +  +++ G    + Q L K+H +L  E++
Sbjct: 2627 VKELELWVNDMIKKMNNTQSPSTINDCETQ-LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-----SERARDLTEAHQLQL----------FKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT-------LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERK----QRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI---RGDHFAKDE---IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3090          

HSP 7 Score: 64.3142 bits (155), Expect = 3.241e-9
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 6906 LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
             + + D++  W+ +K Q+I     +A  L   L L QK+KAL  EI + +P+  Q+      L+  QHP+S E ++ + ++ E W  L +  + R   L++A +   F+ + +  E+W  EK  LV++ + G+D     +L
Sbjct:  661 FMEDYDNEESWLVDK-QRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQAL 800          

HSP 8 Score: 62.7734 bits (151), Expect = 9.788e-9
Identity = 52/214 (24.30%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIH--KSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI 2216
            + ++D G+       L+ K + VD  ++    R   IN       D L +Q   P   Q+++ + K+ + +   L       R  L      H   RD+++  + ++ +   M++ +TG D A+V  LIRR E  E ++SA     ++ + +A  L K ++   G  H  + L+ L + W NL+ +  +R+++L +AY   K+ +D ++ + W+
Sbjct: 2426 VQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHIN----QLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIK-KYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWV 2634          

HSP 9 Score: 60.8474 bits (146), Expect = 3.769e-8
Identity = 33/134 (24.63%), Postives = 71/134 (52.99%), Query Frame = 3
Query: 8670 KKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI 9071
            +KH+    E+++ +P        GKRLI E H  S EI  ++  L    + L+ + + + ++L +  + +++        SW+NE   +  S +YGND  S + L ++  D++ ++N++   + ++ ++AD +I
Sbjct:  696 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 829          

HSP 10 Score: 56.225 bits (134), Expect = 1.029e-6
Identity = 75/403 (18.61%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNE 2432
            W+ + ++V  + + G  +++ E  I   E   + +N  + R +   E    L   N   + +I ++  + +  W++L+DL++++Q   A + ++     +      +  E D     + S D G+   + + L  KH + + +L  +  + + +        ++ K   + PD ++ +E +          L E +  R+ +L Q         +  +   W++  +  +T  E  +  A    L+   + +++EI      F K   +   L K +     E+   +  L      L+   ++RR + +   + Q +  DAE  +QWI+   P + + + G+     + L++RH    + ++  EE    +KR+  L  L      +H +  E++ KL + E
Sbjct: 3267 WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD---ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSV------LAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLF-----RHQLEQEKISKLQEKE 3655          

HSP 11 Score: 55.0694 bits (131), Expect = 2.522e-6
Identity = 77/366 (21.04%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 6669 LEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRR-QKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED 7733
            L + +  L KH   + +I    +R   L+     L        D  N    + V+RR Q++   +R +   L NQ++ L+       LLRE       V E  QQ  + D   + L  +  LLQ +     +++ +    ++   ++    +++H  +      + ++ E + +LL  S  R + L+EA++   F ++ D  E+W  +K+ +        DL   +SLQ K   L + +  ++    ++   +    +L+  +    P +  I+SR  ++   W  L+  +E  + +L +A + + +Y +       + +++ LV  +D+G+D  S + L ++   ++ +LNA +     L Q  D
Sbjct:  476 LRQVDATLKKHEAISADILARVERFNDLTAMAEEL--------DRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVE-ELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQM---STAGKRLIGEQH---PRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 826          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0332056)

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 850/3171 (26.81%), Postives = 1527/3171 (48.16%), Query Frame = 3
Query: 2604 GRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLKEFE-------APKMRXXXXXXXXXXXXXXXXWFPIDSDVAKNYLAKKNRKSMHAEIFKGPTVRNQNELHYDKEN---IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNP--DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF----KDTCRKINVLPELVEAVTKKFNETSDNFES-FRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANE-AIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQN----C-LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKS---ANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVP--PTDDQLNTVQENLLSC--VKETQN-AWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNN---LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEID----------------MESSNF--VKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQR---------KEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSL--HRGNSGS--KIPPV-KPVVEDVRSRKLLKKQASAGQLDIQPTF--------IRPIKFSTAIAD---IDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKL 11870
            G+ + + K EV  +  K +D+WW V   + ++G+ PANY++E E        PK  K K  +  K   +V++  P+             ++     +   P V+ +       EN   +EK+Q  +N+ + EL+ +A+ R   LE S     F++ECD F ++MK KE     R   + + EG+   K+K+E  I DL+A S R+          + ID  ++   R+  +++           K+  R ++I   W++LN  K  +EKSLEGASS++LFN+T DE +  +++K+  L+   +  D  + + L+R+ QNL R++  ++ ++ R  YLG+ VK  YP E + VN + +E+ D++ ++Q      +N + +      F N +K     ++ +   +      +DV +    +++   L  +I   +    ++  L   +   +PN +   + + RL  +  ++     ++ K L   ++ Q F +E D+I++        L+  N   S+D+VE  LK H +    +   D  ++  S    +L  N   DS+ I +R ++VL K   +  +   +K  L+   +F KF   A++L  W+ DK     +ENY+DL NLP KLQKH+A E E+++N   L  +   G  L++  + +   V+  +  ++++WK L   +EDK +KL QA+ Q E N +L D  +K D ++  +++  +GNDL S K LI K  ILESE+    + +A+L     +MA  GHF+ +NI    ++L+ R   L     +R + L+++L +H+F F++D E QWI EH P+A  N+ G++L  A  L  KHKKL  EI GH+P++   L +G+ L  +  P  ++ VE+  + L+  W  LE+   +R  KLD+S   +Q+L D  +I  W+ E++  +  ++   D D  A  + K K+I ++L TY  ++  + H+            + +    +L+E + K  ++ +   +     SL   +  LE+            EVE WI E+++ A S ++G+D + ++ L+++++     +E+G DRV  C   A +L+ S++  + E+   QE ++  W+ LL   +Q+  K  AA EIH+F++   +    +   N +L  +  +D N+     ++ + F  +L  ++ QL  +   + +L+ KYP+N+  I ++ D +   W  L E +  +G +L    D       +++ +++ + +   ++A+  ++    A    IQ    + E +   E   + L   S+ +         + ++     ML++R K   A N+     + I+++Q     C LRD  QI++ ++ Q+  +  ++F   +E+ +  + KH  F   I   +++V  L      L E +H+D  NI ++    + RRQK+ D       KL +  ++   +R+  +  +W++EK ++++    S      L+EK+  LQK++A  AE++A++   +++      L++ QH  S E K  +  +LE W  LL+E ++R   L+EA+D L F  +LD +EAW R+KE +V A++ G DL+HC +L  KL +     +VD+ R+  I Q A++L+ +  +PA +  ++  R K     W  L+  L AY+  L  A ++H +  ++   +D+I ++   +   D G D+ +VE L R++  +ERD++A+ +K  +    AE +        +  I  K +E+      L  L+ +R   LN +Y   K V D K L        + +N +  P+      T L++H E K  +                  E R    + +  Q E +   P   Q + V++ LL    + +T N AW++R   L E  QL  F    E  E WL  +    +  LNN     S + VE + +  D       L+ A    T++     ILE     +  D  L   K   ++     L E      Q L+   +LQE  + + +   W+  K+ +A D NY +  NL +K++KH  F +E+ +N P +Q+ I  G+RLI  +H +  EI ++V  L+    +LK  S  K  +L +      + R V+ F +W++E E    S +YG DL +V  L ++   +E D+  H E    ++++ +      ++L  +I E++ +   R+  L E L     NL D+  L +F  D   EL W+ +K  +A  +++G+SL       K+H +L +E+ ++   I+++ ++ + +   NHFA +Q++ +   L+    +L +    R  +LL     Q F  +  E +  + +K  +L++ + G DE S     KKLE L  E+                 +E ++F    ++EK + +  +Y++  + L K  +++L E K                + Y+RE+EE+  W+ +Q  +   E+YG+D +    LI  F+S+   LNAN+ ++      G +LI E NP+   I++      +    LKD    R++AL GA +VH + R A++ I                            + ++K  ++IS ++ Q L  ++ L      FE +L  +  Q++    E+ +L EIYPDAK+HI  K +E  + W  LK     ++NKL++ ++LQ +  +Y+DL++W      KIT+ E L   VAG+ELL+  + +H  EI ++ +   K   +G  +     ++   VE+K   +Q   + +   L  RRE+YE N+D + F+ +   LE W+   E  +K  D K   S+P++E+  + HED+ K V +++ KF AIKR T LE+LF+ +         +EKER+ K+ L        +K+RE Q++  E+   +    HR N+ S  K P    P+V   ++     +  +  Q+ ++P F        ++    S    D       D  +   E +    K  K   SF+T++R    R N   +                   + P    Q     G + RK  L S G KA VRSWK ++  L G  + ++KD+   L Q +      NI  A     + Y K+ +V  +KL D SEF  +  S +    W+ K+
Sbjct:  895 GQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPV-------------KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRV----------EEIDGAVDTFRRQGHSQL----------DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP-EREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLES-----------DEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGE-IEAREDKFRYLNELSDSMVQTGHYAAAD-VEEKCAAMLDERQKLHAAWNK-----KKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA-DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEI------------------EGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANK----EAFLNNDDLGDSYTAVERLLKKHD---EFEKLLHADHVDTLQKFANSILE----GEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLR-LAKERESRLGECK--------------KLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQ---------------------------LINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPE-LANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLK--DTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERL------EQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSG--PQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKNQKGE-----------------GFDLPPVEIQ-----GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKI 3901          

HSP 2 Score: 534.643 bits (1376), Expect = 1.774e-151
Identity = 331/767 (43.16%), Postives = 471/767 (61.41%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMII----ETESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKL--SPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSD---RFNQ--INYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            E  R++ LQE+R  IQKKTFTKWMNS L +A  +V+DLF DL DG  L+ L+E+IS+  LGK N G +RV  IENVNK+L ++ +KV LE+IGAEDIVDGN RLILGLIWTIILRFQIQE+ I    E ES EK+SAKDALLLWCQ KT GY  V+I DF  SWR GL FNALIH+H P+L +YS +  S  ++  NL  AF  A  EL IP+LLD ED+D  RPD+KSILTYV+S Y +FA+MK E    KR+  IV   ++  R    YE L  NLL WI++K ++L  RD PNSL  +Q+E+L FKEYRT+EKPPK+ ERS I+   F I    K  N   Y P +G L+ ++E AW  LE AEH RE+ LR ELLRQE+LEQ   KF KK+ LRE +L E++ VL++      ++  +A + K E ++ +I    ERF  L  +A  L+  NYH K+ +  R  ++  +W++L +L+ +++ +  +++ L+++LR I +       L+ Q  S D+G H L  ++LL+ H+L + Q+    +   RFN+  + YKS +  D+             L  +L +L    + L   S  RR +L++  N+H  M D + E++WL ++ ++     T  D  +VL L ++H+  E EI +  P   ++  +   L   Q     EI   +D L++ W  LE +   RR  L+DA E  ++Y DA +++ W+ E   LV +++ GNDE + QAL++RH  L  E++ +
Sbjct:   62 ENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPR---YLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAA-----------LLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 814          

HSP 3 Score: 95.5153 bits (236), Expect = 1.213e-18
Identity = 71/302 (23.51%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1425 ISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + +R +D+  RWK L  L   K     + A      R++   + + D L   + S D+G    + KDL+ K  +++ ++     +  ++     D        +QN+        E   K L      L + +Q+RR +L+++ NYHK + +L+ E  W++  +    + E G +      L ++H+  E+EI  H P+ NK  ++   L   Q     ++      L Q W +LER   ER   L  + + Q+Y  DA + + W+ E   ++ + E G D  +   L+ +H  +  E+  +
Sbjct: 1523 VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNI--------EAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTY 1816          

HSP 4 Score: 83.5741 bits (205), Expect = 5.864e-15
Identity = 82/351 (23.36%), Postives = 154/351 (43.87%), Query Frame = 3
Query: 1296 NFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK----QADSGKLAFXXXXXXXXXXXXMEF----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            N +++I K      E+ +   R Q +      L   ++ +KD I+ +   ++  W KL+    +K    Q     LAF  S+         EF    D ++ Q++S D GK   A  +LL+KH  ++  +    +  +Q+  K   F  +         +R T+  +        N L+E    RRE L+ + +  + +RD E+E  WL+ +  V  +++ G    SV  L ++H   E+E+++  P+   L      + +       ++    + L +    L  + + RR  L DA E Q +Y +A ++  W+ E  P++ + + G DE + Q   K+   L  E++ F
Sbjct: 2862 NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVD--------EFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIR------RYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAF 3198          

HSP 5 Score: 81.6481 bits (200), Expect = 1.926e-14
Identity = 83/352 (23.58%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 4446 LQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQ------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTN 5480
            L+KH+A+ A+I + +     +     +L + N+  K+ V+   + +  KW++L    E++   L Q S       NL ++LR+   T E + +  Q      +G  L   + L+  H++ E ++ T  E L +  ++A       H D   +   +  LE   ++L      R + L++   +H F  D D E  W+ + +         + L   + L  KHK L  EI   KP    +  +GK L  E  P    ++++R  +L + W  LE   + R+ +L+ +A   QF  D N+   W+ EK   VN  D   D       + + + +  +L  Y   + N++   +
Sbjct:  483 LKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMS-------NLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPR-SSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 826          

HSP 6 Score: 77.411 bits (189), Expect = 4.233e-13
Identity = 111/497 (22.33%), Postives = 217/497 (43.66%), Query Frame = 3
Query:  861 VRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVE---KPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEE-----LVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDL---LEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            V+ L  W+   I K+N    P+++N+ + + LE  + R VE   +   FA      E+L +   +Q+ +N++ Y      L + +  AW     +E AR++    +L            F  +    E WL    + LNN + G +    E  + K +     L A+ ++T       L++ A ++        D I  + + I  R +KL +L   ++    +       L+       E D    Q     L ++Y    +L   ++KH   D +L + S R   + ++    +   +  +   D+   +  Q++ L GD   L   SQ ++++L+Q  +     R ++E  NW+      +++++ G D A+V  L+++HE  E++++ H  + ++LK       + +     EIH+      + +  L      RR  L+D+   Q++  DAED  QW+AE   +  +++ G    + Q L K+H +L  E++
Sbjct: 2627 VKELELWVNDMIKKMNNTQSPSTINDCETQ-LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-----SERARDLTEAHQLQL----------FKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT-------LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERK----QRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI---RGDHFAKDE---IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3090          

HSP 7 Score: 64.3142 bits (155), Expect = 3.351e-9
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 6906 LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
             + + D++  W+ +K Q+I     +A  L   L L QK+KAL  EI + +P+  Q+      L+  QHP+S E ++ + ++ E W  L +  + R   L++A +   F+ + +  E+W  EK  LV++ + G+D     +L
Sbjct:  661 FMEDYDNEESWLVDK-QRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQAL 800          

HSP 8 Score: 62.7734 bits (151), Expect = 1.029e-8
Identity = 52/214 (24.30%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIH--KSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI 2216
            + ++D G+       L+ K + VD  ++    R   IN       D L +Q   P   Q+++ + K+ + +   L       R  L      H   RD+++  + ++ +   M++ +TG D A+V  LIRR E  E ++SA     ++ + +A  L K ++   G  H  + L+ L + W NL+ +  +R+++L +AY   K+ +D ++ + W+
Sbjct: 2426 VQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHIN----QLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIK-KYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWV 2634          

HSP 9 Score: 60.8474 bits (146), Expect = 3.929e-8
Identity = 33/134 (24.63%), Postives = 71/134 (52.99%), Query Frame = 3
Query: 8670 KKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI 9071
            +KH+    E+++ +P        GKRLI E H  S EI  ++  L    + L+ + + + ++L +  + +++        SW+NE   +  S +YGND  S + L ++  D++ ++N++   + ++ ++AD +I
Sbjct:  696 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 829          

HSP 10 Score: 56.225 bits (134), Expect = 1.073e-6
Identity = 75/403 (18.61%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNE 2432
            W+ + ++V  + + G  +++ E  I   E   + +N  + R +   E    L   N   + +I ++  + +  W++L+DL++++Q   A + ++     +      +  E D     + S D G+   + + L  KH + + +L  +  + + +        ++ K   + PD ++ +E +          L E +  R+ +L Q         +  +   W++  +  +T  E  +  A    L+   + +++EI      F K   +   L K +     E+   +  L      L+   ++RR + +   + Q +  DAE  +QWI+   P + + + G+     + L++RH    + ++  EE    +KR+  L  L      +H +  E++ KL + E
Sbjct: 3267 WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD---ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSV------LAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLF-----RHQLEQEKISKLQEKE 3655          

HSP 11 Score: 54.6842 bits (130), Expect = 2.882e-6
Identity = 77/366 (21.04%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 6669 LEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRR-QKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED 7733
            L + +  L KH   + +I    +R   L+     L        D  N    + V+RR Q++   +R +   L NQ++ L+       LLRE       V E  QQ  + D   + L  +  LLQ +     +++ +    ++   ++    +++H  +      + ++ E + +LL  S  R + L+EA++   F ++ D  E+W  +K+ +        DL   +SLQ K   L + +  ++    ++   +    +L+  +    P +  I+SR  ++   W  L+  +E  + +L +A + + +Y +       + +++ LV  +D+G+D  S + L ++   ++ +LNA +     L Q  D
Sbjct:  476 LRQVDATLKKHEAISADILARVERFNDLTAMAEEL--------DRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVE-ELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQM---STAGKRLIGEQH---PRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 826          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0303857)

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 852/3171 (26.87%), Postives = 1528/3171 (48.19%), Query Frame = 3
Query: 2604 GRDISLIKDEVYKVLKKASDEWWLVETQDQIKGYAPANYLKEFE-------APKMRXXXXXXXXXXXXXXXXWFPIDSDVAKNYLAKKNRKSMHAEIFKGPTVRNQNELHYDKEN---IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNP--DSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF----KDTCRKINVLPELVEAVTKKFNETSDNFES-FRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANE-AIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQN----C-LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKS---ANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVP--PTDDQLNTVQENLLSC--VKETQN-AWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNN---LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEID----------------MESSNF--VKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQR---------KEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSL--HRGNSGS--KIPPV-KPVVEDVRSRKLLKKQASAGQLDIQPTF--------IRPIKFSTAIAD---IDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKL 11870
            G+ + + K EV  +  K +D+WW V   + ++G+ PANY++E E        PK  K K  +  K   +V++  P+             ++     +   P V+ +       EN   +EK+Q  +N+ + EL+ +A+ R   LE S     F++ECD F ++MK KE     R   + + EG+   K+K+E  I DL+A S R+          + ID  ++   R+  +++           K+  R ++I   W++LN  K  +EKSLEGASS++LFN+T DE +  +++K+  L+   +  D  + + L+R+ QNL R++  ++ ++ R  YLG+ VK  YP E + VN + +E+ D++ ++Q      +N + +      F N +K     ++ +   +      +DV +    +++   L  +I   +    ++  L   +   +PN +   + + RL  +  ++     ++ K L   ++ Q F +E D+I++        L+  N   S+D+VE  LK H +    +   D  ++  S    +L  N   DS+ I +R ++VL K   +  +   +K  L+   +F KF   A++L  W+ DK     +ENY+DL NLP KLQKH+A E E+++N   L  +   G  L++  + +   V+  +  ++++WK L   +EDK +KL QA+ Q E N +L D  +K D ++  +++  +GNDL S K LI K  ILESE+    + +A+L     +MA  GHF+ +NI    ++L+ R   L     +R + L+++L +H+F F++D E QWI EH P+A  N+ G++L  A  L  KHKKL  EI GH+P++   L +G+ L  +  P  ++ VE+  + L+  W  LE+   +R  KLD+S   +Q+L D  +I  W+ E++  +  ++   D D  A  + K K+I ++L TY  ++  + H+            + +    +L+E + K  ++ +   +     SL   +  LE+            EVE WI E+++ A S ++G+D + ++ L+++++     +E+G DRV  C   A +L+ S++  + E+   QE ++  W+ LL   +Q+  K  AA EIH+F++   +    +   N +L  +  +D N+     ++ + F  +L  ++ QL  +   + +L+ KYP+N+  I ++ D +   W  L E +  +G +L    D       +++ +++ + +   ++A+  ++    A    IQ    + E +   E   + L   S+ +         + ++     ML++R K   A N+     + I+++Q     C LRD  QI++ ++ Q+  +  ++F   +E+ +  + KH  F   I   +++V  L      L E +H+D  NI ++    + RRQK+ D       KL +  ++   +R+  +  +W++EK ++++    S      L+EK+  LQK++A  AE++A++   +++      L++ QH  S E K  +  +LE W  LL+E ++R   L+EA+D L F  +LD +EAW R+KE +V A++ G DL+HC +L  KL +     +VD+ R+  I Q A++L+ +  +PA +  ++  R K     W  L+  L AY+  L  A ++H +  ++   +D+I ++   +   D G D+ +VE L R++  +ERD++A+ +K  +    AE +        +  I  K +E+      L  L+ +R   LN +Y   K V D K L        + +N +  P+      T L++H E K  +                  E R    + +  Q E +   P   Q + V++ LL    + +T N AW++R   L E  QL  F    E  E WL  +    +  LNN     S + VE + +  D       L+ A    T++     ILE     +  D  L   K   ++     L E      Q L+   +LQE  + + +   W+  K+ +A D NY +  NL +K++KH  F +E+ +N P +Q+ I  G+RLI  +H +  EI ++V  L+    +LK  S  K  +L +      + R V+ F +W++E E    S +YG DL +V  L ++   +E D+  H E    ++++ +      ++L  +I E++ +   R+  L E L     NL D+  L +F  D   EL W+ +K  +A  +++G+SL       K+H +L +E+ ++   I+++ ++ + +   NHFA +Q++ +   L+    +L +    R  +LL     Q F  +  E +  + +K  +L++ + G DE S     KKLE L  E+                 +E ++F    ++EK + +  +Y++  + L K  +++L E K                + Y+RE+EE+  W+ +Q  +   E+YG+D +    LI  F+S+   LNAN+ ++      G +LI E NP+   I++      +    LKD    R++AL GA +VH + R A++ I                            + ++K  ++IS ++ Q L  ++ L      FE +L  +  Q++    E+ +L EIYPDAK+HI  K +E  + W  LK     ++NKL++ ++LQ +  +Y+DL++W      KIT+ E L   VAG+ELL+  + +H  EI ++ +   K   +G  +     ++   VE+K   +Q   + +   L  RRE+YE N+D + F+ +   LE W+   E  +K  D K   S+P++E+  + HED+ K V +++ KF AIKR T LE+LF+ +         +EKER+ K+ L        +K+RE Q++  E+   +    HR N+ S  K P    P+V   ++     +  +  Q+ ++P F        ++    S    D       D  +   E +    K  K   SF+T++R    R N         Q     D+        P    Q     G + RK  L S G KA VRSWK ++  L G  + ++KD+   L Q +      NI  A     + Y K+ +V  +KL D SEF  +  S +    W+ K+
Sbjct:  844 GQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPV-------------KRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKE-----RMIKSDEGEGVDNAKRKFEKFITDLSAASKRV----------EEIDGAVDTFRRQGHSQL----------DKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHP-EREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLES-----------DEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGE-IEAREDKFRYLNELSDSMVQTGHYAAAD-VEEKCAAMLDERQKLHAAWNK-----KKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPA-DTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEI------------------EGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANK----EAFLNNDDLGDSYTAVERLLKKHD---EFEKLLHADHVDTLQKFANSILE----GEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLR-LAKERESRLGECK--------------KLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQ---------------------------LINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPE-LANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLK--DTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKERL------EQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSG--PQSPALSQVQLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKN---------QKGEGFDL--------PPVEIQ-----GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKI 3850          

HSP 2 Score: 534.643 bits (1376), Expect = 1.719e-151
Identity = 331/767 (43.16%), Postives = 471/767 (61.41%), Query Frame = 3
Query:   57 EKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMII----ETESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKL--SPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSD---RFNQ--INYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            E  R++ LQE+R  IQKKTFTKWMNS L +A  +V+DLF DL DG  L+ L+E+IS+  LGK N G +RV  IENVNK+L ++ +KV LE+IGAEDIVDGN RLILGLIWTIILRFQIQE+ I    E ES EK+SAKDALLLWCQ KT GY  V+I DF  SWR GL FNALIH+H P+L +YS +  S  ++  NL  AF  A  EL IP+LLD ED+D  RPD+KSILTYV+S Y +FA+MK E    KR+  IV   ++  R    YE L  NLL WI++K ++L  RD PNSL  +Q+E+L FKEYRT+EKPPK+ ERS I+   F I    K  N   Y P +G L+ ++E AW  LE AEH RE+ LR ELLRQE+LEQ   KF KK+ LRE +L E++ VL++      ++  +A + K E ++ +I    ERF  L  +A  L+  NYH K+ +  R  ++  +W++L +L+ +++ +  +++ L+++LR I +       L+ Q  S D+G H L  ++LL+ H+L + Q+    +   RFN+  + YKS +  D+             L  +L +L    + L   S  RR +L++  N+H  M D + E++WL ++ ++     T  D  +VL L ++H+  E EI +  P   ++  +   L   Q     EI   +D L++ W  LE +   RR  L+DA E  ++Y DA +++ W+ E   LV +++ GNDE + QAL++RH  L  E++ +
Sbjct:   11 ENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPR---YLRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAA-----------LLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAY 763          

HSP 3 Score: 95.9005 bits (237), Expect = 1.046e-18
Identity = 71/302 (23.51%), Postives = 134/302 (44.37%), Query Frame = 3
Query: 1425 ISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDS--LKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + +R +D+  RWK L  L   K     + A      R++   + + D L   + S D+G    + KDL+ K  +++ ++     +  ++     D        +QN+        E   K L      L + +Q+RR +L+++ NYHK + +L+ E  W++  +    + E G +      L ++H+  E+EI  H P+ NK  ++   L   Q     ++      L Q W +LER   ER   L  + + Q+Y  DA + + W+ E   ++ + E G D  +   L+ +H  +  E+  +
Sbjct: 1472 VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNI--------EAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTY 1765          

HSP 4 Score: 83.5741 bits (205), Expect = 4.772e-15
Identity = 82/351 (23.36%), Postives = 154/351 (43.87%), Query Frame = 3
Query: 1296 NFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK----QADSGKLAFXXXXXXXXXXXXMEF----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            N +++I K      E+ +   R Q +      L   ++ +KD I+ +   ++  W KL+    +K    Q     LAF  S+         EF    D ++ Q++S D GK   A  +LL+KH  ++  +    +  +Q+  K   F  +         +R T+  +        N L+E    RRE L+ + +  + +RD E+E  WL+ +  V  +++ G    SV  L ++H   E+E+++  P+   L      + +       ++    + L +    L  + + RR  L DA E Q +Y +A ++  W+ E  P++ + + G DE + Q   K+   L  E++ F
Sbjct: 2811 NLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVD--------EFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIR------RYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAF 3147          

HSP 5 Score: 81.6481 bits (200), Expect = 2.155e-14
Identity = 83/352 (23.58%), Postives = 153/352 (43.47%), Query Frame = 3
Query: 4446 LQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKF-DTVEGMMKTAQ------LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTN 5480
            L+KH+A+ A+I + +     +     +L + N+  K+ V+   + +  KW++L    E++   L Q S       NL ++LR+   T E + +  Q      +G  L   + L+  H++ E ++ T  E L +  ++A       H D   +   +  LE   ++L      R + L++   +H F  D D E  W+ + +         + L   + L  KHK L  EI   KP    +  +GK L  E  P    ++++R  +L + W  LE   + R+ +L+ +A   QF  D N+   W+ EK   VN  D   D       + + + +  +L  Y   + N++   +
Sbjct:  432 LKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMS-------NLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPR-SSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          

HSP 6 Score: 77.7962 bits (190), Expect = 3.223e-13
Identity = 111/497 (22.33%), Postives = 217/497 (43.66%), Query Frame = 3
Query:  861 VRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVE---KPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEE-----LVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDL---LEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            V+ L  W+   I K+N    P+++N+ + + LE  + R VE   +   FA      E+L +   +Q+ +N++ Y      L + +  AW     +E AR++    +L            F  +    E WL    + LNN + G +    E  + K +     L A+ ++T       L++ A ++        D I  + + I  R +KL +L   ++    +       L+       E D    Q     L ++Y    +L   ++KH   D +L + S R   + ++    +   +  +   D+   +  Q++ L GD   L   SQ ++++L+Q  +     R ++E  NW+      +++++ G D A+V  L+++HE  E++++ H  + ++LK       + +     EIH+      + +  L      RR  L+D+   Q++  DAED  QW+AE   +  +++ G    + Q L K+H +L  E++
Sbjct: 2576 VKELELWVNDMIKKMNNTQSPSTINDCETQ-LELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAW-----SERARDLTEAHQLQL----------FKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDT-------LQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERK----QRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLI---RGDHFAKDE---IAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELT 3039          

HSP 7 Score: 63.929 bits (154), Expect = 4.328e-9
Identity = 40/141 (28.37%), Postives = 74/141 (52.48%), Query Frame = 3
Query: 6906 LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
             + + D++  W+ +K Q+I     +A  L   L L QK+KAL  EI + +P+  Q+      L+  QHP+S E ++ + ++ E W  L +  + R   L++A +   F+ + +  E+W  EK  LV++ + G+D     +L
Sbjct:  610 FMEDYDNEESWLVDK-QRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQAL 749          

HSP 8 Score: 62.7734 bits (151), Expect = 9.916e-9
Identity = 52/214 (24.30%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1581 INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIH--KSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI 2216
            + ++D G+       L+ K + VD  ++    R   IN       D L +Q   P   Q+++ + K+ + +   L       R  L      H   RD+++  + ++ +   M++ +TG D A+V  LIRR E  E ++SA     ++ + +A  L K ++   G  H  + L+ L + W NL+ +  +R+++L +AY   K+ +D ++ + W+
Sbjct: 2375 VQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHIN----QLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIK-KYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWV 2583          

HSP 9 Score: 60.4622 bits (145), Expect = 4.787e-8
Identity = 33/134 (24.63%), Postives = 71/134 (52.99%), Query Frame = 3
Query: 8670 KKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI 9071
            +KH+    E+++ +P        GKRLI E H  S EI  ++  L    + L+ + + + ++L +  + +++        SW+NE   +  S +YGND  S + L ++  D++ ++N++   + ++ ++AD +I
Sbjct:  645 QKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 778          

HSP 10 Score: 56.6102 bits (135), Expect = 7.654e-7
Identity = 75/403 (18.61%), Postives = 169/403 (41.94%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ---ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNE 2432
            W+ + ++V  + + G  +++ E  I   E   + +N  + R +   E    L   N   + +I ++  + +  W++L+DL++++Q   A + ++     +      +  E D     + S D G+   + + L  KH + + +L  +  + + +        ++ K   + PD ++ +E +          L E +  R+ +L Q         +  +   W++  +  +T  E  +  A    L+   + +++EI      F K   +   L K +     E+   +  L      L+   ++RR + +   + Q +  DAE  +QWI+   P + + + G+     + L++RH    + ++  EE    +KR+  L  L      +H +  E++ KL + E
Sbjct: 3216 WVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKD---ASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSV------LAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLF-----RHQLEQEKISKLQEKE 3604          

HSP 11 Score: 54.299 bits (129), Expect = 3.573e-6
Identity = 77/366 (21.04%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 6669 LEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRR-QKLHDNYRDIESKLSNQQIWLT-------LLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED 7733
            L + +  L KH   + +I    +R   L+     L        D  N    + V+RR Q++   +R +   L NQ++ L+       LLRE       V E  QQ  + D   + L  +  LLQ +     +++ +    ++   ++    +++H  +      + ++ E + +LL  S  R + L+EA++   F ++ D  E+W  +K+ +        DL   +SLQ K   L + +  ++    ++   +    +L+  +    P +  I+SR  ++   W  L+  +E  + +L +A + + +Y +       + +++ LV  +D+G+D  S + L ++   ++ +LNA +     L Q  D
Sbjct:  425 LRQVDATLKKHEAISADILARVERFNDLTAMAEEL--------DRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVE-ELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQM---STAGKRLIGEQH---PRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQAD 775          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Zebrafish
Match: sptbn5 (spectrin, beta, non-erythrocytic 5 [Source:ZFIN;Acc:ZDB-GENE-131121-26])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 657/2776 (23.67%), Postives = 1303/2776 (46.94%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKE--------NEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASI--VLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDI--------SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAAN-EAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTK---QALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKE--MKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDK-SANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQ----VDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNL--DANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLK-SLSTVEDVTENI---------------DAKRSISSLVSAREQKT--VKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNK---LLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV----KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIK-RQTKLE 11057
            H+ K+ IE  Q  L K F  L  LA+++   LE +   H+F+  C+ F  +M  KE   N   S + ++E ++ KYE  + +LA  SGR      L+ + +  D +L++   +              K  +  R   +  +WE++ KLK +    L  ++ +  F +T  E++  +  +L  L+  +VG    + +  + +     RDI+A++ +++  K +    K   P E   + E++  ++DL  +L+    +R+  L  A  +  F  ++++         E  L E  G         DV+S +  +++   LK EI L +A L  ++ L     V        ++   L +LD +   L    + R++ L+  LE QK   E D+IE+ IS    +L   +   SVD V + L     L A ++ ++  +     +  EL  K N  +++I  R+  + D   +L   C  ++++L    ++ +F  +A E+  W+D+K    E+E+Y+D  N+  KL+KH+A E E+++N   ++++ + G  ++  +H    +++   + + ++W +L     ++  KL QA +Q +  E L D   K + +E M++ A  G+DL S++ L+ +H  LE E +   E +  +  +A  +A + HFD + IL E          L   ++ R S L+ ++  + F  DVD EL WI EH+P A   +Y RSL  AV L  KHK L  E+N H   +  +L+ G+ + R  +    ++V+ R + L   W+ LE+    R  +L+ +    Q L D  ++   ++E S  V+    D    ++A R +  +   V+    + L   +    +  K   R   +     E + K  N         + S   ++  L        F+ E SE+E WI ++ +IA SN+ G D +    LR R+   LK +E+G++R+ TC + A++L+KS +  S  I   Q  ++  WD L   +  +  K   +E+ HKF K   D    +   + ++     KD   +    ++ +    EL   + QL ++         M + +L++      +L  E ++N    W++L     Q+  +L+  +D  +  +  ++   + +++ + +KA+  I  V   + +  Q  + +AE +A  ET  Q  VS  + L  ++  +  E IQ  +  + E+R K     Q   +W+   E+  ++Q   RD   +   T  QE+++K ++    +++ E L+ +H  F   +   +D++ AL      LK   +      NI +      +RR+++ D        L   ++     R+  +   W+ +++ +I+   K   + L+ K+ +LQK++   AEI AH    E +     ELVT  HPKS+E +  V  ++  W  L  E   R   L++ +D L F  +++ VE W R+KE +++  ++G D +H   L  KL+E  G       VD+A I  I   A +L ++ +    E   ++ R + +  RW     +L +YK +L  A ++H    EL  + D+  +++ L++ +  G D++SVE L R+   +ER+   + E+ A L +  +  D L    + S K+S KQ+E+K  L +L    K+R + L  S++      + + L D +L+Q++ +     P +   A + +  H + K  ++ R  + + +    + L +  +   S  A   E++   DD      + +L+       AW  R+  L++ ++L  FL   +  E W+   N++  +I  +L  SLS VE +   +               +  R    L+ A    +  +K     IL  LRK++I  +++++ + K++        E+ +++ + L +  E+           +W+  K  +A D +++D +NL  K+ KH+ F +E+ AN   +QA I  G  +++ +H +  +I  ++ D+D+   +L +    K  RL +  +  ++ R +     W+   E    + +YG DL SV +L +    +E  +++H E++Q + + A    ++ N+L  +I+++   + NR+  L E ++     L   ++L++F+ D+  EL WI+DK+Q    ++ G+SL      VK+H+ +M EI  R   I ++++  ++L    HFA  +I  + + L+ +++ L   K+E  NK   L      Q F S+V ++E  + ++  +L + + G +E++    ++KL+++ LE++ +      L +  +++    Q+    LV    +++Q +   + ++   +R  ++N  N+Y++ R++ ++ TW+ ++  +   ++YGKD +   +L ++F+ +     + +   +    +     L+++  S + +     + +    L    K R E L  A EVH F  + ++L  W+                           ++K  A+ S E    L  V+ L       ERDL  +   + +   E   L    P  +D +  + +EVE+ W  L    NQ+R +L + + +Q +L+++++++ W K E + + + E     V   E +I   +E++ +ID +  +   +   G  +          +EE+   ++ +   + +  T RR  Y+++I+L++   E+   E WL   E+ +++  E   +SV ++ +  K  ED   +++++  +F+A++ R+T+ E
Sbjct:  924 HFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQAKYENFVTELA--SGR----KQLDDITKFGDELLKQQHSR--------------KKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETG--------SDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATN-HFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARS-NQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVS---TDYGKTELATRSLIKQHEGVE-GQIEVLAAQVDELKSNVKQAVRVWGL-----EELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIPEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGL---QELQQEVVEN----WERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQA-VSMGQGLLENDIPNARE-IQEKLKALQEEREKLSDNWQLRQKWL---ENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNS---DELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEK--ETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGH---SDAAEIKEALRKLDDA-----KTMLT------RAWEDRRKTLDQALKLQIFLGYADQTESWM--SNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAIL--LRKERI--LEISKSRRKAL--------EESLQLQKFLEASYEIS----------SWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDAL---KKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKS-QHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDF-----SEEVGTLGQSKLSTVQKLKQSVQSADAQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWM---------------------------NEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLK-ETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRA--EDYGESVSDVLDLMKKQEDLEAMIQAQSERFNALQARRTQRE 3566          

HSP 2 Score: 475.707 bits (1223), Expect = 1.652e-133
Identity = 306/772 (39.64%), Postives = 471/772 (61.01%), Query Frame = 3
Query:   63 SRVQELQEDREGIQKKTFTKWMNSHLKRANAKV--DDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEM-IIET---ESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQI--NKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
             R +ELQE R  +QKKT+TKWMNS   ++  KV   D+F +LR G  L+ L+E+IS   L   +R TLRV  +EN + A+ +++SK+ ++ IG E++VDG+  LILGLIW IILRFQI  + I+E     S  ++SAK+ALL+WCQ KT GY NV+++DF  SWRDGLAFNALIHAH P+L DY++L  ++ + +LT AF +AE E  I  LLD EDV V  PD+KSI+TYVS  Y  F+KMK   T  KR+ KIV    E+  M   YE +V +LL+WI+ K+++LN R FPNSL EMQ  +  FK+YRT+EKPPK+ ER  I+  LF +  K + NN + Y P EG  + ++E  W  LE+AEH RE VL++ L+R E+LEQ A KF +KA+LRES+L + + ++   + G   +  EA+I   + E +  ++   + RF+ L E+A  +E +NYHSK  +  RN DI NRWK L+ ++  ++A  G  A   ++LR I  I M+   L+ Q +S+D+GK       LL+K +L+D Q+ +L +  N I+  S      +K +  T  QR     +LK+L+   N L  +S+ RR+ L+      +   D EE + W+  +  ++     G D + + + I+ H+  E+EI +   + + +     +L + +   + +I K +  L + W  L+   + R+N L  A   ++Y+AD  ++  W+ +H PL+++++ G DE ++ AL++RH  + +E+  +  +++KRL E
Sbjct:   12 GRFRELQEQRMTVQKKTYTKWMNSVFSKSGEKVVLTDVFTELRTGVHLVRLLELISGEKLPTPSRRTLRVHCLENNSIAITFLKSKIRVDLIGPENVVDGDRTLILGLIWIIILRFQIGNINIVEAGGDASAARRSAKEALLIWCQRKTAGYTNVNVQDFSGSWRDGLAFNALIHAHRPDLFDYNRLRQDDPKRSLTHAFALAEDEFGIMQLLDVEDVMVPHPDEKSIMTYVSLYYHYFSKMKQGQTIQKRIAKIVDLLKELDDMKGLYESMVSDLLRWIKTKVVELNDRSFPNSLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQLEQLAQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS---ALKVKHKGATKVQR-----ELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAY-SSEVKRLGE 774          

HSP 3 Score: 76.6406 bits (187), Expect = 9.412e-13
Identity = 80/355 (22.54%), Postives = 166/355 (46.76%), Query Frame = 3
Query: 1236 SWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSG-KLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQ-NLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKR 2291
            SWLNE  SV  + +    I N +A++ K +    EI   + R Q   +   N+ + ++ +K  I  R  D+ + W +L  L N K   +  + A+     +       E+   ++ ++ + D G    +   LL+    ++  + A  ++   +   ++DF     SQ N   D    ++ ++  +    NGL E  Q RRE L+      +  RDLE+E  W+ ++++    K+ G    S+  ++++H V   EI    P+   ++ +  +L + +     EI + L  L + +  L++  + +  LL+ A + Q + ++    +QW+ E  P++ +++ G +E AT+A +++
Sbjct: 2777 SWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQL--LSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDF----SSQGNFLAD---NIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRK 3121          

HSP 4 Score: 72.7886 bits (177), Expect = 1.468e-11
Identity = 76/387 (19.64%), Postives = 178/387 (45.99%), Query Frame = 3
Query: 1209 FNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQIN---STDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELV 2360
            F     L  +W++E   V +  N   ++    + + K + +  E+N   +  Q++ +    +  +N  +   +  R   +  +W++L++   S +  SG+L         I     E + L  + +   STD GK  LA + L+++H  V+ Q++ L+ + +++    +    +++   L     + L     ++   ++ L   +  R ++L++  + H+  R+  E + W++ + ++  + + G DY + ++L  R EV+  ++       +  +  A  L K+       I ++ + L + W  L+ +  +R+  L+ + +C K+Y D  D+   I E     + ++   D    Q+ +++H AL+ E++  E+    +LQEL+
Sbjct: 1597 FYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEE---SCKKRSGELN-RAVTREQILLDCTELETLVSETSALVSTDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQ---AVRVWGL-----EELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHK-TIPEDIAKDLKGVQSQLRKHEALVHELAGTEQ----QLQELL 1966          

HSP 5 Score: 71.633 bits (174), Expect = 2.774e-11
Identity = 46/192 (23.96%), Postives = 99/192 (51.56%), Query Frame = 3
Query: 4281 NKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAK 4853
            N L G    ++  LE  L+  +F  +  E+  WI +K + ++  +  +DL  + + +Q HKALEAEI+S  S    +   G +L +  HP ++ ++  ++T+ ++W++L      ++ +LH A+   ++  ++ +     D  + ++     G D  S+ +L+ +H  +E E+E     + +L ++A   A+
Sbjct:  590 NSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAAQ 781          

HSP 6 Score: 68.1662 bits (165), Expect = 3.281e-10
Identity = 99/480 (20.62%), Postives = 207/480 (43.12%), Query Frame = 3
Query: 8313 SLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK------------LMRIHQMLSSEKELQELSQKVEDHITWIRN--KMLIASDANYEDRVNLSNKVKKHREFV-SEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMS 9707
            SL  ++ +       R+I      +E+  ++  L ++  KLR +   D    EGK    I+   +L E+            LMR+ Q+   E+  Q+  +K     +++ +  +++   D     R+  +    +  E + ++V A+EP  +A  +    +  +N+ S V++  + +D+ N+ K+LK +   +   + +    F   R +E     + E +   +S + G  L  V  L ++Q  I+  I S  E L +I   +   +       + ++ +   +N+ +  L    KN    L     L+ F  D      WI +K  L     +G  L++  + ++ H  L +EI ++      +  + ++L    H  ++ I+     L+  +++L      R N+L A    +Q+ +D+ E    L+D   LL + + G DE S   L+++ + +  E++  SS   +L E+  + +
Sbjct:  306 SLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQL---EQLAQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVKHKG--ATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAA 780          

HSP 7 Score: 56.225 bits (134), Expect = 1.182e-6
Identity = 50/240 (20.83%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 1578 QINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTN--KETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKR 2291
            Q+ ++DLG      + L+++H   +  L +  D+   +   +    + LK++ LT ++   ++ +LK L      + ++S +RRE L+ +  +    RD+ E + W+++ +  + +  K    +  + ++++++H+V+E+EI AH  I   ++ +  +L         EI +++  L   W  L++  + R  +L+D  +  ++    E  + WI +   ++   + G D    Q L+K+
Sbjct: 2141 QLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESA----ERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKK 2376          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Zebrafish
Match: sptbn5 (spectrin, beta, non-erythrocytic 5 [Source:ZFIN;Acc:ZDB-GENE-131121-26])

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 657/2776 (23.67%), Postives = 1303/2776 (46.94%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKE--------NEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASI--VLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDI--------SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAAN-EAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTK---QALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKE--MKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDK-SANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQ----VDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNL--DANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLK-SLSTVEDVTENI---------------DAKRSISSLVSAREQKT--VKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNK---LLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV----KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIK-RQTKLE 11057
            H+ K+ IE  Q  L K F  L  LA+++   LE +   H+F+  C+ F  +M  KE   N   S + ++E ++ KYE  + +LA  SGR      L+ + +  D +L++   +              K  +  R   +  +WE++ KLK +    L  ++ +  F +T  E++  +  +L  L+  +VG    + +  + +     RDI+A++ +++  K +    K   P E   + E++  ++DL  +L+    +R+  L  A  +  F  ++++         E  L E  G         DV+S +  +++   LK EI L +A L  ++ L     V        ++   L +LD +   L    + R++ L+  LE QK   E D+IE+ IS    +L   +   SVD V + L     L A ++ ++  +     +  EL  K N  +++I  R+  + D   +L   C  ++++L    ++ +F  +A E+  W+D+K    E+E+Y+D  N+  KL+KH+A E E+++N   ++++ + G  ++  +H    +++   + + ++W +L     ++  KL QA +Q +  E L D   K + +E M++ A  G+DL S++ L+ +H  LE E +   E +  +  +A  +A + HFD + IL E          L   ++ R S L+ ++  + F  DVD EL WI EH+P A   +Y RSL  AV L  KHK L  E+N H   +  +L+ G+ + R  +    ++V+ R + L   W+ LE+    R  +L+ +    Q L D  ++   ++E S  V+    D    ++A R +  +   V+    + L   +    +  K   R   +     E + K  N         + S   ++  L        F+ E SE+E WI ++ +IA SN+ G D +    LR R+   LK +E+G++R+ TC + A++L+KS +  S  I   Q  ++  WD L   +  +  K   +E+ HKF K   D    +   + ++     KD   +    ++ +    EL   + QL ++         M + +L++      +L  E ++N    W++L     Q+  +L+  +D  +  +  ++   + +++ + +KA+  I  V   + +  Q  + +AE +A  ET  Q  VS  + L  ++  +  E IQ  +  + E+R K     Q   +W+   E+  ++Q   RD   +   T  QE+++K ++    +++ E L+ +H  F   +   +D++ AL      LK   +      NI +      +RR+++ D        L   ++     R+  +   W+ +++ +I+   K   + L+ K+ +LQK++   AEI AH    E +     ELVT  HPKS+E +  V  ++  W  L  E   R   L++ +D L F  +++ VE W R+KE +++  ++G D +H   L  KL+E  G       VD+A I  I   A +L ++ +    E   ++ R + +  RW     +L +YK +L  A ++H    EL  + D+  +++ L++ +  G D++SVE L R+   +ER+   + E+ A L +  +  D L    + S K+S KQ+E+K  L +L    K+R + L  S++      + + L D +L+Q++ +     P +   A + +  H + K  ++ R  + + +    + L +  +   S  A   E++   DD      + +L+       AW  R+  L++ ++L  FL   +  E W+   N++  +I  +L  SLS VE +   +               +  R    L+ A    +  +K     IL  LRK++I  +++++ + K++        E+ +++ + L +  E+           +W+  K  +A D +++D +NL  K+ KH+ F +E+ AN   +QA I  G  +++ +H +  +I  ++ D+D+   +L +    K  RL +  +  ++ R +     W+   E    + +YG DL SV +L +    +E  +++H E++Q + + A    ++ N+L  +I+++   + NR+  L E ++     L   ++L++F+ D+  EL WI+DK+Q    ++ G+SL      VK+H+ +M EI  R   I ++++  ++L    HFA  +I  + + L+ +++ L   K+E  NK   L      Q F S+V ++E  + ++  +L + + G +E++    ++KL+++ LE++ +      L +  +++    Q+    LV    +++Q +   + ++   +R  ++N  N+Y++ R++ ++ TW+ ++  +   ++YGKD +   +L ++F+ +     + +   +    +     L+++  S + +     + +    L    K R E L  A EVH F  + ++L  W+                           ++K  A+ S E    L  V+ L       ERDL  +   + +   E   L    P  +D +  + +EVE+ W  L    NQ+R +L + + +Q +L+++++++ W K E + + + E     V   E +I   +E++ +ID +  +   +   G  +          +EE+   ++ +   + +  T RR  Y+++I+L++   E+   E WL   E+ +++  E   +SV ++ +  K  ED   +++++  +F+A++ R+T+ E
Sbjct:  924 HFQKDTIESTQNSLEKDFNRLYNLAQSKNKILEDTARLHRFYNACEEFESWMGDKENVLNTFSSNSNNLEVVQAKYENFVTELA--SGR----KQLDDITKFGDELLKQQHSR--------------KKDIQQRLGIVTRRWERIQKLKDEMAHELLSSADVKSFLQTCQEVQAQLQHRLAQLDTPDVGSSPSALQAEEHRQAQAERDIEALERKIDYLKSVAKMKKDCSPAESAAIMEEVHALEDLLRQLKAQAIQRQRMLEEARRLQLFQKETRDLLMWAEATQEHLLEEETG--------SDVASAQALLKENLDLKQEIELQKAKLKDMERLGQSLDVASGEKGGKDVQQTLTKLDHEWSQLDKLWSSRNRRLEQGLEFQKLNMEADRIEATISGHEARLKVRDLGDSVDSVHSLLSRQEELEALLEALERSIILFQDKCQELISKRNFAAKEIQQRSKVIQDHFKRLKESCKLRRLELLASKKYQEFLRDAEEMLLWMDEKFEIAEDESYRDPTNILRKLKKHEAAEKEMQANAVRIDRLIETGEKMLADDHYNTQSIQKKTQEVHKRWIELQRKMAERGDKLRQAGQQEQLMELLQDAKLKIEAIERMLQNAIRGHDLRSSRQLLKEHKQLEEEAQELAEKINSIVTRAKNLATN-HFDSQRILKETDTYLKLFKSLEKPLDHRRSQLEADVDLYSFYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARS-NQWNGQEVQQRCEQLIAKWEELEESCKKRSGELNRAVTREQILLDCTELETLVSETSALVS---TDYGKTELATRSLIKQHEGVE-GQIEVLAAQVDELKSNVKQAVRVWGL-----EELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHKTIPEDIAKDLKGVQSQLRKHEALVHELAGTEQQLQELLDGTDAILGMCSPELRVGL---QELQQEVVEN----WERLRMRMEQREEELQSAKDRYMFLNTAQDYSLWCSQVLSWMKAEESIRDVATCDLQLFQHQQLWAEIVAREETFAQA-VSMGQGLLENDIPNARE-IQEKLKALQEEREKLSDNWQLRQKWL---ENTYLEQVFYRDTEYMEKITNSQEIQLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESAERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKKLSEFRGSGSGDVTVDDAHIKTINTLAARLERQNS---DELVTVKKRRQQLNERWRNFHGNLSSYKRKLEAALEVHALIRELEEVRDRAGEKMLLLQGQGCGLDVESVENLIRRHEEMEREARVIQERGAALEK--ETKDRLKRHCDLSDKLSKKQEEVKIALVKLDKEIKRRKERLQESHQLQLFKANQRLLLDWTLKQSDEMVKKGLPKNKTEAESFILEHHDWKAEIDARGDRIDSVKSFGQNLVKSGH---SDAAEIKEALRKLDDA-----KTMLT------RAWEDRRKTLDQALKLQIFLGYADQTESWM--SNREAFLINEDLGGSLSEVEALQRKLALFENSLEAQMEQVSEVDRYAQQLIQANHYDSDNIKKRTKAIL--LRKERI--LEISKSRRKAL--------EESLQLQKFLEASYEIS----------SWLNEKNSVAVDESWKDPINLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQLLSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDFSSQGNFLADNIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDAL---KKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRKLDTVDLELESQRGKVEALLKTGTDLEKS-QHPNSHLVSKSLEDMQGEFETLLQLSGERRTELENQYNFYIFERDARDLQTWLLSRKTIAESDDYGKDLEGVEALQKKFEDF-----SEEVGTLGQSKLSTVQKLKQSVQSADAQQKEKDLLKLWEDLNKAMKARAENLHSAREVHQFEHDLDELRIWM---------------------------NEKEVALDSEELKNDLLSVQALIRQHEGLERDLAVIEEDVSRRKEEGKALVRRSPRVRDSLSKRLQEVEEIWRNLLEKANQRRQRLQQAEAVQRYLIEWREMMGWLK-ETLSLMTGEGFGGKVKDLEQMIKKHDEYRTQIDRQLDKSEMVKNDGRRLMEEGNSWSHELEERLAELKDLEVRVLEAWTERRAQYQEDIELQQLQRELEQAEHWLNTYESALRA--EDYGESVSDVLDLMKKQEDLEAMIQAQSERFNALQARRTQRE 3566          

HSP 2 Score: 475.707 bits (1223), Expect = 1.652e-133
Identity = 306/772 (39.64%), Postives = 471/772 (61.01%), Query Frame = 3
Query:   63 SRVQELQEDREGIQKKTFTKWMNSHLKRANAKV--DDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYIQSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEM-IIET---ESGEKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQI--NKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
             R +ELQE R  +QKKT+TKWMNS   ++  KV   D+F +LR G  L+ L+E+IS   L   +R TLRV  +EN + A+ +++SK+ ++ IG E++VDG+  LILGLIW IILRFQI  + I+E     S  ++SAK+ALL+WCQ KT GY NV+++DF  SWRDGLAFNALIHAH P+L DY++L  ++ + +LT AF +AE E  I  LLD EDV V  PD+KSI+TYVS  Y  F+KMK   T  KR+ KIV    E+  M   YE +V +LL+WI+ K+++LN R FPNSL EMQ  +  FK+YRT+EKPPK+ ER  I+  LF +  K + NN + Y P EG  + ++E  W  LE+AEH RE VL++ L+R E+LEQ A KF +KA+LRES+L + + ++   + G   +  EA+I   + E +  ++   + RF+ L E+A  +E +NYHSK  +  RN DI NRWK L+ ++  ++A  G  A   ++LR I  I M+   L+ Q +S+D+GK       LL+K +L+D Q+ +L +  N I+  S      +K +  T  QR     +LK+L+   N L  +S+ RR+ L+      +   D EE + W+  +  ++     G D + + + I+ H+  E+EI +   + + +     +L + +   + +I K +  L + W  L+   + R+N L  A   ++Y+AD  ++  W+ +H PL+++++ G DE ++ AL++RH  + +E+  +  +++KRL E
Sbjct:   12 GRFRELQEQRMTVQKKTYTKWMNSVFSKSGEKVVLTDVFTELRTGVHLVRLLELISGEKLPTPSRRTLRVHCLENNSIAITFLKSKIRVDLIGPENVVDGDRTLILGLIWIIILRFQIGNINIVEAGGDASAARRSAKEALLIWCQRKTAGYTNVNVQDFSGSWRDGLAFNALIHAHRPDLFDYNRLRQDDPKRSLTHAFALAEDEFGIMQLLDVEDVMVPHPDEKSIMTYVSLYYHYFSKMKQGQTIQKRIAKIVDLLKELDDMKGLYESMVSDLLRWIKTKVVELNDRSFPNSLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQLEQLAQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSS---ALKVKHKGATKVQR-----ELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAY-SSEVKRLGE 774          

HSP 3 Score: 76.6406 bits (187), Expect = 9.412e-13
Identity = 80/355 (22.54%), Postives = 166/355 (46.76%), Query Frame = 3
Query: 1236 SWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSG-KLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQ-NLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKR 2291
            SWLNE  SV  + +    I N +A++ K +    EI   + R Q   +   N+ + ++ +K  I  R  D+ + W +L  L N K   +  + A+     +       E+   ++ ++ + D G    +   LL+    ++  + A  ++   +   ++DF     SQ N   D    ++ ++  +    NGL E  Q RRE L+      +  RDLE+E  W+ ++++    K+ G    S+  ++++H V   EI    P+   ++ +  +L + +     EI + L  L + +  L++  + +  LL+ A + Q + ++    +QW+ E  P++ +++ G +E AT+A +++
Sbjct: 2777 SWLNEKNSVAVDESWKDPI-NLQAKLLKHQSFEAEILANRNRVQAHIKDGDNMLAFSHPAKSKIKPRIKDVDDNWDQL--LSNCKHKKTRLQQAYQALQFQRSLGDIEEWLGSVEVEVANDDYGGDLASVSRLLKALQGLEEMVDAHMEKVQGLVDTAKDF----SSQGNFLAD---NIQQRVWEVVNRYNGLAEPMQTRRETLESWQLLFQFYRDLEDELLWIEDKLQATATKDWGTSLQSIQSIVKKHLVVMQEIENRTPLIMAVQEAGQNLVRGRHFASREISEKLSGLKKNFDALKKESANKDRLLQQALKIQSFLSEVSQLEQWMEEQKPVLESRDYGKNEEATEAFLRK 3121          

HSP 4 Score: 72.7886 bits (177), Expect = 1.468e-11
Identity = 76/387 (19.64%), Postives = 178/387 (45.99%), Query Frame = 3
Query: 1209 FNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQIN---STDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELV 2360
            F     L  +W++E   V +  N   ++    + + K + +  E+N   +  Q++ +    +  +N  +   +  R   +  +W++L++   S +  SG+L         I     E + L  + +   STD GK  LA + L+++H  V+ Q++ L+ + +++    +    +++   L     + L     ++   ++ L   +  R ++L++  + H+  R+  E + W++ + ++  + + G DY + ++L  R EV+  ++       +  +  A  L K+       I ++ + L + W  L+ +  +R+  L+ + +C K+Y D  D+   I E     + ++   D    Q+ +++H AL+ E++  E+    +LQEL+
Sbjct: 1597 FYHDVDLELNWISEHQPVADTTNYERSLVGAVSLLQKHKDLQAEVNAHSKYLQRVLDRGRAMARSNQWNGQEVQQRCEQLIAKWEELEE---SCKKRSGELN-RAVTREQILLDCTELETLVSETSALVSTDYGKTELATRSLIKQHEGVEGQIEVLAAQVDELKSNVKQ---AVRVWGL-----EELNKPCNHIKSKLSELQHSATVREQRLRETLHLHEFKRETSELEEWIAQQTQIAASNDLGSDYENAMQLRGRFEVFLKQLEVGKERMHTCEQLADKLIKSNHPESRFIRETQNLLRESWDELQDLSKDRKEKLRKSEKCHKFYKDLTDALGQIKERHK-TIPEDIAKDLKGVQSQLRKHEALVHELAGTEQ----QLQELL 1966          

HSP 5 Score: 71.633 bits (174), Expect = 2.774e-11
Identity = 46/192 (23.96%), Postives = 99/192 (51.56%), Query Frame = 3
Query: 4281 NKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAK 4853
            N L G    ++  LE  L+  +F  +  E+  WI +K + ++  +  +DL  + + +Q HKALEAEI+S  S    +   G +L +  HP ++ ++  ++T+ ++W++L      ++ +LH A+   ++  ++ +     D  + ++     G D  S+ +L+ +H  +E E+E     + +L ++A   A+
Sbjct:  590 NSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAAQ 781          

HSP 6 Score: 68.1662 bits (165), Expect = 3.281e-10
Identity = 99/480 (20.62%), Postives = 207/480 (43.12%), Query Frame = 3
Query: 8313 SLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK------------LMRIHQMLSSEKELQELSQKVEDHITWIRN--KMLIASDANYEDRVNLSNKVKKHREFV-SEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMS 9707
            SL  ++ +       R+I      +E+  ++  L ++  KLR +   D    EGK    I+   +L E+            LMR+ Q+   E+  Q+  +K     +++ +  +++   D     R+  +    +  E + ++V A+EP  +A  +    +  +N+ S V++  + +D+ N+ K+LK +   +   + +    F   R +E     + E +   +S + G  L  V  L ++Q  I+  I S  E L +I   +   +       + ++ +   +N+ +  L    KN    L     L+ F  D      WI +K  L     +G  L++  + ++ H  L +EI ++      +  + ++L    H  ++ I+     L+  +++L      R N+L A    +Q+ +D+ E    L+D   LL + + G DE S   L+++ + +  E++  SS   +L E+  + +
Sbjct:  306 SLREMQHLVAAFKKYRTIEKPPKYQERGAIEAHLFDLRTKLRANNQRDYIPPEGKTLGDIERNWTLLERAEHQRERVLQSALMRLEQL---EQLAQKFGRKATLRESYLEDTLQLIQQQDLGGLQRLEEAEIAARRLEALGADVLAHEPRFRALSEMAAVIERDNYHSKVQVIRRNVDIMNRWKDLKQVLQEQRAHVGDAANTFAVLRDIELISMDLKELQAQADSSDMGKQLPDVVALLQKQDLIDTQIISLGETLNAISSSSALKVKHKG--ATKVQRELKDLNSHYNSLLGLSKNRRKALEGQLKLFEFFHDCEEVEAWIYEKWVLLQAASLGRDLSQIQQAIQNHKALEAEIQSQESLCSGVVFRGQELCRGRHPNENDIQKWIRTLQKQWQQLKEQVTIRKNRLHAANVIKQYFADITEASSWLDDHKPLLIDEDYGKDEASSTALLQRHQRVEKEMEAYSSEVKRLGEQAKSAA 780          

HSP 7 Score: 56.225 bits (134), Expect = 1.182e-6
Identity = 50/240 (20.83%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 1578 QINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTN--KETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKR 2291
            Q+ ++DLG      + L+++H   +  L +  D+   +   +    + LK++ LT ++   ++ +LK L      + ++S +RRE L+ +  +    RD+ E + W+++ +  + +  K    +  + ++++++H+V+E+EI AH  I   ++ +  +L         EI +++  L   W  L++  + R  +L+D  +  ++    E  + WI +   ++   + G D    Q L+K+
Sbjct: 2141 QLKNSDLGTTVDDVESLIKRHEAFEKLLHSQEDKMVALQESA----ERLKTEGLTREKNSNIKNKLKALQERRERIKDLSGKRREDLEVSKLHCIFSRDVSEAEEWITDRMNKIQDDSKMDMSNLQTKMKMLQKHQVFEAEILAHGNIIESVQQAGNELVTMHHPKSKEIRQTVSALISHWKALKQELAVRGKVLEDNRDFLEFLQKVEQVEVWIRQKEVMINVGDVGEDYEHGQQLLKK 2376          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 520.39 bits (1339), Expect = 1.826e-148
Identity = 304/762 (39.90%), Postives = 466/762 (61.15%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISA-HLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEI 2315
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R   ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + KV LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV++ +F  SWRDGLAFNA++H H  +LID+  L   N   NL  AF +AEKEL +  LLDPEDV+V++PD+KSI+TYV++ Y  F+KMK      KR+GK++  A+E  ++IE YE L   LLQWI++ I+ LN R   NSL+ +Q ++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LE  A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I    ER   ++ +A  LE+  YH    +  R  ++   W+ L++L+ +++ +       +  L    +  ME+ + +K ++ S D GKH    +DLL+KH LV+  + A ++R   +   ++ F  +   Q+  P     +E ++  L      L +++  RR +L  +    + + +L EE  W+  + ++++  + G D +S L L+ +HE +  E++A + P+ N +      L K   +   E+ + +  +   W++LE     R   L ++    ++  DA D + WI E    V ++E G+DE +TQ L ++   + EEI
Sbjct:   39 SARLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARR-ERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASN--EQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSI-AGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEI 796          

HSP 2 Score: 265.003 bits (676), Expect = 7.726e-70
Identity = 267/1311 (20.37%), Postives = 589/1311 (44.93%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIAT---DIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSA--LGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL----QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIE-LGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK--TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPN-NSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV----SFSXXXXXXXX-----XXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCL---RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKAL 6752
            E +     +E +   + + + EL+GL+ + +  L+G+   ++ F E  +   ++  KE  +     I T   D+E I+++++ +  ++    GRI   SD+  + Q    +L  D R              +K ++     ++ N+W     L   ++++LE A +I  ++   +E++  + +K  ++ +  ++G D      L+RK   + RD++AI+ +++  +     +   +P +   +  ++ EI +++ +L+  +++R+  L  A  +  F+ D  + +  L+     + ++  P  ++  E  + Q E +K E++  + + +K+++  + V + + +  ++  A  L  LD     L+     R   L  A + Q   ++  Q E  ++ Q   L       S+   E A+K H +    ++  + ++  +  S R+     N  ++KI  + D + ++  K           L+++ E   F ++  EL+ WI++K+L  ++ +Y +  NL  K QKH+A  AE+ SN   L+KI   G  L+K     +  V + L  + ++W +L   T+ K + L  A+    F ++ + +      +   +++   G DL S   L+ KH +LE +++ + + +  L+ +A  +A++     E +  E R++  R ++L   + +R  +L  + + HQF  D++ E+ W++E  P AT  D+G+ LP    L  K++ L  EI GH+P + ++   G ++    + E+    +  ++ R   L++ W  L  + + R  +L  +   +QF  D  +   W+ E+  ++   +K  D       + K + +   L  Y   +  +++++    ++       PE  E +T +  +    +   +    +++  L+        + E+ ++E WI E++ +A S+E G+D + +  LRD++    +    +G++RV   N  A++L++S +  +  +A  ++ +   W  LL     +     A+ E+H+F++  ++   ++     +L      +D N +    ++   +  +++ +  Q+  +   A +L+  Y    +D I      +   W+ L      + L L    +     + +++ + ++  IN Q+++      V +A   I          ANH+ +  ++     SF+                 +EIQ  +D +  KR +  Q   +W  K +H+ I    L   RD     S  A QE  V+      +++E E L+ +H  F    +  +DR   L
Sbjct:  815 EAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKE-QWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRI---SDVNQVAQQ---LLGSDNR--------------NKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQEDSGIVE-VDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEH-----PE-SERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVI----------ANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQ---KWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQL 2084          

HSP 3 Score: 233.802 bits (595), Expect = 1.882e-60
Identity = 333/1520 (21.91%), Postives = 643/1520 (42.30%), Query Frame = 3
Query: 6630 QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIP---TLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEP----VGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED--IDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKAL-CDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQ---LNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFS--------SLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIR-----AERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYI----RESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEK-NPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAF---VREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAK-DHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQ-------KIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKL 11054
            QE  +   ++  DL     LL+KH  F   ++    R   L   I     L +  H     +     D   +   L +  +  E  L+    +     +++D   W+ E L+Q+ + +   +    +  L +K + +  EI +H    + L  +   L+   +  S + +  +  I +++ +L   S     AL  A  L   F E  A + W  EKE  +   E+ + L+    +Q +    EP    +GG      RI  + Q A QLL          D I      + +RW   ++     K  L  A  + NY+ E   I   +K++ K+++  +  G+D+  V  L+RK  G+ERDL A+  K   LR      + ++ +    IK  L   EI++  E+L    K+R + L  + +    ++D       +S  QT + +  + P     A   L  H+ +K  ++N               KED   + ++ A   +    TD Q   L    + L +   E +  W  R   L +     T L   +  E +L +Q    + +L++ +  S+++   E I       + + A E+K + G    ++E  R+  +SD      K +   D           + NE L +    L   +ELQ   Q  ++   WI  KML A D +Y++  NL +K +KH+ F++E+ +N+  +      G+ L+ E       + E +  L  Q  EL+  +  K + L +  +   +T+      SW+       +S ++G DL SV  L ++   +E  ++  ++++QS+Q +A  +  E++ +     EQ   + +RF QL + LK    +L  ++  ++F+ D+  E+ W++++M LA   + G  L      +K++ TL  EI      I+ I+    ++        D+ R          L   +  L +  E+R  +L      QQF +D  E E  + ++ L + + EK  DEQS L ++KK + L   ++  +    +L+  +S +  + ++   E +   Q ++ ++   ++      +  L   L +    RE +++  WI  + ++    E G+DY+    L ++F  + +  +    + ++  N     ++E  +P +  +      + E    L +    R + L  + E+H F    REA  LI                               +K E +   E  + L+ V+        +E D++A++ Q+ +  +++ RLQ+ Y   K D I      V + W  L+ A   +R  L +T +   +L   +DL+ W +  N++I S ++ P DV+ + L+I    + K EI++++       + G  + +   Y    ++EK + +Q       + W+   D+L       +  +++ +F  + +  ESWL   E L+++ +  S  +V E+E   K HE + K+    + +F  +++ T L
Sbjct:  660 QEQIISGGDYGKDLSSALHLLSKHEAFRDEMAA---RYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQT-LARKQREVEEEIQSHRSLIDSLH-EQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGG------RISDVNQVAQQLLGSDN---RNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLA--EIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDT-PTSLAEAERLLAQHEAIKNEVDN--------------YKEDYEKMRATGAEVTQG--QTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQ----EYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEK-ING----VVESGRR-LVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAK----LKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQEDSGIVEVDGEQRR-VTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLA-NSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLI------------------------------REKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDS-PRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHL-------QIVLEVLQFGRDASMAESWLAGQEPLVRAAELGS--NVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTL 2090          

HSP 4 Score: 194.512 bits (493), Expect = 1.564e-48
Identity = 326/1711 (19.05%), Postives = 718/1711 (41.96%), Query Frame = 3
Query: 4341 AKFDENANELSEWIDDKLLAIEEENYK-DLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIM--KLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTK----DRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSX-XXXXXXXXXXXXXIQSDIDDM-LEKRNKTKQALNE-W-----MTKNEHILIKQ-----NCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHL-LQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEK-WHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADN----IRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-----QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVN-LSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKE-------LKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQH 9314
            A+FD  A     W+ +    + ++N+  +L  +    +KH+A+E +I++    +  +     +L       ++R   ++D V  +       W+ L      + ++L    +     + L+ I+   + ++  +++   G  L   + L+ KH ++E+++  Q E +  ++  A   A +       D   + +++  L     +L  L   R   L D+ +  QF +++ +E  WI E     +  DYG+ L  A+ L +KH+    E+      + N +  G+ L +E   +   +V  R K ++  W  LE+ +  R+  L+ S    QF  D ND+  WI E    V  S +++ +D+ + + +  K + +  ++ ++ +L+ ++    +   +       +   + A+ +++ E      S+R        AL+          E S  + W+ EK++   + E    L+ +E ++ R+++    +     R+   N+ A QLL S N   ++I   Q  + + W    + A+Q+    ++A  I  ++  C +    +  +   +   T+    D   +    +++    ++LE ++ +LDD+   A KL  ++P   + I  ++  +  +W++L     ++   L            + +  A+L+   T V A     + LA  E +         LA HE +  ++ ++ E           + + Q+D   M L +R    QAL+  W     M ++ H ++ Q       LRD  Q       QE  +        L+  E+ + KH +F   +  +++++  +      L    +   D I    D   +R QK      ++ +KL + +     L++  +   W++EK+   Q  + D++ N     LH   QK++A  AE+++++   +++  K  +++  + P+ E+  +   + L+K W +L + +Q ++  L +A    +F     A+++W +     + +++ G DL     L  K        Q+ E ++D+  +   Q LQ + +   + D+    +    + +  R+  L++ L+  +  L  + + H +  +L      +K+R+ L    D G D+ SV+ L +K   +++++     +   ++      +   +  +D      +  +  E+++    L   T+QR+  L  + R  +   DA A  +  + + EL  +S     D +SA   +K H  L+  + +             +L     ++ +S   ++E +     Q++ +   L    +E       R+ +L E ++L       +  EQW+  +    +V+  + +     E VT   D  R  +   S   Q+ V     +  E +      +  +AE K   + + ++ L E +    QML++  EL    Q   + +  IR K    + A     +N + + +++H  +  +V+A    +    D   RL           GEK  D+    +        L++ +  +   L++T+++F++   V   + W+       +SH+   D+ S   +     DI+ +I +  +   +  E   T+IN N+Y + +I+E+   +  +  ++ +  +   ++L     + +F  D      W+  +  L    E+GS++ E +  +K+H
Sbjct:  428 ARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRL-------WEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKE-GHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQV--SSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWR-------QALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMK-EKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTV-ASEDTPTSLAEAERL---------LAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQR---LQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARN-----LHSKWQKHQAFMAELASNKDWLDKI-DKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKK-------HQMLEHQMDVREKEV-QSLQSQALALAQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDA-AEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALED-------YAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEE-------RRGKLQERLRLTQLKREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWK-DGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARL------QKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRH 2067          

HSP 5 Score: 137.117 bits (344), Expect = 4.110e-31
Identity = 341/1727 (19.75%), Postives = 683/1727 (39.55%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSE--KINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIE-EENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELV--------EAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI----QQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNN-----FDLDLEETEKLLA---KHRNFAHNISVTDDRV----KALSVFIPTLKEMKHFDYDNINSLFDDCVK-------RRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLD-----KSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIV------CNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSR-------WDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLM-NNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNL-KSLSTVEDVTENIDAK----RSISSLVS------AREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRN-KMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKL 8984
            A +F ++    E+ +S+    +   N  + +  VE A + H  +   I     RV ++     EL+     E  ++  R D VL     L      ++  L    +  +  +  + + EW++D    ++ +++ K L ++ + LQKH  +EA+I +    ++ +              K      V++ +  +   + +L     D+  +L  +    +F   L +        E ++     G DL SA  L+ KH     E+  +   L         + K+GH     + + I+ +  + + L      R  +L +++ +HQF  D +    WI E     +  + G        LA K +++  EI  H+ ++ +L E G  L    +  +   VE R  A++  ++ LE  +   +  LD +    +   + +   LW+ EK  +       L N +I     KL+ + V    +DTL   +  NT G +     +N + + +        + + +  N+ ++ +  F++  N ++ ALE+  +  N+  E +E+++W+ EK K+ +S +  G DL  +  L+ +     + +E  + ++      A +L+     + EEI     ++Q  W+ L     ++      A ++  F +   DF   ++    ++ S+    +  +   +R+    +    E++N K   + + +  A   + +       + + +  L+  W +L      +   L    D+  L    K++  FLN     +      +S+  A EAI+  + F  ++   E  +  +V  S      +     ++IQ   D + E+  K KQA NE + K +     Q+ L+D          QE+ + +N       D+  +E   L +   KH+ F   ++   D +    K   V +    E++    + ++ L    V+       + Q L D  R   ++L  Q             + W+     Q+++ D      S N L      L+K++ L  ++   E E + L  ++  L       ++E   IV        + +++ QL    ++R   L  +K+   F  +L+    W +E+  L ++ + G DL     L  K   L + + G Q    RID I      +      P  E++  R R  A+  R       W +L ++ E    RL EA +   +Y +       + ++   +  ++   D  S   + +K   +E+ L    +   +L  +  +  N +   S +I+L+Q ++      L  L ++R   L    R  ++ ++   L +  + + E++  S          T L+  D+ +    +   I + R+  +  +  E    +  S   +N SV    D LN    +LL  +       + R   L    +LH F +  +A E   L + KK  +    L + L+TV+       A     +++S  V+      AR QK   G           ++  DI   E       +G  S  +   R   +L + ++ + L+  V D + W+    + I S  +  D  +    +  H++  SE+E       A  + G+ LI+ NH +S EI EK+  L  +  E+      K+  L   ++  ++ R      SW+   E +  +   G+++  VE L
Sbjct:  427 AARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYA--HSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQW-------LHNMEIPT---KLEDLEVIQQRFDTLEPEM--NTLGGR--ISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAE--AERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVE-SGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQD---------GQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANR---AELFTQSC--------SALDSWLQNISSQLQSDDFGKDLTSVNIL------LKKHQMLEHQMDVREKEVQSLQSQALAL-------AQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQ---PRIDDIQAHGTNM-----SPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDL-EQWIAEREVVAGSHELGQDYEHVTMLR--DKFREFARDTSTIGQERVDAVNAQADE----LIESGHPENASVAEWKDGLNEAWADLLELI-------DTRTQMLAASYELHRFHQ--DAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAG-----------EKADDIHRHERAVTEAWEGLQSATQ--TRRLLLLDTVEKFRFLNM-VRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESL 2063          

HSP 6 Score: 131.339 bits (329), Expect = 2.621e-29
Identity = 199/983 (20.24%), Postives = 422/983 (42.93%), Query Frame = 3
Query: 8187 NKRQNRLNEY-IQLHTFLETCEAEEQWLLTQNKKCDVILNNLK---SLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVID-GFSSL----NEKLMRIHQMLSSEKELQELSQKVEDHI----TWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEK---VIDLDNQLKEL------KTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI-NENNYLTSD---IREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQN--KTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISRE-FNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDI---KSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAI 11036
             KR  ++ +Y I+    +E  E     LL   ++  V LN+ +   SLS V++  +  +  R++       E+  ++  L  I  K+R +        EGK  S I+  +  L    +E+ + +   L  +++L+ L+ + +       TW+  N+ L++ D    +   +    +KH    ++++A    + A     + L +E +     +  +   V+ L   LKEL      + M+   L+RL++ +            + W+ + +   +S + G  L  VE L ++   +E DI++  E+++++Q  A     NE +Y   D   + E+  ++   + +LG+   +    L D+  L++F  ++  E  WI+++ Q+ +  + G  L+ A   + +H     E+A R   + +       L    H    ++     ++   +  L  A + R   L  +  + QF +D  ++E  + +    +++ E G DE S   L +K   +  EI    S    L E+ S +   Y +  + +  +  ++ +  E++ +  + R  +   L  Y    E+     W+  +   +   E     +D   + +RFD+    +N    +I ++  + +QL+   N    +I+ T + +    +  +     RK+AL+ AL +  +  E N++  W+K                           +KT+ I S +     L+ V  L+      ERDLEA+  +++   +E+ +L   +P+ ++ I  +  E+++ W  L+  + ++   L E  KLQ +L    D  +W       + S E  PT +A +E L+      K E+D+  ++  K+  +G ++   ++ A+++   + ++   +   W  +     SR  +  Q  D +  + +    E +L   E ++   +  S  S+   EEA K HED++  +E+ + K + +
Sbjct:  290 GKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYI---------MEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMK---------------------------EKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVAS-EDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHM--FLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPS--SLQGAEEAIKKHEDFLTTMEASEEKINGV 1231          

HSP 7 Score: 78.1814 bits (191), Expect = 3.244e-13
Identity = 94/428 (21.96%), Postives = 192/428 (44.86%), Query Frame = 3
Query: 1218 KASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKRHTALL-------EEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIEND 2465
            +AS  + W+ E    L+NM   T +++ E    + + +  E+NT   R   + ++A  L  ++  +KD I    + + NRW   Q L N  KQA    L      L          +  K   ++  LG        L  K   ++  L+A+  + + +  +++  +         P+Q + ++ QL  +      L    ++R E L +       +RDL++ + WLS     + +++T    A   RL+ +HE  ++E+  +   + K++ +  ++++ Q   D +   + + L  L  GW  L R+   R  +L  A++ Q    DA+ ++ ++ ++ + L   +   + +GA +A IK+H   L       E+I+   E+  + + +  T   K  +K D   ER +K NK  +N++  K++++
Sbjct:  860 EASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSE------HPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQ--TDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEA-IKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQK-NKQAANELLAKLKDN 1277          

HSP 8 Score: 77.0258 bits (188), Expect = 7.318e-13
Identity = 83/369 (22.49%), Postives = 173/369 (46.88%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDI----LKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQT----LETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIP-DGEIHKSLDF----LSQGWTNLERIKSERRNL-LKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTAL 2303
            W+NE +    +M+     +N  ++  K +    E+ + K+   K+ +    L       +  +S   S +Q +W +L+   N+ QA +  L F  +            D     +  Q+ S D GK   +   LL+KH +++          +Q++ + ++ + SL+SQ L   Q  +    ++ + + ++   + L +  ++RR+ L  +   H+  RDLE+E  W+   + + T+ + G D  SV  L+++++  + EI  H P  + ++    ++S  +    D E   +LD     L + W  L   ++E+RN+ L +A   Q++Y DA +++ W+ E    ++++E   DE +   ++K+H  L
Sbjct: 1293 WINEKMLTAQDMSYDEA-RNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELE---NTTQAKAQCL-FDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLE----------HQMDVREKE-VQSLQSQALALAQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLIS-ETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQIL 1644          

HSP 9 Score: 70.4774 bits (171), Expect = 5.642e-11
Identity = 142/781 (18.18%), Postives = 305/781 (39.05%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNY-------VNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANL-DKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESII-------SQQNCKLDSINPQLSV---DDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKL-------QKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD 5369
            +E   +K+EAI  D+ A   R+  +   E++ + ++     ++R+  A                 R   ++  WE L +L   + + L     +    +    + E +      L   + G      E+L +K   +  DI A   + ER K +    K+    E +Y       V EK+  +   YG+L      R+  L+++  + +F+ +  E    + E   II      KD+SS    + + E  + E+      L + +    ++V +       +T  +  +  +   L++    R++ L +++   +F  + + +E+ I       S Q    D  + Q       +VE  +++H +L   ID +  +   L       +    S ++  R   +  +  +L G     +  L+  L   +    A+    W+ +K      E +     +P KL       Q+   LE E+ +    +  ++     L+  ++  KD +      ++ +W    +    +++ L  A    +   E NE  + +  K   +E    T  LGNDL    +L  K   +E +LE     L  L+ +A ++  +    +E I  ++ +++    +L   + +R  +L +  K   F  D+D    W+   + +    D   SL +A +L  +H+ +  E++ +K     +  +G ++ +  +      +  R +AL   W  L +  + R   L  + + +  L D      ++  + Y ++ ++
Sbjct:  460 VEAATRKHEAIETDIQAYGERVAAV---EAVARELEAEGYHEVRRVLA-----------------RRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISA---QAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSL---IDSLHEQGSLLP------EAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEK------EQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIES---TQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTE 1199          

HSP 10 Score: 64.6994 bits (156), Expect = 3.932e-9
Identity = 72/344 (20.93%), Postives = 141/344 (40.99%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF--------DILKPQ---INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKS-----LDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAE 2222
            W+ ++ S L + ++G  + + E  + K  LV  +I+   ER + ++  A    SN        S +  D     +K+ DL+     + G+LA    +         +F          ++ Q   I+  D GK   +A  LL KH     ++ A   R+  +          +K  ++   +   +  ++K++    + L E SQ R + L ++  +H+   D  + + W+   ++ ++++E GHD  S   L R+    E EI +H  + + L        +   +P+   H       L  + Q +  LE + S  R  L  A    + +++A   Q W+ E
Sbjct:  546 WMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQ------SYKPCDPALVEEKV-DLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAA---RYGPLGNSIAGGEALVKEGHVGAPE---VTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLH------EQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGE 870          

HSP 11 Score: 59.6918 bits (143), Expect = 1.001e-7
Identity = 76/406 (18.72%), Postives = 172/406 (42.36%), Query Frame = 3
Query: 1200 ATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKD-----AISTRNSDIQNRWKKL-----QDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTL-ETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFE------ENDMKRLQ 2351
            A +FN+       W+ E + +  + + G  + + +  + K + +  EI   + R   ++    N+        D     A+  R ++++  W  L     Q  +   +A+  +  +  +          E  ++     S +  K   +A  +++KH +++  L+  +   +Q+   SR  ++S   ++    +R TL + Q+  L     GL +++++RR +L++     +L R++++ + W++    V  + E G DY  V  L  +   +  + S       + ++ A++    + I  G      + +  D L++ W +L  +   R  +L  +YE  +++ DA ++   I E    +   E G D    Q  +++HTA   ++          ++D  RLQ
Sbjct: 1490 AHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMM-----SEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPES----ERITLRQAQVDKLYA---GLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTS----TIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQ 1879          

HSP 12 Score: 55.4546 bits (132), Expect = 2.466e-6
Identity = 44/150 (29.33%), Postives = 65/150 (43.33%), Query Frame = 3
Query: 11487 SQGSTNSDI--------LRTCSAEAPSST---------TQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKI----ALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKLQ 11873
            SQGS +  +        L + S + PS+T         T +A   G + RKQ + S   K+A RSW+  Y  L    L +YKD       +    EVP+   ++  A   V   YKKR  V  ++L D  E+  Q   + E   W+  +Q
Sbjct: 2152 SQGSESESVNGPGRDSGLDSASRQDPSATLPGRGGAEGTTEA-MEGILCRKQEMESHNKKSANRSWQNVYCVLRKGSLGFYKDNKSASNGIPYHGEVPI---SLGEAVCEVAHDYKKRKHVFKLRLGDGKEYLFQAKDEAEMSSWIRAIQ 2297          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 518.85 bits (1335), Expect = 7.270e-148
Identity = 302/756 (39.95%), Postives = 463/756 (61.24%), Query Frame = 3
Query:   60 KSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISA-HLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEI 2315
            + R ++LQ++RE +QKKTFTKW+NSHL R   ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + KV LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV++ +F  SWRDGLAFNA++H H  +LID+  L   N   NL  AF +AEKEL +  LLDPEDV+V++PD+KSI+TYV++ Y  F+KMK      KR+GK++  A+E  ++IE YE L   LLQWI++ I+ LN R   NSL+ +Q ++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LE  A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I    ER   ++ +A  LE+  YH    +  R  ++   W+ L++L+ +++ +       +  L    +  ME+ + +K ++ S D GKH    +DLL+KH LV+  + A ++R   +   ++ F  +   Q+  P     +E ++  L      L +++  RR +L  +    + + +L EE  W+  + ++++  + G D +S L L+ +HE +  E++A + P+ N +      L K   +   E+ + +  +   W++LE     R   L ++    ++  DA D + WI E    V ++E G+DE +TQ L ++   + EEI
Sbjct:   81 EGRFKQLQDEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARR-ERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASN--EQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSI-AGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEI 832          

HSP 2 Score: 266.159 bits (679), Expect = 3.061e-70
Identity = 267/1311 (20.37%), Postives = 589/1311 (44.93%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIAT---DIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSA--LGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL----QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIE-LGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK--TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPN-NSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV----SFSXXXXXXXX-----XXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCL---RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKAL 6752
            E +     +E +   + + + EL+GL+ + +  L+G+   ++ F E  +   ++  KE  +     I T   D+E I+++++ +  ++    GRI   SD+  + Q    +L  D R              +K ++     ++ N+W     L   ++++LE A +I  ++   +E++  + +K  ++ +  ++G D      L+RK   + RD++AI+ +++  +     +   +P +   +  ++ EI +++ +L+  +++R+  L  A  +  F+ D  + +  L+     + ++  P  ++  E  + Q E +K E++  + + +K+++  + V + + +  ++  A  L  LD     L+     R   L  A + Q   ++  Q E  ++ Q   L       S+   E A+K H +    ++  + ++  +  S R+     N  ++KI  + D + ++  K           L+++ E   F ++  EL+ WI++K+L  ++ +Y +  NL  K QKH+A  AE+ SN   L+KI   G  L+K     +  V + L  + ++W +L   T+ K + L  A+    F ++ + +      +   +++   G DL S   L+ KH +LE +++ + + +  L+ +A  +A++     E +  E R++  R ++L   + +R  +L  + + HQF  D++ E+ W++E  P AT  D+G+ LP    L  K++ L  EI GH+P + ++   G ++    + E+    +  ++ R   L++ W  L  + + R  +L  +   +QF  D  +   W+ E+  ++   +K  D       + K + +   L  Y   +  +++++    ++       PE  E +T +  +    +   +    +++  L+        + E+ ++E WI E++ +A S+E G+D + +  LRD++    +    +G++RV   N  A++L++S +  +  +A  ++ +   W  LL     +     A+ E+H+F++  ++   ++     +L      +D N +    ++   +  +++ +  Q+  +   A +L+  Y    +D I      +   W+ L      + L L    +     + +++ + ++  IN Q+++      V +A   I          ANH+ +  ++     SF+                 +EIQ  +D +  KR +  Q   +W  K +H+ I    L   RD     S  A QE  V+      +++E E L+ +H  F    +  +DR   L
Sbjct:  851 EAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKE-QWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRI---SDVNQVAQQ---LLGSDNR--------------NKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQEDSGIVE-VDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEH-----PE-SERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVI----------ANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQ---KWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQL 2120          

HSP 3 Score: 235.728 bits (600), Expect = 5.634e-61
Identity = 333/1520 (21.91%), Postives = 643/1520 (42.30%), Query Frame = 3
Query: 6630 QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIP---TLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEP----VGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAED--IDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKAL-CDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQ---LNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFS--------SLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIR-----AERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYI----RESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEK-NPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAF---VREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAK-DHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQ-------KIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKL 11054
            QE  +   ++  DL     LL+KH  F   ++    R   L   I     L +  H     +     D   +   L +  +  E  L+    +     +++D   W+ E L+Q+ + +   +    +  L +K + +  EI +H    + L  +   L+   +  S + +  +  I +++ +L   S     AL  A  L   F E  A + W  EKE  +   E+ + L+    +Q +    EP    +GG      RI  + Q A QLL          D I      + +RW   ++     K  L  A  + NY+ E   I   +K++ K+++  +  G+D+  V  L+RK  G+ERDL A+  K   LR      + ++ +    IK  L   EI++  E+L    K+R + L  + +    ++D       +S  QT + +  + P     A   L  H+ +K  ++N               KED   + ++ A   +    TD Q   L    + L +   E +  W  R   L +     T L   +  E +L +Q    + +L++ +  S+++   E I       + + A E+K + G    ++E  R+  +SD      K +   D           + NE L +    L   +ELQ   Q  ++   WI  KML A D +Y++  NL +K +KH+ F++E+ +N+  +      G+ L+ E       + E +  L  Q  EL+  +  K + L +  +   +T+      SW+       +S ++G DL SV  L ++   +E  ++  ++++QS+Q +A  +  E++ +     EQ   + +RF QL + LK    +L  ++  ++F+ D+  E+ W++++M LA   + G  L      +K++ TL  EI      I+ I+    ++        D+ R          L   +  L +  E+R  +L      QQF +D  E E  + ++ L + + EK  DEQS L ++KK + L   ++  +    +L+  +S +  + ++   E +   Q ++ ++   ++      +  L   L +    RE +++  WI  + ++    E G+DY+    L ++F  + +  +    + ++  N     ++E  +P +  +      + E    L +    R + L  + E+H F    REA  LI                               +K E +   E  + L+ V+        +E D++A++ Q+ +  +++ RLQ+ Y   K D I      V + W  L+ A   +R  L +T +   +L   +DL+ W +  N++I S ++ P DV+ + L+I    + K EI++++       + G  + +   Y    ++EK + +Q       + W+   D+L       +  +++ +F  + +  ESWL   E L+++ +  S  +V E+E   K HE + K+    + +F  +++ T L
Sbjct:  696 QEQIISGGDYGKDLSSALHLLSKHEAFRDEMAA---RYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQT-LARKQREVEEEIQSHRSLIDSLH-EQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGG------RISDVNQVAQQLLGSDN---RNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLA--EIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDT-PTSLAEAERLLAQHEAIKNEVDN--------------YKEDYEKMRATGAEVTQG--QTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQ----EYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEK-ING----VVESGRR-LVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAK----LKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQEDSGIVEVDGEQRR-VTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLA-NSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLI------------------------------REKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDS-PRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHL-------QIVLEVLQFGRDASMAESWLAGQEPLVRAAELGS--NVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTL 2126          

HSP 4 Score: 196.052 bits (497), Expect = 5.077e-49
Identity = 326/1711 (19.05%), Postives = 718/1711 (41.96%), Query Frame = 3
Query: 4341 AKFDENANELSEWIDDKLLAIEEENYK-DLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIM--KLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTK----DRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSX-XXXXXXXXXXXXXIQSDIDDM-LEKRNKTKQALNE-W-----MTKNEHILIKQ-----NCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHL-LQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEK-WHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADN----IRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-----QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVN-LSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKE-------LKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQH 9314
            A+FD  A     W+ +    + ++N+  +L  +    +KH+A+E +I++    +  +     +L       ++R   ++D V  +       W+ L      + ++L    +     + L+ I+   + ++  +++   G  L   + L+ KH ++E+++  Q E +  ++  A   A +       D   + +++  L     +L  L   R   L D+ +  QF +++ +E  WI E     +  DYG+ L  A+ L +KH+    E+      + N +  G+ L +E   +   +V  R K ++  W  LE+ +  R+  L+ S    QF  D ND+  WI E    V  S +++ +D+ + + +  K + +  ++ ++ +L+ ++    +   +       +   + A+ +++ E      S+R        AL+          E S  + W+ EK++   + E    L+ +E ++ R+++    +     R+   N+ A QLL S N   ++I   Q  + + W    + A+Q+    ++A  I  ++  C +    +  +   +   T+    D   +    +++    ++LE ++ +LDD+   A KL  ++P   + I  ++  +  +W++L     ++   L            + +  A+L+   T V A     + LA  E +         LA HE +  ++ ++ E           + + Q+D   M L +R    QAL+  W     M ++ H ++ Q       LRD  Q       QE  +        L+  E+ + KH +F   +  +++++  +      L    +   D I    D   +R QK      ++ +KL + +     L++  +   W++EK+   Q  + D++ N     LH   QK++A  AE+++++   +++  K  +++  + P+ E+  +   + L+K W +L + +Q ++  L +A    +F     A+++W +     + +++ G DL     L  K        Q+ E ++D+  +   Q LQ + +   + D+    +    + +  R+  L++ L+  +  L  + + H +  +L      +K+R+ L    D G D+ SV+ L +K   +++++     +   ++      +   +  +D      +  +  E+++    L   T+QR+  L  + R  +   DA A  +  + + EL  +S     D +SA   +K H  L+  + +             +L     ++ +S   ++E +     Q++ +   L    +E       R+ +L E ++L       +  EQW+  +    +V+  + +     E VT   D  R  +   S   Q+ V     +  E +      +  +AE K   + + ++ L E +    QML++  EL    Q   + +  IR K    + A     +N + + +++H  +  +V+A    +    D   RL           GEK  D+    +        L++ +  +   L++T+++F++   V   + W+       +SH+   D+ S   +     DI+ +I +  +   +  E   T+IN N+Y + +I+E+   +  +  ++ +  +   ++L     + +F  D      W+  +  L    E+GS++ E +  +K+H
Sbjct:  464 ARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRL-------WEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKE-GHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQV--SSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWR-------QALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMK-EKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTV-ASEDTPTSLAEAERL---------LAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQR---LQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARN-----LHSKWQKHQAFMAELASNKDWLDKI-DKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKK-------HQMLEHQMDVREKEV-QSLQSQALALAQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDA-AEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALED-------YAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEE-------RRGKLQERLRLTQLKREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWK-DGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARL------QKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRH 2103          

HSP 5 Score: 139.813 bits (351), Expect = 5.558e-32
Identity = 339/1722 (19.69%), Postives = 683/1722 (39.66%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSE--KINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIE-EENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELV--------EAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI----QQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNN-----FDLDLEETEKLLA---KHRNFAHNISVTDDRV----KALSVFIPTLKEMKHFDYDNINSLFDDCVK-------RRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIV------CNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAK---LTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSR-------WDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLM-NNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNL-KSLSTVEDVTENIDAK----RSISSLVS------AREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRN-KMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKL 8984
            A +F ++    E+ +S+    +   N  + +  VE A + H  +   I     RV ++     EL+     E  ++  R D VL     L      ++  L    +  +  +  + + EW++D    ++ +++ K L ++ + LQKH  +EA+I +    ++ +              K      V++ +  +   + +L     D+  +L  +    +F   L +        E ++     G DL SA  L+ KH     E+  +   L         + K+GH     + + I+ +  + + L      R  +L +++ +HQF  D +    WI E     +  + G        LA K +++  EI  H+ ++ +L E G  L    +  +   VE R  A++  ++ LE  +   +  LD +    +   + +   LW+ EK  +       L N +I     KL+ + V    +DTL   +  NT G +     +N + + +        + + +  N+ ++ +  F++  N ++ ALE+  +  N+  E +E+++W+ EK K+ +S +  G DL  +  L+ +     + +E  + ++      A +L+     + EEI     ++Q  W+ L     ++      A ++  F +   DF   ++    ++ S+    +  +   +R+    +    E++N K   + + +  A   + +       + + +  L+  W +L      +   L    D+  L    K++  FLN     +      +S+  A EAI+  + F  ++   E  +  +V  S      +     ++IQ   D + E+  K KQA NE + K +     Q+ L+D          QE+ + +N       D+  +E   L +   KH+ F   ++   D +    K   V +    E++    + ++ L    V+       + Q L D  R   ++L  Q             + W+     Q+++ D   +     + LL+K++ L  ++   E E + L  ++  L       ++E   IV        + +++ QL    ++R   L  +K+   F  +L+    W +E+  L ++ + G DL     L  K   L + + G Q    RID I      +      P  E++  R R  A+  R       W +L ++ E    RL EA +   +Y +       + ++   +  ++   D  S   + +K   +E+ L    +   +L  +  +  N +   S +I+L+Q ++      L  L ++R   L    R  ++ ++   L +  + + E++  S          T L+  D+ +    +   I + R+  +  +  E    +  S   +N SV    D LN    +LL  +       + R   L    +LH F +  +A E   L + KK  +    L + L+TV+       A     +++S  V+      AR QK   G           ++  DI   E       +G  S  +   R   +L + ++ + L+  V D + W+    + I S  +  D  +    +  H++  SE+E       A  + G+ LI+ NH +S EI EK+  L  +  E+      K+  L   ++  ++ R      SW+   E +  +   G+++  VE L
Sbjct:  463 AARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYA--HSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQW-------LHNMEIPT---KLEDLEVIQQRFDTLEPEM--NTLGGR--ISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAE--AERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVE-SGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQD---------GQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANR---AELFTQSC--------SALDSWLQNISSQLQSDDFGKDLTSVNI-LLKKHQMLEHQMDVREKEVQSLQSQALAL-------AQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQ---PRIDDIQAHGTNM-----SPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDL-EQWIAEREVVAGSHELGQDYEHVTMLR--DKFREFARDTSTIGQERVDAVNAQADE----LIESGHPENASVAEWKDGLNEAWADLLELI-------DTRTQMLAASYELHRFHQ--DAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAG-----------EKADDIHRHERAVTEAWEGLQSATQ--TRRLLLLDTVEKFRFLNM-VRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESL 2099          

HSP 6 Score: 132.88 bits (333), Expect = 8.845e-30
Identity = 199/983 (20.24%), Postives = 422/983 (42.93%), Query Frame = 3
Query: 8187 NKRQNRLNEY-IQLHTFLETCEAEEQWLLTQNKKCDVILNNLK---SLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVID-GFSSL----NEKLMRIHQMLSSEKELQELSQKVEDHI----TWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEK---VIDLDNQLKEL------KTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMI-NENNYLTSD---IREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQN--KTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISRE-FNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDI---KSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAI 11036
             KR  ++ +Y I+    +E  E     LL   ++  V LN+ +   SLS V++  +  +  R++       E+  ++  L  I  K+R +        EGK  S I+  +  L    +E+ + +   L  +++L+ L+ + +       TW+  N+ L++ D    +   +    +KH    ++++A    + A     + L +E +     +  +   V+ L   LKEL      + M+   L+RL++ +            + W+ + +   +S + G  L  VE L ++   +E DI++  E+++++Q  A     NE +Y   D   + E+  ++   + +LG+   +    L D+  L++F  ++  E  WI+++ Q+ +  + G  L+ A   + +H     E+A R   + +       L    H    ++     ++   +  L  A + R   L  +  + QF +D  ++E  + +    +++ E G DE S   L +K   +  EI    S    L E+ S +   Y +  + +  +  ++ +  E++ +  + R  +   L  Y    E+     W+  +   +   E     +D   + +RFD+    +N    +I ++  + +QL+   N    +I+ T + +    +  +     RK+AL+ AL +  +  E N++  W+K                           +KT+ I S +     L+ V  L+      ERDLEA+  +++   +E+ +L   +P+ ++ I  +  E+++ W  L+  + ++   L E  KLQ +L    D  +W       + S E  PT +A +E L+      K E+D+  ++  K+  +G ++   ++ A+++   + ++   +   W  +     SR  +  Q  D +  + +    E +L   E ++   +  S  S+   EEA K HED++  +E+ + K + +
Sbjct:  326 GKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYI---------MEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMK---------------------------EKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVAS-EDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHM--FLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPS--SLQGAEEAIKKHEDFLTTMEASEEKINGV 1267          

HSP 7 Score: 78.5666 bits (192), Expect = 2.248e-13
Identity = 94/428 (21.96%), Postives = 192/428 (44.86%), Query Frame = 3
Query: 1218 KASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKRHTALL-------EEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEKLNKNESNDIDEKIEND 2465
            +AS  + W+ E    L+NM   T +++ E    + + +  E+NT   R   + ++A  L  ++  +KD I    + + NRW   Q L N  KQA    L      L          +  K   ++  LG        L  K   ++  L+A+  + + +  +++  +         P+Q + ++ QL  +      L    ++R E L +       +RDL++ + WLS     + +++T    A   RL+ +HE  ++E+  +   + K++ +  ++++ Q   D +   + + L  L  GW  L R+   R  +L  A++ Q    DA+ ++ ++ ++ + L   +   + +GA +A IK+H   L       E+I+   E+  + + +  T   K  +K D   ER +K NK  +N++  K++++
Sbjct:  896 EASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSE------HPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQ--TDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEA-IKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQK-NKQAANELLAKLKDN 1313          

HSP 8 Score: 77.0258 bits (188), Expect = 5.704e-13
Identity = 83/369 (22.49%), Postives = 173/369 (46.88%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDI----LKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQT----LETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIP-DGEIHKSLDF----LSQGWTNLERIKSERRNL-LKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTAL 2303
            W+NE +    +M+     +N  ++  K +    E+ + K+   K+ +    L       +  +S   S +Q +W +L+   N+ QA +  L F  +            D     +  Q+ S D GK   +   LL+KH +++          +Q++ + ++ + SL+SQ L   Q  +    ++ + + ++   + L +  ++RR+ L  +   H+  RDLE+E  W+   + + T+ + G D  SV  L+++++  + EI  H P  + ++    ++S  +    D E   +LD     L + W  L   ++E+RN+ L +A   Q++Y DA +++ W+ E    ++++E   DE +   ++K+H  L
Sbjct: 1329 WINEKMLTAQDMSYDEA-RNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELE---NTTQAKAQCL-FDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNILLKKHQMLE----------HQMDVREKE-VQSLQSQALALAQEDSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLIS-ETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQIL 1680          

HSP 9 Score: 70.8626 bits (172), Expect = 4.323e-11
Identity = 142/781 (18.18%), Postives = 305/781 (39.05%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNY-------VNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANL-DKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESII-------SQQNCKLDSINPQLSV---DDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKL-------QKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD 5369
            +E   +K+EAI  D+ A   R+  +   E++ + ++     ++R+  A                 R   ++  WE L +L   + + L     +    +    + E +      L   + G      E+L +K   +  DI A   + ER K +    K+    E +Y       V EK+  +   YG+L      R+  L+++  + +F+ +  E    + E   II      KD+SS    + + E  + E+      L + +    ++V +       +T  +  +  +   L++    R++ L +++   +F  + + +E+ I       S Q    D  + Q       +VE  +++H +L   ID +  +   L       +    S ++  R   +  +  +L G     +  L+  L   +    A+    W+ +K      E +     +P KL       Q+   LE E+ +    +  ++     L+  ++  KD +      ++ +W    +    +++ L  A    +   E NE  + +  K   +E    T  LGNDL    +L  K   +E +LE     L  L+ +A ++  +    +E I  ++ +++    +L   + +R  +L +  K   F  D+D    W+   + +    D   SL +A +L  +H+ +  E++ +K     +  +G ++ +  +      +  R +AL   W  L +  + R   L  + + +  L D      ++  + Y ++ ++
Sbjct:  496 VEAATRKHEAIETDIQAYGERVAAV---EAVARELEAEGYHEVRRVLA-----------------RRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISA---QAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSL---IDSLHEQGSLLP------EAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEK------EQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIES---TQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTE 1235          

HSP 10 Score: 64.6994 bits (156), Expect = 3.194e-9
Identity = 72/344 (20.93%), Postives = 141/344 (40.99%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF--------DILKPQ---INSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKS-----LDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAE 2222
            W+ ++ S L + ++G  + + E  + K  LV  +I+   ER + ++  A    SN        S +  D     +K+ DL+     + G+LA    +         +F          ++ Q   I+  D GK   +A  LL KH     ++ A   R+  +          +K  ++   +   +  ++K++    + L E SQ R + L ++  +H+   D  + + W+   ++ ++++E GHD  S   L R+    E EI +H  + + L        +   +P+   H       L  + Q +  LE + S  R  L  A    + +++A   Q W+ E
Sbjct:  582 WMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQ------SYKPCDPALVEEKV-DLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAA---RYGPLGNSIAGGEALVKEGHVGAPE---VTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLH------EQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGE 906          

HSP 11 Score: 60.4622 bits (145), Expect = 7.542e-8
Identity = 76/406 (18.72%), Postives = 172/406 (42.36%), Query Frame = 3
Query: 1200 ATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKD-----AISTRNSDIQNRWKKL-----QDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTL-ETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFE------ENDMKRLQ 2351
            A +FN+       W+ E + +  + + G  + + +  + K + +  EI   + R   ++    N+        D     A+  R ++++  W  L     Q  +   +A+  +  +  +          E  ++     S +  K   +A  +++KH +++  L+  +   +Q+   SR  ++S   ++    +R TL + Q+  L     GL +++++RR +L++     +L R++++ + W++    V  + E G DY  V  L  +   +  + S       + ++ A++    + I  G      + +  D L++ W +L  +   R  +L  +YE  +++ DA ++   I E    +   E G D    Q  +++HTA   ++          ++D  RLQ
Sbjct: 1526 AHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMM-----SEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPES----ERITLRQAQVDKLYA---GLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTS----TIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQ 1915          

HSP 12 Score: 55.4546 bits (132), Expect = 2.449e-6
Identity = 44/150 (29.33%), Postives = 65/150 (43.33%), Query Frame = 3
Query: 11487 SQGSTNSDI--------LRTCSAEAPSST---------TQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKI----ALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKLQ 11873
            SQGS +  +        L + S + PS+T         T +A   G + RKQ + S   K+A RSW+  Y  L    L +YKD       +    EVP+   ++  A   V   YKKR  V  ++L D  E+  Q   + E   W+  +Q
Sbjct: 2188 SQGSESESVNGPGRDSGLDSASRQDPSATLPGRGGAEGTTEA-MEGILCRKQEMESHNKKSANRSWQNVYCVLRKGSLGFYKDNKSASNGIPYHGEVPI---SLGEAVCEVAHDYKKRKHVFKLRLGDGKEYLFQAKDEAEMSSWIRAIQ 2333          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 518.079 bits (1333), Expect = 9.912e-148
Identity = 307/768 (39.97%), Postives = 471/768 (61.33%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIET----ESG--EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFL--DSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NS L R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + KV LEN+G+ DIVDGNHRLILGLIWTIILRFQIQ++I+ET    ++G  E +SAKDALLLWCQ KT GY N++I +F  SW+DG+AFNALIH H P+L+DY  L   N   NL QAF +AEK+L +  LLDPEDV  E PD+KSI+TYV + Y  F+KMK      KR+GK++  A+E  +MIE YE L  +LL WI++ I+ LN R   NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  + + NN K Y P EG L+ ++  AW+ LEKAE+ RE VLR EL+RQE+LEQ A +F++KA++RE+WL E   +++  N G  +   EA   K + +  +I   +ER Q L  L+  LES  YH    I  R  +I   W  LQ+L+ +++    K   L  I + +  I    D +K ++ S D GKH L  +DLL+KH+LV+  +   ++R    N  +  F   DS K     P   Q +  ++++L      L  ++ QR+ +L+Q+      + ++ E ++W+    ++ ++ + G D  SVL L  +H V+E E++A      ++      + + + +   ++ + ++ + + W  LE + + R+  L+D     ++  DA+D + W+ +    + + + G+DE  TQ L+K+H  L +E +
Sbjct:   39 SARLFERSRIKALADEREAVQKKTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGDSYK-----PCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAA 801          

HSP 2 Score: 238.81 bits (608), Expect = 5.696e-62
Identity = 289/1318 (21.93%), Postives = 594/1318 (45.07%), Query Frame = 3
Query: 2925 NIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYIS-DLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLK---DRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL---------KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMK--TAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL--QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINV--LPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSI-ELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISL-------FSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDN-LNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKAD---RQINSV---LAANEAIQL-----GKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHI-LIKQNC--LRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            +I+ +  ++  ++ EL  L+  R+  L+ +   +  F E D+   +M  KE          T + G++      ++DL     R++ ++ ++ ++   +D     ++ K  AK L +   P  K +V +    +  +WE    +  DK+  ++ A S+  ++   DE    I +K  ++ +  ++G D  +   ++RK   + RD+ AI+ +++  +     + K +P   + +  + +E+D  +  L+  L+ R++ L     +  F+ D  + +  L +    + ++ +P  +   E  +   + L+++++  E +  ++K   + V++   D P    +   L  LD     L      R   L   L  Q+F ++  Q ++I++ Q   L  ++   ++D  E ALK H +    +D    ++ S  +    L         K       I  RN K  DK  ++ GK       L+++ E   F +N  +L+ WI++K+L  ++ +Y +  NL  K QKH+A  AE+ SN   L  I   G +L++     +  VKD L  + E W KL + T++K + L  A+    F+++LAD+ +    ++  ++    +   DL SA  L+ KH I E+++  +   L +L Q+A E       D+  +  E + L+    KL   ++QR   L+     HQF  D+  E+ W+ E  P A  +D+G +L     L  K++ L  EI+GH+P +  +LE G+ +    E SP  ++  E   K L+  W +L+++   R+ +L  S   +Q+ +D +D   WI E+  Y+     ++  D+ +  IM LK   V   T D    + +++     D  +K+     P+  EA+ ++  +    +   +    D++  L++         E+ ++E WI E+  +A S E G+DL  +  LRD++    +    +G++RV T N   ++L++  +S S  +A  ++ +   W  LL     +     ++ ++ K+    K+    +      L       FSK +  + +         F +++ ++  Q+      A +L  +Y  +    ++  +  +   W+ L++    +  QLE   D    +  +++ +A++  I  Q++     R ++SV   +  ++ I+      G KF + +   + +L++            +  +  EI+  +  ++EKR   K+ + +W  + + + L+ + C   RD     +    QE  V   +    ++E EKLL +H  F  + +  ++R  A
Sbjct:  826 DIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKE----------TWLVGLETPEN--LEDLEIVQNRLSILAQEMGNMQTRVD-----NVNKA-AKQLEDSRHPQTK-QVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGK-------LKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRDRARELEEL-QEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKK-LQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIAD--EMAKDEQSAMIM-LKRHLVLKQTVD----DYAYSIQQLADRAQKMLAEEHPD-GEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAA------FERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLER------------KHKDSAEIKEKLMQLVEKR---KEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERFSA 2086          

HSP 3 Score: 211.46 bits (537), Expect = 1.080e-53
Identity = 324/1525 (21.25%), Postives = 657/1525 (43.08%), Query Frame = 3
Query: 6585 NCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLT---EPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENID-AKRSIS------SLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE-------KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFES--HNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSD-----IREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRA--ERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVK---NLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSRE-IENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCD-MQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTE-EVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDI-----KSTAKY---IGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            N L +I ++ S    +E      ++  DL     L +KH  F   ++   D +K +     ++ ++KH     +    +D  ++ Q+L +     +  L + Q +     ++DD   W+ + ++Q+ + D   +    +  LL+K++ L  E + +    + L  K A  +  +   + + +  + +I + + +LL+ S  R   L +   L   F E DA E W  +KE  +   E   +L+    +Q +L+   + +G  Q    R+D + + A QL   +    P+   ++     +  RW+  K  +E  K+R++ A  LHNY  +       IK++ ++++  +D G+D+ +V  ++RK  G+ERDL A+ +K   LR +A+ +      N S  I  +Q+E+    + L    K R D L    +    ++D         +  + +     P+    A   L +HD L+  M+  +   +R+ D            T +   Q +   P   QL    E L     E    W+ R+N L++ +    F+              K+ D ILNN +      D  + +D A++++       + + A ++K +  S LE  ++L    +    L  GK K   D  SS+ E       K   +   L   +ELQ   Q  +D   WI  KML A D +Y++  NL +K +KH+ F++E+ +N+  +      G+ L+         + +++  L     +L++ +  K + L +  +   + + +     W+ E ++  +        DL S   L ++    E  +     +L+ +QE     + ++  L  D     I +Q+  +   F +L   L      L  A+ +++F  D+  E+ W+ +++ +A  ++ G++L      +K++ +L  EI      I+ + ++ R +      + ++ R   E   L+  + +L     +R  +L  +   QQ+ +D  + E  + ++ L +   E   DEQS + ++K+   L   +D  + +  +L+++   M  +     + +++    +  +   +KE+ E ++  + +  +++L  RE E++  WI  ++++   +E G+D D    L ++F  + +                     E     +E ++  N +I E + G         E   G  E  A      DL++ I  +   ++S   +     D  E    ++  K E  +  +  +  S         A FERD+ ++  Q+++    + RL   Y   +   +  TE EV + W  L  A   +R +L ET     +    +DL++W ++   +I + E  P DV+  ELL+      + EI+++  + N+ ++ G  +     K +A+    + Q+VE+++  + K W +  D L   R L E    + +F  + +  E+WL+  E  + S D    ++V E+E+  K HE + K   + + +F A
Sbjct:  649 NFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQ-RLLKKHRDLRDEAAKNGATIDAL-SKQANALPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQT---RVDNVNKAAKQLEDSRH---PQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENAS-DILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKD------------TGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDA-----------KQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKIL--STLETGQRL----VDSENLYSGKVK---DKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRDRARELEELQE----AVEQHGSLREDQPELEIEQQN--LQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMAKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFAR---------------------ETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWA------DLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNE--LPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEK-PRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLK-WDDRWDWL---RLLLE----VCQFARDASVAEAWLIAQEPYVASKD--VGQTVDEVEKLLKRHEAFEKSTATWEERFSA 2086          

HSP 4 Score: 130.183 bits (326), Expect = 4.717e-29
Identity = 302/1554 (19.43%), Postives = 613/1554 (39.45%), Query Frame = 3
Query: 2916 DKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQ--RGSIATDIEGIKKKYEAIIDDLAANSGRITYISD-LESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRD--------IDAIKSRMERFKYLGDGVKKTYPTEVNY---VNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDR-PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSI----NPQLSVDDVENAL-KTHANLAAFIDKID---NRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEK---LQKHKALEAEIKSNISSLEKIHDCGNDLI--KRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSA--TLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLD-DFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSD-------------NFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEE--IASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFS--KTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWM---------------TKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEE----TEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFD------------YDNINSLFDDCVKRRQKLH---DNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKY-KALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSL 7328
            D + I  +   L+  + EL  LA  RK  LE S     F  E      +++ +E  F+    G   T +  ++ K+    D+LAA    +  + D  ES+IQ                 + ++  P    KV  R  ++  QW++L +L   ++++L+       F    D+L+  +   +  ++ D+VG D+ + + L +K ++ LRD        IDA+  +               P E+     +  ++ +I D+Y +L    + R+  L++   ++   +++   E  + +    +     P+++  +E    +L  L  E+  ++  +D +   A  +   R P    +     RL+ + ++ K     +   +  AL    +  +CD+ ES I ++   ++S     N   +V  ++  L     +LAA  DK+D   +  Q L K   E     ++  I  R +++    + L      ++  L    +   F ++ ++   W+     A+  E+  D   LPE    L  H AL  ++  +     ++ D G  +I  + + P+   ++  L+ +D+ W +L+   + ++  L Q     +F  +        +  E  +      + L  A+  + KH    + ++   E +    +    +    +     + D++  +E R  K      + +  LKDN +   F  +      WI E   +A  T  D  R+L    +   KH+  + E+  +K  + N+ + G++L  E  P ++  V+ R   L + WD+LE    + K +L   AN  +  D    D+  W+ E         + L  D +   +  L S N+       LLK      N  +D  R+   L EL EAV +  +   D             +F+     L+ ++  LE  +    F  ++++   W++E+  +A S++ G +LQ ++ L  +  S  K I+  + R+    E   ++  +     EE  ++   + +Q  W +L    +++  +   + E  ++     D    +    + + +    KD  +     KR     + +++    +  ++  A K+  +   + + I+     ++  +  L E A  +  +L++   + +L  ++++   ++ E +  V + +++   L  +    L  KF E      TV Q+ V                 +   ID+++E  +     L EW                T+ + +    + L+  +  +       ++ K N    DL E     E     H  F  +IS    +VK        L      D             +    L D C  RR++L    D +R           + T++R   D   W++  LQQI+T +K  +     + LL KY + + AEI    P+F Q +     L+  +H  S E K  +  ++EK  +++ +   R   L+   ++  F  +    EAW   +E  V++ ++G  +D    L
Sbjct:  612 DPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQ-----------------IKHLGSP----KVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRD-LRDEAAKNGATIDALSKQA-----------NALPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPE-----NASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPD--GLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQ---KHQAFMAELASNKDWLHNIDKEGQELM-ESKPEFEPIVKDRLAKLHELWDKLESTTQE-KARLLFDANRSELFDQSLADLKKWLAELQ-------QQLQGD-VEEEVKDLTSANI-------LLKKHQITENQVRDRARE---LEELQEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMAKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDV-VASSQEMGQDL--DHVTILRDKFREFARETGTVGQERVD---------------TVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFY--DGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFR-----------FFTMVR---DLMAWMESILQQIETQEKPRDV--SSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKL 2066          

HSP 5 Score: 107.457 bits (267), Expect = 3.530e-22
Identity = 147/708 (20.76%), Postives = 311/708 (43.93%), Query Frame = 3
Query: 3927 SNITSALGRLD----DKMKSLKDKETKRDKDLKDALE--AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCG-----NDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREV--SPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVN--QSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL--VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDM 5987
            S+I  A  RL+    D+ + L+D+  +++K     LE  A++F ++    E+ + +    +   N    +  VE A K H  +   I   + RVQ+L     EL+     D+++I+ R D +L   + L      ++  L+ +L   +  +    +  W+D+ K   +  +  K L  + + LQKH  +EA+I      ++  +         D  K   P+   ++D ++ +D  +++L A    ++ +L Q+     F   +A++       E +  +   G DL S   L  KH++ E EL  + +NL ++  +   M +  H     +   +  ++ +  +L  L   R  NL+D  ++ QF  D D    W+ +     + +D G       +L  KH+ L  E   +   +  L +    L  E+  +P    D++ R   ++D +  L   +D R+ KLD +        + +   LW+ +K  ++   ++ ++L++ +I     +L  +  ++    T + N++      +D+       P+   V+    + N+    +E+F+A + DK++ +++     N+  +  E E+WI EK ++ +S +  G DL  +  ++ +     + +   +D++ +  + A +L+K     + +I + QE++   WD   T       + D+  E+ K     +D  D 
Sbjct:  398 SDINKAWERLEKAEYDRERVLRDELIRQEK-----LEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGDSYKPCDPQ--VIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTP----DIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQN--RLSILAQEMGNMQTRVDNVNKAAKQLEDSRH-----PQTKQVKDCQIRLNK---RWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWD---TLKRTLKDREDSLGEVSKLQTFLQDMDDF 1081          

HSP 6 Score: 83.5741 bits (205), Expect = 6.292e-15
Identity = 172/794 (21.66%), Postives = 333/794 (41.94%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMER-----FKYL-GDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSV-----ETSIQQLEPLKYEINLVEA-----NLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDV-------ENALKTHANL-------AAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDK---LLAIE-EENYKDLFNLPEKLQKHKALEAEIKSNISS-LEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEF----NENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL--QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDK 5372
            +E  KKK++AI  D+AA   R+  +  L   ++S         R  DAK            ++  R   I+  W+ L +L   +   L+   ++    +    +   +++    L   + G      E+L +K   +  DI     R++       K+  GD  K   P +   + ++++ +D  Y +L     +RK  L  +  +  F+ +  E E  + E   I  +    KD++SV     + S+ + E      NL +      ++ ++K L S  ++ R ND         +  + + L++    R ++L+D     +F  + D +++ +      +D++  Q+S DDV       +  LK H +L        A ID +  +  +L +   EL+  PD   I  R + + D   +L      ++  L++ +         +    W+  K   L+ +E  EN +DL    E +Q   ++ A+   N+ + ++ ++     L    HP+   VKD    ++++W+   A  EDK+ ++  A     +    +E  + I  K   +E    T  LGNDL +  ++  K   +E +L    + L  L+ +A ++ K+   +  +IL    +L+     L   +  R  +L +  K   F  D+D    W+ + + +    D    LP+A +L N H  L  +++GH+     + ++G  +   +E  P Y++ +E R + L   W  L K  D RK+ LD     +QF+ D       +  + Y +   DK
Sbjct:  465 VEAAKKKHDAIETDIAAYEERVQALVALSKELES--------ERYHDAK------------RIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGDSYK---PCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMND---------VQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWL------VDAMR-QMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPE---ELRNTPD---IQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDL----EIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIES---TQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQ-LEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDK 1205          

HSP 7 Score: 80.4925 bits (197), Expect = 6.060e-14
Identity = 187/943 (19.83%), Postives = 395/943 (41.89%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEK--------WHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQ---LLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKF--AKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTE--LINVSSWPN--DSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVK-----GSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLI--SENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRF---VKQHVTLMSEIATRAQSIESIKKQARDL 9386
            V  +NF  DL   E    KH     +I+  ++RV+AL      L+  ++ D   I++  D+ ++    L +  +    +L        + +E      W+DE   ++ + D   + LE +  LLQK+  + A+I+          VKSA     +    + +K     ++          + +L + + +R + L++++ L  F  E+  +E+W RE+E + S+ + G DL   + LQ+K    V   ++  AR D + Q  ++   ++Q K + +P+   ++ R   ++ +W  L+      K  L +  +   +  +   +   + D ++ +   D G D  + ++L +K   + RD  A N     A  +QA  + + L     I+  L   +I+D   +L  L+  R   L+ +   + I  +  A C++ + Q E  L+ + +  N  D +     L +   L   M N + + + +    ++L++ R+        Q + V     +LN   E   + V++       +++R++  + LH +   C+  E W+    +K  VI        + +D+  ++ A  +I   +   E+          SL +  +KL K+   +      + + +   + +L   L      L    +LQ   Q ++D   W+ +++  +AS+   +        +  H     +++ +E D     D G  +I   E+     ++ +++  LD    EL  M D +   L + +   ++ R  +   + +N  E      +  + L   EK  ++  D    ++++KE++ S  E    +++  N  +  ++++ + I  R  +  +  K  S  L D   L  F  +      WI +KM  A      +S  EA       ++H   M+E+A+    + +I K+ ++L
Sbjct:  453 VSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVE-DLLQKHSLVEADIAVQAER-----VKSANAAALKFANGDSYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSK--HSVFEDEL-AARRDNLKQVMDEGESMIQIKHLGSPK---VQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDL-RDEAAKNGATIDALSKQANALPEELRNTPDIQGRL--NDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDA-CELWMGQKETWLVGLETPENLEDLEIVQNRLSI---LAQEMGNMQTRVDNVNKAAKQLEDSRH-------PQTKQVKDCQIRLNKRWEAFKAMVED-------KKHRVDSALSLHNYDLDCDETESWI---KEKTRVI-------ESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQ----DTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQEL 1348          

HSP 8 Score: 74.3294 bits (181), Expect = 4.518e-12
Identity = 58/236 (24.58%), Postives = 116/236 (49.15%), Query Frame = 3
Query: 1602 KHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNK-LKISALDLSKTQFIPDGE-IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTAL 2303
            K   +A  LL+KH + + Q++   DR  ++     +  ++++      + +  LE + +NL  D   L     QR+ +L+     H+  RDL +E  W++  + +  + + G++  +V  L+++++  + EI  H P  ++ L+      +  +  P+ E + + +  L   W  L+   ++RR  L  + E Q+YY DA+DS+ WI E    ++  E   DE +   ++KRH  L
Sbjct: 1420 KDLTSANILLKKHQITENQVR---DRARELE----ELQEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMAKDEQSAMIMLKRHLVL 1648          

HSP 9 Score: 73.1738 bits (178), Expect = 1.072e-11
Identity = 211/1072 (19.68%), Postives = 446/1072 (41.60%), Query Frame = 3
Query: 3333 WEKLNKLKCDKEKSLEG----ASSIDLFNKTGDE---LRESI---NQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANL----DKLKSLASIVLKDRPNDSN-------ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKI----DNRVQSLSKRKTELK-PNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYK-DLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIK--RNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVE---GMMKTAQLGNDLPS----AKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEH-RPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGF---KDTCRKI----------NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRS----EEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKD--RNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLA----FLNEINTQVKAD--RQINSVLAAN 6362
            WE+L K + D+E+ L         ++   +  D    +RE+    NQ+L  ++ DN G+D  + E  K+K   +  DI A + R++    L   ++     +   ++ +   I  L+  LQ  L+ R+  L+    + +   +       ++E+ G + +    K +  VE  +Q+        +LVEA++    +++KS  +  LK    DS        I   +  LD   + L     +R   L+ +     F  E  ++ES I ++     S++      D+ + L   +  + F D++    DN  Q + + ++ ++  +  S K+  R + V  +  +L      +K +L++   F +F  +A++L  W+ D +  +  ++   D +     L+KH+ L  E   N ++++ +    N L +  RN P    ++  L  I + + +L   ++ ++KKL            L  I  + D  E   G  +T  +G + P      + +  + +IL  E+      +  + + A ++    H   + + D   +L  R      +V  +   +   L  H +  D D+   WI+E  R   +  D G  L   + +  K   +  ++   +  + +L +  + L +E  P    D+  R + L   WD L++   DR+  L   +  + FL D +D   W+ +    V   D   D    A +++ L         +D L  ++  +   +   KDT   +            L + +E + K + E    ++S       ++N L+    F  F  +  + +A ++ ++      +  + L   E    +    + +++  ++++ +  E   +L+ S+N  S    ++++S++E  +   D+    A + + K     E+  F +  +D +  +N   ++    + D  RN +    ++ Q F  EL + K  L +I     +L    P    ++ + +  L+ LW +L E   Q+  +L +  +   L+D   +SLA    +L E+  Q++ D   ++  + +AN
Sbjct:  404 WERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRL--VSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKH-------SLVEADIAVQAERVKSANAAALKFANGDSYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLD---YGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTPD---IQGRLNDIRDMYIELLTLSDLRQKKLDDTM-------ALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKE-HPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMP-DGLPEAEQLLNL---------HDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDS-------RKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDK----AKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARN-LHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKL-ESTTQEKARLLFDANRSELFD---QSLADLKKWLAELQQQLQGDVEEEVKDLTSAN 1426          

HSP 10 Score: 59.3066 bits (142), Expect = 1.332e-7
Identity = 103/431 (23.90%), Postives = 185/431 (42.92%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFF--KECDSFMEYMKGKEGDFNQRGSIATDIE-GIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQ-WEKLNKLKCDKEKSLEGASSIDL--FNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFK---------YLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDS-NITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTH 4148
            E H D E I ++Q +++K +  LK LA  RK  L+ +   H F   +E +   +++        +R  +A+  E G    +  I+ D      R T     E  + +++ +++E I    ++           S     +K+ +N+ W  L +L   + + L   SS DL  +   G EL   I +K + L +D +G D    E+  R      RDI ++  ++++F+         Y GD       TE        KE+ + +  L +A   R+  L    +  +F    ++    +  +   IE Q  P+DVSSVE  ++  + ++ EI       ++   L   +L+ +  DS  I   L +L +K K +  K   R   L+  LE  +F ++    E+ +  Q   + S +   +VD+VE  LK H
Sbjct: 1672 EEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHT--YHHFLLSREVEDLEQWIA-------ERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQER-VDTVNRIIDELIEGGHSE-----------SATLAEWKDGVNESWADLLELIDTRAQLL--TSSYDLLKYFYDGKELVGHIEEKKNELPED-LGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATE--------KEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRH 2070          

HSP 11 Score: 54.299 bits (129), Expect = 5.245e-6
Identity = 48/171 (28.07%), Postives = 72/171 (42.11%), Query Frame = 3
Query: 11517 RTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIAL---LTQH-EVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSDNEQVQWLSKLQQNKRLSSLEIQTAEKSKSVSVEPELCETISIDVASVFDSDTLHVPSKK 12017
            +  S    S+  Q     G + RK  L     KA  RSW   Y  L    L+ YKD  +    +T H E PL    + N++  +  +YKK+  V  ++L D SE+  Q   + E   W   ++Q     + ++Q  E        P   + +S+   S   S TL VPS K
Sbjct: 2188 KAASLPTESTQVQPVLMEGTLARKHELEGPNKKAPNRSWNNLYCVLKPGHLSIYKDAKSFSHSVTFHGEEPL---TLTNSSCEILTNYKKKKQVFKLRLGDGSEYLFQCKDEEELQNWTQAIEQ-----AAQVQIEEPVAG----PSGVKALSLPPPS---STTLEVPSTK 2343          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 543.502 bits (1399), Expect = 7.700e-156
Identity = 311/767 (40.55%), Postives = 481/767 (62.71%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP-IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER   +  +A  LE+ NYH    I+ R  ++   W+ L +L+ ++     +L   +++        M +     D +K  + S D GKH L  +DLL+KH LV+  +   +DR   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + +++++ + G D  SV+RL  +H+ +E E+S     +   +K     +++  F  + +I + +  + + W NLE + + R+  L+D     ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+
Sbjct:   38 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKAR-----RLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRF--ATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSE-KIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 796          

HSP 2 Score: 269.24 bits (687), Expect = 5.447e-71
Identity = 277/1315 (21.06%), Postives = 604/1315 (45.93%), Query Frame = 3
Query: 2913 YDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDL-ESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTL 6773
            ++  +++ + + + + + EL  LAR RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+  +E++  ++   + R+  ++ +   LI S  P              S       + K++ R       W +  +L    + +L  A SI  ++   +E +  I +K  ++ +   +G D      L+RK   + RD+ AI++++   +   + ++  +P +   + +++ EI++++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EIN  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q F ++  Q E+ ++ Q   L       +++  E A+KT  +    +D  + ++ ++  + R+     N +S+KI  + D +  +  K         + L+++ E  KF ++  ELS WI++K+L   + +Y +  NL  K  KH+A  AE+ SN   L+KI   GN LI      +  VK+ +  +   W++L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE++++ + + + +L+ +A  ++++G      D +  + E+R +EL    L PL N+R   L  + + HQF  DV+ E+ W+EE  P AT  D+G +L     L  K++ L  EI GH+    ++ E  K +  + S +  + +  R   L+  W  L ++ + R  +L+ S   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+  Q       E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV + N  A+ L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +    +   W+ L++  + + L+L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  AL      L
Sbjct:  817 FNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQ--FESLEPEMNNQASRVAVVNQIARQLIHSGHP--------------SEKEIKAQQDKLNTR-------WSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIEL----LAPL-NERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGH-----PE-SERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2082          

HSP 3 Score: 263.077 bits (671), Expect = 4.061e-69
Identity = 338/1515 (22.31%), Postives = 669/1515 (44.16%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANH---SIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRS-------ISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK--------LMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLF 11066
            +++  DL    +L  KH+ F   +S    R   L   I   +EM    HF  + I     D  ++   L       + +L +         ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ +    + L  ++A L   +   S + +  +  I E++ +L   ++ R  AL++A  L   F E DA E W  EKE  ++  ++   L+    +Q +  EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L+ A  + NY+ E       I+++ K+++  ++ G+D+  V  L+RK  G+ERDL A+  K   L++  +    L+A H   +  I  +  EI +  E++    K R + L  + +  + ++D         +    I     PN    A   L  H+ +K  +NN +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQ+ L+   Q H +        Q  L   K+ +  LNN + +    ++  N++A  +         + + A E+K    ++++   +L    ++D  +   K +  +D   S ++K        LMR    L   +E+Q+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LI+E   +   + EK+  L    +EL++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  ++  K++++ ++ +A  +  E    T ++  Q  ++  RF++L   L      L  ++ +++F+ DV  E+ W++++M LA   + G +L      +K++ TL  EI       + I ++++ + D +    + I     +L+  +  L    E+R  +L  +   QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS KTS       +   E +   Q+++ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + ++ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A + +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL   E  + S   +  +SV E+E+  K HE + K   +   +F A++R T +  L+
Sbjct:  666 DDYGKDLTSVVRLYCKHKAFEDEMS---GRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRSTIDALHEQAAAL-PEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQFESLEPEMNNQA--SRVAVVNQIARQLIHS---GHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAE---KLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQSLLS---QSHAY--------QLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKI--NAVVDTGRRL----VNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR----LKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKS-TDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLS-KTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSV----------NHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLY 2085          

HSP 4 Score: 108.227 bits (269), Expect = 3.421e-22
Identity = 166/825 (20.12%), Postives = 342/825 (41.45%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHD------CGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSN-EFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV 6434
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RV ++    R+ E +   D ++I  R D V+     L      +++ LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++        G +  K   P+   ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L  KH   E E+  +  +L +  ++  EM  + HF  E I + I+ ++ + A L  L   R   L+D    +QF  D D    W+ +     + +D G        L  KHK +  EI  ++  +  L E    L  E       DV+ R   +++ +  L + A  RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I  +  + +  + N +          R++    +   + ++A   K N     +  FR  ++  ++AL +     N+  E +E ++WI EK K+ +S  E G DL  +  L+ +     + +   E ++    + A +L      +++ I     ++ + W+ + T    +      A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++++      K++    +     +D     + + +  L+  W +L +    +   L     Y +     K++ AFLN     +      N++ AA  AI+  + F  ++   E  +  +V
Sbjct:  426 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQ--VIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEE--RFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLN-------NMQIPEKLEDLEVIQFE--SLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLN---TRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLAEAEKLLTQH----ENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVV 1229          

HSP 5 Score: 106.301 bits (264), Expect = 1.310e-21
Identity = 201/1041 (19.31%), Postives = 424/1041 (40.73%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEAN-LDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-----KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHE-WDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   +   LE    +    +    + + +++   +L   + G      E+L +K   +  DI        A+ +  +RF   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV     + +  + E++    + L  +K    ++ +D      I   +  + ++  +L+     R K L+D   + +F  + D +++       I+S  +   D  + Q  V   ++  +  AN  + ID +  +  +L + +       +S  + NR   + ++  +L      +K  L++ L   K    A+    WI      +E+E + +   +PEKL+     + ++LE E+ +  S +  ++     LI   HP +  +K     ++ +W +     +  +  L  A    +   E NE  + I  K   +E    T +LGNDL    +L  K   +E +L      L  L+++A ++  +     + I+D + ++     ++   +  R  +L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EIN ++     + + G+ + +  +      +  R +AL   W+ L K  ++R+  L  S   + FL D         +   ++N  +  L + ++ N +   ++       + T +       N   DT R++    N+  + +E   +K +      +  RA  ND    L++ ++   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +  NQL+ ++   +E I   +    H  W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    +++  K +++++   A  L
Sbjct:  459 VEAATKKHEAIETDIAAYEERVLAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERF------NSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWI------VEKEQWLNNMQIPEKLEDLEVIQFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIES---TQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRD-------TKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIE---EKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLI-AEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQAL 1446          

HSP 6 Score: 103.219 bits (256), Expect = 9.985e-21
Identity = 231/1098 (21.04%), Postives = 460/1098 (41.89%), Query Frame = 3
Query: 8667 VKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA---EILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNM----STDYQNKTKEL--VKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKL-------------EKLFQ-QRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVED--VRSRKLLKKQASAGQL--DIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDK----IALLTQHEVPLLSDNIRNATITVPESYKKRNFVIHVKLEDLSEFYLQFNSD 11840
            +K   +F++ ++A+E  I A +D G+RL+++ + +S +I EKV  +D++ K+ +  ++  L RL +  +  K+ +  +    WINE  K+  + +   D    +  + LK Q    E  + S+KE L  I++E + +I E     + ++E+ + ++  + +L    +  +  L DA   E+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + +E ++ QA+ L      + D++  +R  +E  +  L     ER   LLA+K   QF  DV +  + + ++  L  + + G + Q+   LMKK ++L  EI         + E++  +    S + +  T+ L  ++ L + L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ E +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  N+ ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     ++++++ + + WK + D    RR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+     +++    F       K              EKL Q   K KE I K   W D       R E  ++  E      +H+ +  + +       ++  + SR++       GQ   +++    R   F  + A  DE  + +  +  V TL      + + ST++R   K S+       + +  +        +  A +     AQF G + RK        KA+ RSW   Y  ++   + +YKD       +   +E+P    N++ A   V   YKK+  V  +KL D +E+  Q   D
Sbjct: 1208 IKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINE--KMLTARDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGK-STDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDK---WED-------RWEWLRLILE------VHQFSRDASVAEAWLFGQEPYLSSREI-------GQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTL--YTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGIAYHNEIPA---NLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDD 2231          

HSP 7 Score: 83.1889 bits (204), Expect = 1.147e-14
Identity = 192/962 (19.96%), Postives = 400/962 (41.58%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA----SSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNF---EKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIR----ESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKD---------------HIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHI---QKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++ +  +++ +  +L  +   DIK    +  +VI  +  L E L      L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    +++      ++A     +R  +            I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E E+I  S +YG DL SV +L  +    E +++     L    +E + MI E+++ +  IRE+   I  ++  L          L D    Y+F +D      W+ D +++ +  ++G         VK+H  +  EIA    +I+++ +QA  L +   F    ++   + +E  Y+ L      R   L       +  S+    E+ + +K   LNN    EK  D +       + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L+  L I+    E  E  +WI+ +  ++   +E G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I      +K   K R+E+L  A ++  F+R+ +D   W+                             +T+  I+ E          + N  A+ E+ L    +Q E   NE N  +E Y   +D                +  + + ++  WN L      +++ L+++   QL+L   K   ++   +   +   E LP ++  +E  I    +    +D+  +++N ++ +G  + +        +EEK + I    K  +   ++L  R    + N +++KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E I K+ +
Sbjct:  456 LPAVEAATKKHEA---IETDIAAYEERVL--AVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPE-ERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVI-----QFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLS----------------------------RTQTAIASE---------DMPNTLAEAEKLL----TQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTE-LPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR---LKDNREMQKFLQDCQELSLWI--NEKMLTARD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGN--QLIAEKPETEAIVKEKM 1355          

HSP 8 Score: 82.0333 bits (201), Expect = 3.165e-14
Identity = 183/959 (19.08%), Postives = 404/959 (42.13%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINL----VEANLDKLKSLASIVLKDRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVE-GMMKTAQLGNDLPSAKSL----IGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLL---KNISHNTNGFKDTCRKINVLPELVE--AVTKKFNETSDNFESFRASLNDKQNALENCQDFLN-------FQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQE--DMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R+     +   ++     ++  +  +   +  L+  L   L+ R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    V A     +  A+     +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +      D+ + ++ +    AF D++  R   L +   E      + +  SEKI  R   + ++   L      +K  LE+     +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +  S+++ +H+    L +      D V++ L  I+E++K+L      +++ L  A         L  +  + D  E  +++  Q  N++   + L    + +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV++    L   L    +  + ++   WI E+ +   +  + G  L   + L  K   +  ++   +  + +L +  + L+ E  P   + +  R   + + W+ ++    +R+  L  ++  +QFL D +D   W++     +  + +D+ N                LA  + LL   +NI +  N +++  +K+  + E+V       ++       ++     N+     EN Q  L+       F  +  + EA+++ ++ +    E   +L+  E         + +++  E+++    +   +L+  +N  S++I    +  D +H+ +R    A+    +     E+ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I    N+L  + P    ++ E++  L+ +W++L
Sbjct:  441 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYG---KDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTD-VQNRLSGIEERYKELAELARLRKQALQDAL-------TLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAE-HPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAI--ASEDMPN---------------TLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNR--AGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEEL 1365          

HSP 9 Score: 78.5666 bits (192), Expect = 2.757e-13
Identity = 85/405 (20.99%), Postives = 181/405 (44.69%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDM---KRLQELVTLMTKPSDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++    L +    ++  +  + S +   W++L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q+        ++  +++      KS +    QRQ +E +   L   +N       +R++ L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  L+++++  + EI  H      IF + K+   D S    +    I + L  L   W+ L     +R   L++++  Q+YY D  +++ W++E    ++++E   DE +  +++K+H  L + +  + E      K  + LV      S++  +R  +V+KL
Sbjct: 1290 WINEKMLTARDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIELLAPLN-------ERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSS----LNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKL 1678          

HSP 10 Score: 58.9214 bits (141), Expect = 3.000e-7
Identity = 78/381 (20.47%), Postives = 170/381 (44.62%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLIN-SKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
            K   +A   E W+ E    LNNM     +++ E  + + E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ +K A S  L+     L    T     +  K   ++ +LG        L  K   ++  L A+  +   +  ++    + L++++  PDQ Q +  +L  ++     +    + R E L +     + +RDL++ ++WLS     + +++  +  A   +L+ +HE  ++EI+ +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R++LL  ++  Q +  D + ++ ++     ++ + E  N+  A +A IK     +  +   EE
Sbjct:  855 KMFSEADACELWIVEKEQWLNNMQIPEKLEDLE--VIQFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEA----EKLEAEH--PDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEE 1223          

HSP 11 Score: 55.4546 bits (132), Expect = 2.769e-6
Identity = 77/390 (19.74%), Postives = 169/390 (43.33%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP--IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  + K + +  EI   + R   + E +  +  ++  + +AI+ R +D+Q  W  L +    +     ++   +  +             E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   Q+  L     GL ++S++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  + + H+     + +   A DL  +       I +  D L++ W +L  +   R  +L  ++E  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1489 QFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQS---QVDKLYA---GLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARD-TGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1864          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 543.117 bits (1398), Expect = 1.011e-155
Identity = 311/767 (40.55%), Postives = 481/767 (62.71%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP-IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER   +  +A  LE+ NYH    I+ R  ++   W+ L +L+ ++     +L   +++        M +     D +K  + S D GKH L  +DLL+KH LV+  +   +DR   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + +++++ + G D  SV+RL  +H+ +E E+S     +   +K     +++  F  + +I + +  + + W NLE + + R+  L+D     ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+
Sbjct:   34 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKAR-----RLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRF--ATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSE-KIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 792          

HSP 2 Score: 226.483 bits (576), Expect = 4.354e-58
Identity = 270/1315 (20.53%), Postives = 585/1315 (44.49%), Query Frame = 3
Query: 2913 YDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDL-ESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLIT---EINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQ--MEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTL 6773
            ++  +++ + + + + + EL  LAR RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +   LI S  P              S       + K++ R       W +  +L    + +L  A SI  ++   +E +  I +K  ++ +   +G D      L+RK   + RD+ AI++++   +   + ++  +P +   + +++ EI++++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EIN  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q F ++  Q E+ ++ Q   L       +++  E A+KT  +    +D  + ++ ++  + R+     N +S+KI  + D +  +  K         + L+++ E  KF ++  ELS WI++K+L   + +Y +  NL  K  KH+A  AE+ SN   L+KI   GN LI      +  VK+ +  +   W++L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K      EL +Q + L++  +   E+      D +  + E+R +EL    L PL N+R   L  + + HQF  DV+ E+         + LN     L     +   +    T   EI GH+    ++ E  K +  + S +  + +  R   L+  W  L ++ + R  +L+ S   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+  Q       E+ ++E WI E++ +A S+E G+D +   +  LR R  ++  +  +G++RV + N  A+ L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +    +   W+ L++  + + L+L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  AL      L
Sbjct:  813 FNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHP--------------SEKEIKAQQDKLNTR-------WSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQKEVEELRSQAQALSQEGKSTDEV------DGQRQVVEVRFIEL----LAPL-NERKKYLLASKEIHQFNRDVEDEI--------VSALNGMTFCLWLNCTITKGNTNSCTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGH-----PE-SERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTVSTLRFREFAR-DTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2065          

HSP 3 Score: 224.942 bits (572), Expect = 1.310e-57
Identity = 345/1590 (21.70%), Postives = 679/1590 (42.70%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANH---SIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRS-------ISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK--------LMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVE-KLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVEDVRSRKLLKKQASA 11282
            +++  DL    +L  KH+ F   +S    R   L   I   +EM    HF  + I     D  ++   L       + +L +         ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ +    + L  ++A L   +   S + +  +  I E++ +L   ++ R  AL++A  L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L+ A  + NY+ E       I+++ K+++  ++ G+D+  V  L+RK  G+ERDL A+  K   L++  +    L+A H   +  I  +  EI +  E++    K R + L  + +  + ++D         +    I     PN    A   L  H+ +K  +NN +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQ+ L+   Q H +        Q  L   K+ +  LNN + +    ++  N++A  +         + + A E+K    ++++   +L    ++D  +   K +  +D   S ++K        LMR    L   +E+Q+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LI+E   +   + EK+  L    +EL++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV   LK+QQ ++E      + Q Q++ +E  +        T ++  Q  ++  RF++L   L      L  ++ +++F+ DV  E+    + M       +  ++ + +       TL  EI       + I ++++ + D +    + I     +L+  +  L    E+R  +L  +   QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS KTS       +   E +   Q+++ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+       RF  + +       + ++            N  + ++ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A + +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL   E  + S   +  +SV E+E+  K HE + K   +   +F A++R T +  L           + S   DDP T +   +T+K +   +   S           P+     D +S+  ++ Q +A
Sbjct:  662 DDYGKDLTSVVRLYCKHKAFEDEMS---GRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRSTIDALHEQAAAL-PEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLIHS---GHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAE---KLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQSLLS---QSHAY--------QLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKI--NAVVDTGRRL----VNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR----LKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQKEVE----ELRSQAQALSQEGKS--------TDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEIVSALNGMTFCLW--LNCTITKGN---TNSCTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLS-KTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTVSTLRFREFARDTGHIGQERVDSV----------NHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNS-TRCSFTADDPETAVMVEQTEKGFYIYSKESS-----------PIPSPTADRKSKSGMQPQTAA 2128          

HSP 4 Score: 117.472 bits (293), Expect = 5.342e-25
Identity = 321/1657 (19.37%), Postives = 681/1657 (41.10%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYM-KGKEGDFNQ-RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIE--EENYKDLFNLPEKLQKHKALE---AEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLVS--FSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKL 7718
            ++D + I  ++  + +L+  L  L +AR++ LE +    + F+E    M++M + K    +Q  G     +E + +K+  +  D+A  + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++      + +    G+ +          + E+IK+I + +  L++    RK  L +  + ++F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI    + +D L   A+ + ++R N +++ + L  ++++ K L +    R + L+DAL   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L    +P  ++I  + DK+  + ++        K  L + L    +    NE   WI +K   IE  +E   DL  +    +K   +E   A I++ ++ L+K      + ++  HP +  A+ D L  I+  W+++    +++E+ L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E+    E+  K++    EM   G  D + +     ++ L+    +L  +   R S L  +  +  F  D  Q   ++          +   +L  A       +  +T ++  +  +  ++++G+ L  + +    K +E +  ++     +    A+D   +L  +   ++FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I    N        I   PE    V +K +     +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +   Q K +E  E R +       Q L  +   ++E+   ++ ++  +  LL   +++     A++EIH+FN+  +D  ++V+  N   F    +   I  G        KE++  + + DDI   +  +      N++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV+    E          ++++ + + D+ E+R   +  L+E        L + N  R++  +    A +EV    +    D E       + R FA +   +  +RV +++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+      L +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL     R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+ L
Sbjct:  491 YHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQK----EAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDK-IEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKML----TARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQL------IAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKK---QQKEVE--ELRSQA------QALSQEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVED--EIVSALNGMTFCLWLN-CTITKGNTNSCTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEER---RGKLDE-----RQRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTVSTLRFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQ----------DKHKKLPEE------LGRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSAL 2058          

HSP 5 Score: 110.538 bits (275), Expect = 6.662e-23
Identity = 166/825 (20.12%), Postives = 341/825 (41.33%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHD------CGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSN-EFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV 6434
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RV ++    R+ E +   D ++I  R D V+     L      +++ LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++        G +  K   P+   ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L  KH   E E+  +  +L +  ++  EM  + HF  E I + I+ ++ + A L  L   R   L+D    +QF  D D    W+ +     + +D G        L  KHK +  EI  ++  +  L E    L  E       DV+ R   +++ +  L + A  RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++  ++AL +     N+  E +E ++WI EK K+ +S  E G DL  +  L+ +     + +   E ++    + A +L      +++ I     ++ + W+ + T    +      A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++++      K++    +     +D     + + +  L+  W +L +    +   L     Y +     K++ AFLN     +      N++ AA  AI+  + F  ++   E  +  +V
Sbjct:  422 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQ--VIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEE--RFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLN---TRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLAEAEKLLTQH----ENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVV 1227          

HSP 6 Score: 106.301 bits (264), Expect = 1.175e-21
Identity = 203/1037 (19.58%), Postives = 423/1037 (40.79%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEAN-LDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHE-WDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDIS 6116
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   +   LE    +    +    + + +++   +L   + G      E+L +K   +  DI        A+ +  +RF   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV     + +  + E++    + L  +K    ++ +D      I   +  + ++  +L+     R K L+D   + +F  + D +++       I+S  +   D  + Q  V   ++  +  AN  + ID +  +  +L + +       +S  + NR   + ++  +L      +K  L++ L   K    A+    WI      +E+E + +   +PEKL+       + ++LE E+ +  S +  ++     LI   HP +  +K     ++ +W +     +  +  L  A    +   E NE  + I  K   +E    T +LGNDL    +L  K   +E +L      L  L+++A ++  +     + I+D + ++     ++   +  R  +L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EIN ++     + + G+ + +  +      +  R +AL   W+ L K  ++R+  L  S   + FL D         +   ++N  +  L + ++ N +   ++       + T +       N   DT R++    N+  + +E   +K +      +  RA  ND    L++ ++   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +  NQL+ ++   +E I   +    H  W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q   KE+E +++Q   +S
Sbjct:  455 VEAATKKHEAIETDIAAYEERVLAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERF------NSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWI------VEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIES---TQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRD-------TKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIE---EKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLI-AEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQ---KEVEELRSQAQALS 1435          

HSP 7 Score: 88.1965 bits (217), Expect = 3.354e-16
Identity = 200/1034 (19.34%), Postives = 424/1034 (41.01%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRD----IESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTI--------VCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPE---------ADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERD-------LNALNEKFAKLRQ----AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTE-LINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEI---LEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLI-SENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKK 9629
            V  +NF  DL   E    KH     +I+  ++RV A+      L+   + D   I +  D+ ++  + L +  +     +E  L  Q+++  +L   D    W+DE    + + D   + L  +  LLQK+  + A+I+        +   +    T      E +K          V ++   + +L   + +R + L+E++ L  FF E+   E W REKE ++S+++ G DL   + L  K           +A  D ++  +  LLQ  TI   E         ++ IR R K I+ +W  L++     K RL +    + +  +   +   + D L++V   D G D  S + L +K   +  +       ++AL+E+ A L +    + D+ + L              I++  ++LA L + R   L  +   +K+  +A A C++ + + E  +N    P   +         + L+  MNN+  +   +  + R+L      + S   S+ E +    D+LNT        V +T++A       L+  + +  +   C   + W+  + K    ++ + + L    D+   +  +R ++ +   R+   ++  L ++    EKL  +     +    +   + + +  +   L    + L    +LQ+  + ++D  +W+ R +  IAS+            + +H    +E+   E D Q   D G+ +   +  A  + + +++  LD    EL  M + +   L ++     + R  +   +++N  E +       N+L + E   + Q D    +++ +E++ ++ +    ++N+ N  +  I E+   I++R  +      +    L D   + +F  D      WI +KM  A       +     +++K H   M+E+A+  + ++ I+K+   L       +  ++ + + L   +E L +  + +  +L      + F     +++  L+     + + + G D  S   L+KK
Sbjct:  443 VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMD----WMDEMKVLLLSQDYGKHLLGVE-DLLQKHALVEADIAIQADRVRAVNASAQRFATG----GEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCK----------HKAFEDEMSGRSGHLLQ--TIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSG------------IEERYKELAELARLRKQALQDALTLYKMFSEADA-CELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQL------IHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDA-------LSSALSIQNYHLECNETKSWIREKTK----VIESTQELGN--DLAGVMALQRKLTGM--ERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLK-HQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKK 1419          

HSP 8 Score: 87.4261 bits (215), Expect = 6.563e-16
Identity = 189/959 (19.71%), Postives = 399/959 (41.61%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA----SSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIR----ESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKD---------------HIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHI---QKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++ +  +++ +  +L  +   DIK    +  +VI  +  L E L      L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    +++      ++A     +R  +            I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E E+I  S +YG DL SV +L  +    E +++     L    +E + MI E+++ +  IRE+   I  ++  L          L D    Y+F +D      W+ D +++ +  ++G         VK+H  +  EIA    +I+++ +QA  L +   F    ++   + +E  Y+ L      R   L       +  S+    E+ + +K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L+  L I+    E  E  +WI+ +  ++   +E G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I      +K   K R+E+L  A ++  F+R+ +D   W+                             +T+  I+ E          + N  A+ E+ L    +Q E   NE N  +E Y   +D                +  + + ++  WN L      +++ L+++   QL+L   K   ++   +   +   E LP ++  +E  I    +    +D+  +++N ++ +G  + +        +EEK + I    K  +   ++L  R    + N +++KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E I K+ +
Sbjct:  452 LPAVEAATKKHEA---IETDIAAYEERVL--AVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPE-ERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLS----------------------------RTQTAIASE---------DMPNTLAEAEKLL----TQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTE-LPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR---LKDNREMQKFLQDCQELSLWI--NEKMLTARD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGN--QLIAEKPETEAIVKEKM 1353          

HSP 9 Score: 82.8037 bits (203), Expect = 1.790e-14
Identity = 184/955 (19.27%), Postives = 403/955 (42.20%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINL----VEANLDKLKSLASIVLKDRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLL---KNISHNTNGFKDTCRKINVLPELVE--AVTKKFNETSDNFESFRASLNDKQNALENCQDFLN-------FQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQE--DMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R+     +   ++     ++  +  +   +  L+  L   L+ R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    V A     +  A+     +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +      D+ + ++ +    AF D++  R   L +   E      + +  SEKI  R   + ++   L      +K  LE+     +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +  S+++ +H+    L +      D V++ L  I+E++K+L      +++ L  A +    F+E  A  L   +  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV++    L   L    +  + ++   WI E+ +   +  + G  L   + L  K   +  ++   +  + +L +  + L+ E  P   + +  R   + + W+ ++    +R+  L  ++  +QFL D +D   W++     +  + +D+ N                LA  + LL   +NI +  N +++  +K+  + E+V       ++       ++     N+     EN Q  L+       F  +  + EA+++ ++ +    E   +L+  E         + +++  E+++    +   +L+  +N  S++I    +  D +H+ +R    A+    +     E+ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I    N+L  + P    ++ E++  L+ +W++L
Sbjct:  437 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYG---KDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTD-VQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEK-EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAE-HPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAI--ASEDMPN---------------TLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNR--AGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEEL 1363          

HSP 10 Score: 67.0106 bits (162), Expect = 9.273e-10
Identity = 95/448 (21.21%), Postives = 194/448 (43.30%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGIKKKYEAI------IDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQ-WEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTE-VNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLA-SIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL 4220
            E H + E I  +Q++++KL+  LK L+  R+  L+      Q  +E D   +++  +E        +      + + YE +        + A ++G I      +  + S++ M ++ I    +          D + ++  +K+ +N+ W  L +L   + + L  +  +  F     E+   I  K   L ++ +G D+ + E L+R       DI A+ +++ + +     ++  Y  +  + + ++  E+ + +  L +A + R+  L + G+  +F +  ++    + ++   IE Q  P+DVSSVE  +   + +K EI+    +      L  S++ +       I   L +L +K K + DK   R + L+  LE  +F ++    E+ +  Q   L S     SVD+VE  +K H          D R  +L +  T L
Sbjct: 1643 EGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAERE--------VVAGSHELGQDYEHVTVSTLRFREFARDTGHIG-----QERVDSVNHMADDLINSGHS----------DAATIAE-WKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEE-LGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2065          

HSP 11 Score: 62.003 bits (149), Expect = 3.039e-8
Identity = 78/381 (20.47%), Postives = 170/381 (44.62%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLIN-SKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
            K   +A   E W+ E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ +K A S  L+     L    T     +  K   ++ +LG        L  K   ++  L A+  +   +  ++    + L++++  PDQ Q +  +L  ++     +    + R E L +     + +RDL++ ++WLS     + +++  +  A   +L+ +HE  ++EI+ +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R++LL  ++  Q +  D + ++ ++     ++ + E  N+  A +A IK     +  +   EE
Sbjct:  851 KMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEA----EKLEAEH--PDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEE 1221          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 543.117 bits (1398), Expect = 1.197e-155
Identity = 311/767 (40.55%), Postives = 481/767 (62.71%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP-IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER   +  +A  LE+ NYH    I+ R  ++   W+ L +L+ ++     +L   +++        M +     D +K  + S D GKH L  +DLL+KH LV+  +   +DR   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + +++++ + G D  SV+RL  +H+ +E E+S     +   +K     +++  F  + +I + +  + + W NLE + + R+  L+D     ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+
Sbjct:   34 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKAR-----RLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRF--ATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSE-KIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 792          

HSP 2 Score: 273.092 bits (697), Expect = 3.050e-72
Identity = 277/1315 (21.06%), Postives = 605/1315 (46.01%), Query Frame = 3
Query: 2913 YDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDL-ESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTL 6773
            ++  +++ + + + + + EL  LAR RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +   LI S  P              S       + K++ R       W +  +L    + +L  A SI  ++   +E +  I +K  ++ +   +G D      L+RK   + RD+ AI++++   +   + ++  +P +   + +++ EI++++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EIN  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q F ++  Q E+ ++ Q   L       +++  E A+KT  +    +D  + ++ ++  + R+     N +S+KI  + D +  +  K         + L+++ E  KF ++  ELS WI++K+L   + +Y +  NL  K  KH+A  AE+ SN   L+KI   GN LI      +  VK+ +  +   W++L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE++++ + + + +L+ +A  ++++G      D +  + E+R +EL    L PL N+R   L  + + HQF  DV+ E+ W+EE  P AT  D+G +L     L  K++ L  EI GH+    ++ E  K +  + S +  + +  R   L+  W  L ++ + R  +L+ S   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+  Q       E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV + N  A+ L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +    +   W+ L++  + + L+L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  AL      L
Sbjct:  813 FNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHP--------------SEKEIKAQQDKLNTR-------WSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIEL----LAPL-NERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGH-----PE-SERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2080          

HSP 3 Score: 262.307 bits (669), Expect = 7.175e-69
Identity = 352/1589 (22.15%), Postives = 694/1589 (43.68%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANH---SIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRS-------ISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK--------LMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVEDVRSRKLLKKQASA 11282
            +++  DL    +L  KH+ F   +S    R   L   I   +EM    HF  + I     D  ++   L       + +L +         ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ +    + L  ++A L   +   S + +  +  I E++ +L   ++ R  AL++A  L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L+ A  + NY+ E       I+++ K+++  ++ G+D+  V  L+RK  G+ERDL A+  K   L++  +    L+A H   +  I  +  EI +  E++    K R + L  + +  + ++D         +    I     PN    A   L  H+ +K  +NN +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQ+ L+   Q H +        Q  L   K+ +  LNN + +    ++  N++A  +         + + A E+K    ++++   +L    ++D  +   K +  +D   S ++K        LMR    L   +E+Q+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LI+E   +   + EK+  L    +EL++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  ++  K++++ ++ +A  +  E    T ++  Q  ++  RF++L   L      L  ++ +++F+ DV  E+ W++++M LA   + G +L      +K++ TL  EI       + I ++++ + D +    + I     +L+  +  L    E+R  +L  +   QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS KTS       +   E +   Q+++ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + ++ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A + +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL   E  + S   +  +SV E+E+  K HE + K   +   +F A++R T +  L           + S   DDP T +   E       +  N S  + +S  +  P+     D +S+  ++ Q +A
Sbjct:  662 DDYGKDLTSVVRLYCKHKAFEDEMS---GRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRSTIDALHEQAAAL-PEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLIHS---GHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAE---KLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQSLLS---QSHAY--------QLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKI--NAVVDTGRRL----VNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR----LKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKS-TDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLS-KTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSV----------NHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNS-TRCSFTADDPETAVMMAENADT--NELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAA 2152          

HSP 4 Score: 109.768 bits (273), Expect = 1.069e-22
Identity = 166/825 (20.12%), Postives = 341/825 (41.33%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHD------CGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSN-EFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV 6434
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RV ++    R+ E +   D ++I  R D V+     L      +++ LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++        G +  K   P+   ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L  KH   E E+  +  +L +  ++  EM  + HF  E I + I+ ++ + A L  L   R   L+D    +QF  D D    W+ +     + +D G        L  KHK +  EI  ++  +  L E    L  E       DV+ R   +++ +  L + A  RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++  ++AL +     N+  E +E ++WI EK K+ +S  E G DL  +  L+ +     + +   E ++    + A +L      +++ I     ++ + W+ + T    +      A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++++      K++    +     +D     + + +  L+  W +L +    +   L     Y +     K++ AFLN     +      N++ AA  AI+  + F  ++   E  +  +V
Sbjct:  422 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQ--VIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEE--RFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLN---TRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLAEAEKLLTQH----ENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVV 1227          

HSP 5 Score: 104.76 bits (260), Expect = 3.689e-21
Identity = 201/1043 (19.27%), Postives = 424/1043 (40.65%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEAN-LDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHE-WDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   +   LE    +    +    + + +++   +L   + G      E+L +K   +  DI        A+ +  +RF   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV     + +  + E++    + L  +K    ++ +D      I   +  + ++  +L+     R K L+D   + +F  + D +++       I+S  +   D  + Q  V   ++  +  AN  + ID +  +  +L + +       +S  + NR   + ++  +L      +K  L++ L   K    A+    WI      +E+E + +   +PEKL+       + ++LE E+ +  S +  ++     LI   HP +  +K     ++ +W +     +  +  L  A    +   E NE  + I  K   +E    T +LGNDL    +L  K   +E +L      L  L+++A ++  +     + I+D + ++     ++   +  R  +L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EIN ++     + + G+ + +  +      +  R +AL   W+ L K  ++R+  L  S   + FL D         +   ++N  +  L + ++ N +   ++       + T +       N   DT R++    N+  + +E   +K +      +  RA  ND    L++ ++   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +  NQL+ ++   +E I   +    H  W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    +++  K +++++   A  L
Sbjct:  455 VEAATKKHEAIETDIAAYEERVLAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERF------NSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWI------VEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIES---TQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRD-------TKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIE---EKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLI-AEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQAL 1444          

HSP 6 Score: 86.6557 bits (213), Expect = 9.838e-16
Identity = 189/959 (19.71%), Postives = 399/959 (41.61%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA----SSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIR----ESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKD---------------HIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHI---QKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++ +  +++ +  +L  +   DIK    +  +VI  +  L E L      L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    +++      ++A     +R  +            I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E E+I  S +YG DL SV +L  +    E +++     L    +E + MI E+++ +  IRE+   I  ++  L          L D    Y+F +D      W+ D +++ +  ++G         VK+H  +  EIA    +I+++ +QA  L +   F    ++   + +E  Y+ L      R   L       +  S+    E+ + +K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L+  L I+    E  E  +WI+ +  ++   +E G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I      +K   K R+E+L  A ++  F+R+ +D   W+                             +T+  I+ E          + N  A+ E+ L    +Q E   NE N  +E Y   +D                +  + + ++  WN L      +++ L+++   QL+L   K   ++   +   +   E LP ++  +E  I    +    +D+  +++N ++ +G  + +        +EEK + I    K  +   ++L  R    + N +++KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E I K+ +
Sbjct:  452 LPAVEAATKKHEA---IETDIAAYEERVL--AVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPE-ERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLS----------------------------RTQTAIASE---------DMPNTLAEAEKLL----TQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTE-LPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR---LKDNREMQKFLQDCQELSLWI--NEKMLTARD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGN--QLIAEKPETEAIVKEKM 1353          

HSP 7 Score: 81.6481 bits (200), Expect = 3.783e-14
Identity = 184/955 (19.27%), Postives = 403/955 (42.20%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINL----VEANLDKLKSLASIVLKDRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLL---KNISHNTNGFKDTCRKINVLPELVE--AVTKKFNETSDNFESFRASLNDKQNALENCQDFLN-------FQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQE--DMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R+     +   ++     ++  +  +   +  L+  L   L+ R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    V A     +  A+     +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +      D+ + ++ +    AF D++  R   L +   E      + +  SEKI  R   + ++   L      +K  LE+     +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +  S+++ +H+    L +      D V++ L  I+E++K+L      +++ L  A +    F+E  A  L   +  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV++    L   L    +  + ++   WI E+ +   +  + G  L   + L  K   +  ++   +  + +L +  + L+ E  P   + +  R   + + W+ ++    +R+  L  ++  +QFL D +D   W++     +  + +D+ N                LA  + LL   +NI +  N +++  +K+  + E+V       ++       ++     N+     EN Q  L+       F  +  + EA+++ ++ +    E   +L+  E         + +++  E+++    +   +L+  +N  S++I    +  D +H+ +R    A+    +     E+ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I    N+L  + P    ++ E++  L+ +W++L
Sbjct:  437 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYG---KDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTD-VQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEK-EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAE-HPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAI--ASEDMPN---------------TLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNR--AGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEEL 1363          

HSP 8 Score: 78.5666 bits (192), Expect = 3.524e-13
Identity = 85/405 (20.99%), Postives = 181/405 (44.69%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDM---KRLQELVTLMTKPSDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++    L +    ++  +  + S +   W++L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q+        ++  +++      KS +    QRQ +E +   L   +N       +R++ L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  L+++++  + EI  H      IF + K+   D S    +    I + L  L   W+ L     +R   L++++  Q+YY D  +++ W++E    ++++E   DE +  +++K+H  L + +  + E      K  + LV      S++  +R  +V+KL
Sbjct: 1288 WINEKMLTARDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIELLAPLN-------ERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSS----LNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKL 1676          

HSP 9 Score: 67.781 bits (164), Expect = 6.004e-10
Identity = 94/444 (21.17%), Postives = 197/444 (44.37%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQ-WEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTE-VNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLA-SIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL 4220
            E H + E I  +Q++++KL+  LK L+  R+  L+      Q  +E D   +++  +E     ++ G     +  +++++     + A ++G I      +  + S++ M ++ I    +          D + ++  +K+ +N+ W  L +L   + + L  +  +  F     E+   I  K   L ++ +G D+ + E L+R       DI A+ +++ + +     ++  Y  +  + + ++  E+ + +  L +A + R+  L + G+  +F +  ++    + ++   IE Q  P+DVSSVE  +   + +K EI+    +      L  S++ +       I   L +L +K K + DK   R + L+  LE  +F ++    E+ +  Q   L S     SVD+VE  +K H          D R  +L +  T L
Sbjct: 1658 EGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR----EFARDTGHIG-----QERVDSVNHMADDLINSGHS----------DAATIAE-WKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEE-LGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2080          

HSP 10 Score: 61.6178 bits (148), Expect = 3.784e-8
Identity = 78/381 (20.47%), Postives = 170/381 (44.62%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLIN-SKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
            K   +A   E W+ E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ +K A S  L+     L    T     +  K   ++ +LG        L  K   ++  L A+  +   +  ++    + L++++  PDQ Q +  +L  ++     +    + R E L +     + +RDL++ ++WLS     + +++  +  A   +L+ +HE  ++EI+ +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R++LL  ++  Q +  D + ++ ++     ++ + E  N+  A +A IK     +  +   EE
Sbjct:  851 KMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEA----EKLEAEH--PDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEE 1221          

HSP 11 Score: 55.4546 bits (132), Expect = 3.225e-6
Identity = 77/390 (19.74%), Postives = 169/390 (43.33%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP--IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  + K + +  EI   + R   + E +  +  ++  + +AI+ R +D+Q  W  L +    +     ++   +  +             E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   Q+  L     GL ++S++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  + + H+     + +   A DL  +       I +  D L++ W +L  +   R  +L  ++E  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1487 QFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQS---QVDKLYA---GLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARD-TGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1862          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Xenopus
Match: frs3 (fibroblast growth factor receptor substrate 3 [Source:Xenbase;Acc:XB-GENE-478600])

HSP 1 Score: 543.117 bits (1398), Expect = 1.229e-155
Identity = 309/761 (40.60%), Postives = 467/761 (61.37%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEI 2315
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R   ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + KV LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV++ +F  SWRDGLAFNA++H H P++ID+  L   N   NL  AF +AE+EL +  LLDPEDV+V++PD+KSI+TYV++ Y  F+KMK      KR+GK++  A+E  ++IE+YE L   LLQWI++ II LN R   NSL+ +Q ++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   ++   N G  +   EA + K E +  +I    ER Q +  +A  LE+ NYH    I  R  ++      L++L+ +++     +   +  +       M++ + +K ++ S D GKH    +DLL+ H LV+  +   ++R   +   ++ F+   + +   P   + +  ++  L      L  +S  RR +L+++    K   D+ EE+ W+  + +++ + + G D  S LRLI +H  +  E+S H     +      +L        GEI + +  +   WT +E +  +R   L++AY   ++ ADA D++ WI +   LV   E G+DE +TQ L+K+H  + EEI
Sbjct:   43 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRISDLYNDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDIIDFDTLKKSNAHHNLQNAFNVAERELGLTKLLDPEDVNVDQPDEKSIITYVATFYHYFSKMKALAVEGKRIGKVLDQAIEADQLIENYEGLASELLQWIEQMIITLNDRKLANSLSGVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLAARFDRKAAMRETWLSENQRLVAQDNFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARR-QRLHMNLELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAERVKSVTAVAQKFM--TEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEI 800          

HSP 2 Score: 271.552 bits (693), Expect = 1.038e-71
Identity = 289/1295 (22.32%), Postives = 587/1295 (45.33%), Query Frame = 3
Query: 2928 IEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGK--HNILESELE-TQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIE-LGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT-KDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN--SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQ--LGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSD-----IDDMLEKRNKTKQALNEWMTKNEHILIKQNCL---RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDR 6740
            ++ +   L + + EL  LA  RK  L+ S   H+ F E D+ + ++  KE   N  +      D+E +++++E +  ++   + RI  ++++   + + D   E  IR    ++ S                    +W +  KL   K+ +L+ A  I  ++   +E    + +K  ++ +  ++G D      L+RK   + RD+ AI+ ++   +   + +   +P +   +  ++ +ID+ +G+L++ +++R+  L  A  +  F+ D  + +  L+     + ++ +P D++  E  + Q E +K EI+   A+  +++ +   V + + +     +   L  LD     L      R + L      Q+F K+  Q+E  ++ Q   L       ++   E A+K H +    +D  + ++Q L  S RK   + N +SEKI  +   + ++  K           L+++ +   F ++  EL+ WI++K+L  ++ +Y +  NL  K QKH+A  AE+ SN   L+KI   G  L+      +  V++ L T+ + W  L + T+ K + L  A+    F ++ + +      +E  +++   G DL S   L+ K  H +L S    +Q + L +      E+    H D   + D+  KL        PL N+R   L  + + HQF  D++ E+ W++E  P A   D+G+ LP    L  K++ L  EI GH+P + ++LE GK + ++ S +  +++E R   LK  W+ L  +   R  +L+ S   +QF  D  +   W+ E+  ++   +K    D+I  + M  K + ++ A  D    NI    N  +D   + +  PE  + +T +  +    + S +    ++Q  L+        + ++ ++E WI E++ +A S+E G+D + +  LRD++    +    +G++RV   N  A+ L+ S +S +  +A  ++ +   W  LL     ++    A+ E+H+F +  K+    +      +  +T +D N  +   +    F  +++ +  Q+  +   A++L+  Y     +D+   E   ++  W +L   +  +   L    +    +  +++ + ++++IN  + A  +   V +A+  IQ  LG K AE  A  +       SF+  ++            SD     ++ + E+R +T+   N+W  K   + +    L   RD     +  A QE  V+ +    +++E E L+ +H  F   +S  D+R
Sbjct:  827 VDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNS--------------------RWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQTDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQQLMSEKPELEPVVREKLDTLHKLWNDLESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQHCMLSSPFCFSQAQALGQEDANIVEV-DSKHKD---VADKFSKLR------APL-NKRRKLLLASKEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDILERGKSMIQD-SSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEK--AKDEIGAQAMLKKHLVMEQA-LDDYADNIHQLANSSRDMVSRGH--PE-SDRITLRQGQVDKLYASLKDLAEERQGKLQEHHRLCQLKRDVEDLEHWISEREVVAASHELGQDYEHVTMLRDKFREFSRDTSNIGQERVDAVNLMADDLISSGHSENATVADWKDQLNEAWADLLEMIDTRSQMLAASYELHRFYQDAKETLGQIQDKQKQIPEETGRDLNTAEAMQRMHTAFEHDIQALSAQVKQVQEDASRLQKAYAGEKAADIHRHE-QAVSEAWGELQNASGARRQLLLDTVEKFRFFRMVRDLMLWMDDINLLIDAQEKPRDVSSADLVIQNHLGIK-AEVDARAD-------SFTTCIDLGNSLLEKNHYASDKISEKLEQLQERRQETE---NKWKDKMAWLRVVHEVLMFGRDASVAEAWLASQEPIVRSSELGGNVDEVESLIKRHEAFQKAVSTWDER 2071          

HSP 3 Score: 213.386 bits (542), Expect = 4.270e-54
Identity = 305/1486 (20.52%), Postives = 635/1486 (42.73%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYI----RESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEK-NPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEE-VEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKI-------WKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKL 11054
            +++  DL  + +L++KH  F   +S     ++        L    HF    I     +   +  ++     D E +L     +     +++D   W+ + L+ + T +   +    +  L++K+K +  EI +H P  + L  + A  +   +  S E    +  + +++ +L++ +  R  AL+++  L   F E DA   W  EKE  ++  E+   L+    +Q +            +RI  + + A QLL   T      ++IR     + SRW+  +  ++  K  L+ A  + NY+ E       ++++ K+++  +  G+D+  V  L+RK  G+ERDL A+  K   LR +AE + D      +  I  +  +I +   +L    K+R + L  + +    ++D         +    +     P D   A   L  H+ +K  +++     +R+ D+  ++   +                TD Q   +Q+ L +      E    W  R   L++      FL+  +  E +L  Q    + +L++ +  ST++     I       + + A E+K ++G L+E   KL ++Q  + +  + K  S+ +      +    +   L   ++LQ   Q  ++   WI  KML A D +Y++  NL +K +KH+ F++E+ +N+  +      G++L+SE       + EK+  L     +L++ +  K + L +  +   +T+      SW+   E   +S +YG DL SV  L  +Q    +       Q Q++ +E D  I E +    D       + ++F +L   L      L  ++  ++F+ D+  E+ W+++KM +A   + G  L      +K++ TL  EI      I+ I ++ + +   +     +I      L++++E L     +R  +L  +   QQF +D  E E  + ++ L + + EK  DE     ++KK   +   +D  + N  +L+  + +M +    ++  +    Q ++ ++   ++      +  L  +  +    R+ E++  WI  + ++    E G+DY+    L ++F  +++  +    + ++  N+    ++   +  +  + +    + E    L +    R + L  + E+H F ++A + +                        +  D Q       I  E  + L+    ++     FE D++A+++Q+++   +++RLQ+ Y   K   + + E+ V + W  L+ A   +R  L +T +   +    +DL+ W    N+ I + E  P DV+ ++L+I      K E+D+++      I  G+ +     Y    + EK   +Q+        WK   D +   R ++E    +  F  + +  E+WL   E +++S +     +V E+E   K HE + K V +   +F  +++ T L
Sbjct:  671 DDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQT-LVKKHKEIEEEILSHRPAIDALH-EQARGLPPAYSHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLL---TTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADG-HPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQ----------------TDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQ----EYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEEK-IQG-LVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQQLMSEKPELEPVVREKLDTLHKLWNDLESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQHCMLSSPFCFSQAQALGQE-DANIVEVDSKHKD-------VADKFSKLRAPLNKRRKLLLASKEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDILERGKSMIQDSSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEKAKDEIGAQAMLKKHLVMEQALDDYADNIHQLANSSRDMVSRGHPESDRITLR-QGQVDKLYASLKDLAEERQGKLQEHHRLCQLKRDVEDLEHWISEREVVAASHELGQDYEHVTMLRDKFREFSRDTSNIGQERVDAVNLMADDLISSGHSENATVADWKDQLNEAWADLLEMIDTRSQMLAASYELHRFYQDAKETL-----------------------GQIQDKQKQ-----IPEETGRDLNTAEAMQRMHTAFEHDIQALSAQVKQVQEDASRLQKAYAGEKAADIHRHEQAVSEAWGELQNASGARRQLLLDTVEKFRFFRMVRDLMLWMDDINLLIDAQEK-PRDVSSADLVIQNHLGIKAEVDARADSFTTCIDLGNSLLEKNHYASDKISEKLEQLQERRQETENKWK---DKMAWLRVVHE----VLMFGRDASVAEAWLASQEPIVRSSELGG--NVDEVESLIKRHEAFQKAVSTWDERFVLLEKLTTL 2081          

HSP 4 Score: 159.458 bits (402), Expect = 1.039e-37
Identity = 200/976 (20.49%), Postives = 426/976 (43.65%), Query Frame = 3
Query: 8205 LNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLK---SLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVID-GFSSL----NEKLMRIHQMLSSEKELQELSQKVEDHI----TWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEK---VIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINEN-NYLTSD---IREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTK--ELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSV--ITEEMNGLKDNFK----IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISRE-FNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDI---KSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAI 11036
            L++ I+    +E  E     LL   ++  + LN+ K   SLS V++  +  +  R++       E+  ++  L  I  K+R +        EGK  S I+  +  L    +E+ + +   L  +++L++L+ + +       TW+  N+ L+A D    D   +   ++KH    +++ A    +QA       L +EN+     I  +   VI L + L+EL T    +L   +E  + F+    +   + W  + +   +S +YG  L  VE L +    +E DI    E+++S+   A   + E+  Y   D   +R +  ++  R+ +L        + L ++  L++F  D+  E  WI+++ +L   ++ G  L  + R + +H     E++     ++    +  +L  + HF   +I      ++  +  +    E+R  +L    +Y QF +D  + E  + D   L++  E G DE S   L+KK + +  EI         L E+   +   Y +  +    +  L+ +  E+  +   ++  ++++L  +    E++  L WI  +   + + E  +  +D   + +RF++    +N   ++I ++        +     + +  N NS+  + +++N   + F+     +K AL  AL++  +  E N+ + W++                           +KT+ I S +     L+ V  L+      ERDL+A+  ++    +E+ +L + +P     I+ +  ++++TW  LK  + ++   L E  KLQ +L    D  SW       + S E +P D+A +E L+      K EID    + +++   G+++   ++ A+Y+   ++++   +   W  +     +R +L  Q    ++F+ +   +E +L   E ++   +  S  ++   E A K HED++  +++ + K   +
Sbjct:  301 LDQAIEADQLIENYEGLASELLQWIEQMIITLNDRKLANSLSGVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLAARFDRKAAMRETWLSENQRLVAQDNFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARRQRLHMNLELQRMFQ---DLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAERVKSVTAVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPAYSHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNE------VAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMR---------------------------EKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVAS-EDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQTDAQYM--FLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTEMPS--TLQAAEAAIKRHEDFLTTMDANEEKIQGL 1235          

HSP 5 Score: 120.553 bits (301), Expect = 5.680e-26
Identity = 133/667 (19.94%), Postives = 278/667 (41.68%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI--------NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDF 5978
            A +F ++    E+ +S+    +   N  + +  VE AL+ H  +   I     RVQ+++    EL+     D  +I  R   V+   + L      ++  L  +LE  +  ++ + L +W +D    ++ E+Y K L  + + LQ H  +EA+I      ++ +       +  +   K      V++ +  +++++ +L   +  +  KL ++    +F  ++ +          ++ +   G DL S+  LI KHN    E+      L +   +  E+   GHF    I + I++++ +  ++  L   R   L++   ++QF  D +    WI +     + ++ G        L  KHK++  EI  H+P +  L E  + L    S  +  +V+ R  AL+  ++ L   A  RK  L  S    +   + +   LWI EK  ++N +       +I  ++  L+ +     T +  + N++       +   ++        N + ++ + +  ++NE       FR  ++ K+ AL++  D  N+  E +E   W+ EK K+ +S +  G DL  +  L+ +     + ++  + +V      A +L      ++  I     D+   W  L     ++      A ++  F +   DF
Sbjct:  431 AARFDRKAAMRETWLSENQRLVAQDNFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARRQRLHMNLELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAERVKSVTAVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPAYS--HSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVT-------EIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNE-------FRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDF 1081          

HSP 6 Score: 115.161 bits (287), Expect = 2.440e-24
Identity = 233/1151 (20.24%), Postives = 459/1151 (39.88%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNI-----------NSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNF---WVDEKLQQIKTLD--KSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVT---NQHPKSEEFKTIVCNILE-KWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERD-------LNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPP--TDDQLNT-----VQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEI---LEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLI-SENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIE--TIKEF-KWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLE----------IDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIER 9938
            V  +NF +DL   E  L KH     +I    +RV+A++     L+   + D   I           + L +    RRQ+LH N              L L R   D ++   W ++   ++++ D  K  + +E+   LLQ +  + A+I+      + +   + + +T      P   E      ++LE ++ +L + S  R S L+E++ L  FF ++   EAW RE+  L+ +++ G DL   + L +K     G        +        +L+ +    A E   I  R K ++ +W  ++   E  + RL EA+  + +  +       I D L+LV   + G D  S + L +K   IE +       ++AL+E+   L  A         +HS ++  +   ++   E+L  L   R   L  S    K+  +A A      ++ + +NV+  P   +      +  + L+  MNN                     + S IAS NE      T DQ N      +Q+ L S   E +   ++++  L+  + +  +   C     W+  + K    ++ + +SL    D+      +R ++ +   R+ K ++G + ++    EKL            G+   + + +  L + + R  + L    +LQ   + ++D  +W+ R +  +AS+    D       + +H    +E++    D     D G+ +   +  A  + + +++  LD    EL  M + + + L +  + ++F K T++VEGF   +N  E +       + L + E   ++  D    +++++E++Q + E    +I E N  +  I+E+   I+ R  +  +        L D   L  F  D      WI +KM  A       +     ++ K H   M+E+A+    ++ I K+ + L       +  +R +   L   +  L +  + +   L      + F      +E  L +    L +   G D  S   L+ K +   L           +  E +N V++  K  +++  +      L  N + KL+   +               + + R+ E+ + W+K +  + I  ++GKD      LI++
Sbjct:  452 VAQDNFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARRQRLHMN--------------LELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVED---LLQTHTLVEADIAVQAERVKSVTAVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGE---IEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPA--------YSHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNN---------------------LASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTK----VIESTQSLGN--DLAGVTALQRKLTGM--ERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQTDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGF---LNNQEYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQK-HQAFMAELASNKDWLDKIDKEGQQLMSEKPELEPVVREKLDTLHKLWNDLESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQHCMLSSPFCFSQAQALGQEDANIVEVDSKHKDVADKFSKLRAPL--NKRRKLLLASKEG-------------HQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKK 1526          

HSP 7 Score: 111.309 bits (277), Expect = 3.610e-23
Identity = 373/1887 (19.77%), Postives = 732/1887 (38.79%), Query Frame = 3
Query: 4293 GKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKT---------AQ--LGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATY-DTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKF---NKTCKDFSD----MVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIK----QNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI---------------SVTDDRVKALSVFIPTLKEMKHFD---------YDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFL---VSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNI-RSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLL---SCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWL-------LTQNKKCDVILNN--LKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIAS----DANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTS 9698
            GK  GK +D  +E D     ++  A+EL +WI+  ++ + +    + L  +  +LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA    +FD    M +T         AQ   G DL + ++ + KH  +E+++    E +  +   A E+  + + D   IL     +      L  LV  R   L  NL+  +   D+   + W E+ +      DYG+ L     L   H  +  +I      V ++    +    E     P   + V  R   L+  +  L   +  R+ KL+ S    +F  D  +   WI E+S  +   D   D       I K  +   +++ +   L + ++               + E ++ V  ++ E         A   D++  L     +  FQ + ++ EAWI +  ++  ++E G D    + L  +     + I      +   +E A  L  +  S S E+      ++  ++ L+  A+ +      +  +HK       C  + D     +N+  I    K +D   +    +R +    E+ N+ +++  ++  A +L      N + I +  D LN  W +  +  +QK   L+   D    + +  E++ ++ E    +++ + + + LA   A+Q      E  L   +  +  L S +E L +         I   SDID+       T   L + M + E  L +    Q  LRD+    S  +  +  V   +   DL E E+LLA+H    + I                VT  +  A  +F+   + +K  D         ++N + L       +Q L D  + +E  L+NQ+  L+                       +  +TL+     +++++     + A+E + + L+    +L+  Q+  SE+ +  V +I E+  +    + +  + LK+ +DL  F  +   +  W  EK      VS +E  +        QA + E    K      +D I +   QL+  K    PE + + R +   +   W+ L++  ++    L +A +   +      +   +++    ++   +G D+ SV  L  KQ         L+  F    QA+ +    DAN  +++  K K++ D   +L     +R   L  S    +  +D   L D  L   E + ++   +  K   T   +  + +TL       + RI D+   L+  ++++      Q+ S+ P +     ++E L    S  +E      KR  RL E +    F       E W+       +++ K  D I     LK    +E   +  D   +I  L ++      +G        LR+ Q+  +      Y S+ D       KL   H++        +L + VED   WI  + ++A+      +YE    L +K ++     S +   +  + A       LIS  H+ +  + +    L+    +L  M D + + L  + +  ++ +  +  +  I + +K       G DL + E ++R     E DI +   Q++ +QE+A  +  +  Y     +DI      ++  + +L          L D    +RF   V   + W+ D   L + +E    ++ AD  ++ H+ + +E+  RA S  +       L ++NH+A D+I  +   L+   +   N  +++   L        F  D    E  L  +  ++ + E G +     +L+K+ E+    +      FV L + T+
Sbjct:  294 GKRIGKVLDQAIEADQLIENYEGLASELLQWIEQMIITLNDRKLANSLSGVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---ARFDRKAAMRETWLSENQRLVAQDNFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVADELEAENYHDVRRILARKCNVIRLSDYLRELVTARRQRLHMNLELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAERVKSVTAVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTE-------MEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPAY-SHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIP--EKLEDLEVVQ---QRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDE-------TWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQTDAQYMFLQ--QRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDT-KQVEGFLNNQEYVLSHT---------------------EMPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQKHQAFMAELASNKDW----LDKIDKEGQQLMSEK----PELEPVVREKLDTLHKLWNDLESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQHC-----MLSSPFC-FSQAQALGQE-DAN-IVEVDSKHKDVADKFSKLRAPLNKRRKLLLASKEGHQFNRD---LEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDI---LERGKSMI------QDSSLDPQE-----IEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEKAKDEIGAQAMLKKHLVMEQALD--DYADNIHQLANSSRDMVSRGHPESDRITLRQGQVDKL------YASLKDLAEERQGKLQEHHRLC-------QLKRDVEDLEHWISEREVVAASHELGQDYEHVTMLRDKFREFSRDTSNI--GQERVDAVNLMADDLISSGHSENATVADWKDQLNEAWADLLEMIDTRSQMLAASYELHRFYQDAKETLGQIQDKQKQIPEET-GRDLNTAEAMQRMHTAFEHDIQALSAQVKQVQEDASRL--QKAYAGEKAADIHRHEQAVSEAWGELQNASGARRQLLLDTVEKFRFFRMVRDLMLWMDDINLLIDAQEKPRDVSSADLVIQNHLGIKAEVDARADSFTTCIDLGNSLLEKNHYASDKISEKLEQLQERRQETENKWKDKMAWLRVVHEVLMFGRDASVAEAWLASQEPIVRSSELGGNVDEVESLIKRHEAFQKAVSTWDERFVLLEKLTT 2080          

HSP 8 Score: 108.612 bits (270), Expect = 2.728e-22
Identity = 211/1081 (19.52%), Postives = 438/1081 (40.52%), Query Frame = 3
Query: 2925 NIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQRGSIATDIEGI---KKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYP-TEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLAS----IVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQI-----ESIISQQNCKLDSINPQLSVDDVENALKTHANLAA---FIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI-NVLPELVEAVTKKFNETSDNFESFRASLNDKQNAL-ENCQDFLNFQDEISEVEA--------WIDEKQKIAD--------SNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKS-QNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLF----SKTKDRNAIDF 6047
            +I   Q +LN  + E + L   +K  L+ +     +  EC+  + +M+ K        S+  D+ G+   ++K   +  DL A  G+   + DL S                +A+ L++   P     +  R  +I   W +L      +E++L  AS +  F +  D+ +  +++    +  ++V  D    E L  + + +  +ID   +   R + +G+ V +     +  ++ +++K +D  + +L    E R   L+   +  +F+ D+K+ E  LN    ++ +  +P  + + E +I++ E     +  ++AN +K++ L      ++ +   N   I   +  +D++ K  +   ++    LKD  + Q F ++C ++     E +++ Q+   D      S      A    A LA+   ++DKID   Q L   K EL+P      +  + D +    N L      K   L +      F ++ + L  W+ +    ++ ++Y KDL ++   L K +          S  + +     ++++ +   KD        + +K+ KL A    + K L  + E  +FN +L D +        M  +   G DLP+ + LI K+  L+ E+      +  + ++   M +D   D + I + +  L+    +L     +R++ L+++L   QF  D  +   W+ E        +  +    A  +  KH  +   ++ +   +  L  S +D+     P   + +  R   +   +  L+  A++R+ KL       Q   D  D+  WI+E+       +   D + +                  T+L+      + F++  R   N+  E V+AV    ++   +  S  A++ D ++ L E   D L   D  S++ A        + D K+ +            E G DL   E ++    +    I+    +VK   E+A++L K+    ++ +I   ++ +   W  L   +  +        E  +F +  +D   M+ +D+I+L      K +D ++ D 
Sbjct:  932 SIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGK---VGDLRS----------------EAEKLAD-GHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQTDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTEMPSTLQAAEAAIKRHEDF---LTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQKHQAFM--AELASNKDWLDKIDKEGQQLMSEKPELEP-----VVREKLDTLHKLWNDLESTTQSKAQCLFDANRAELFTQSCSALESWLQNLESQLQSDHYGKDLTSVNILLNKQQHCMLSSPFCFSQAQALGQEDANIVEVDSKHKD--------VADKFSKLRAPLNKRRKLLLASKEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDILERGKSMIQDSSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEKAKDEIGAQAMLKKHLVMEQALDDYADNIHQLANSSRDMVSRGHPESDR-ITLRQGQVDKLYASLKDLAEERQGKLQEHHRLCQLKRDVEDLEHWISEREVVAASHELGQDYEHV------------------TMLR------DKFREFSRDTSNIGQERVDAVNLMADDLISSGHSENATVADWKDQLNEAWADLLEMIDTRSQMLAASYELHRFYQDAKETLGQIQDKQKQIPEETGRDLNTAEAMQRMHTAFEHDIQALSAQVKQVQEDASRLQKAYAGEKAADIHRHEQAVSEAWGELQNASGARRQLLLDTVEKFRFFRMVRDL--MLWMDDINLLIDAQEKPRDVSSADL 1947          

HSP 9 Score: 100.138 bits (248), Expect = 8.139e-20
Identity = 175/943 (18.56%), Postives = 387/943 (41.04%), Query Frame = 3
Query: 3294 SKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDS-------KENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVL-KDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAF---IDKIDNRVQSLSKRKTELK-PNPD-SEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYK-DLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDY--GRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDL---QREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPE----LVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAI 6041
             ++  R KE+  QW ++  L  D+E+ L  A S   F    ++    I   L +++   VG D+ S + L +K + +  +I + +  ++       G+   Y +    V+ ++  ++  Y +L      RK  L ++  +HK  +++        E EQ LN    + E   IP+ +  +E   Q+ E L+ E+N + + +  +  +A  +L  D+ N+++I     +L+ +    +    ++   L  AL+ Q ++ EC++    + ++   ++S   Q   +D+         L      +  I  +V  L     +L   +P  +  I  R   + +   +L      ++  L    +   F  + ++   W+     A+  E+   DL      L +H+ ++ EI    +   ++ D G ++ +    + DA    ++  LK +D  W +L    E++ + L Q     +F ++   +    +  E ++   ++ + L +A++ I +H    + ++   E +  L +   ++ ++ + + E I +++  ++ R  K     ++  + LKDN     F  D  +   WI E   +A    Y   R+L    +   KH+  + E+  +K  +  + + G+ L   + E+ P+ ++ ++T  K     W+ LE     +   L  +     F    + +  W+          +  L +D              DL + + LL    H          +   L +    +VE V  K  + +D F   RA LN ++  L   ++   F  ++ +   W+ EK  +A S + G+DL  ++ L  +  +  K I   + R+    E    +++  +   +EI      ++  W+ L     +++A+ + +    +F     +    +    + + S+ K ++ I
Sbjct:  720 GEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPAY-SHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLN----VTE---IPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIEST--QSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTR---GQTDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKDNRDLQHFLQDCQELTLWINEKMLTAQDVSYDEARNLHSKWQ---KHQAFMAELASNKDWLDKIDKEGQQLMSEKPELEPVVREKLDTLHKL----WNDLESTTQSKAQCLFDANRAELFTQSCSALESWL-------QNLESQLQSDHYGK----------DLTSVNILLNKQQHCMLSSPFCFSQAQALGQEDANIVE-VDSKHKDVADKFSKLRAPLNKRRKLLLASKEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDILERGKSMIQDSSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEKAKDEI 1624          

HSP 10 Score: 91.6633 bits (226), Expect = 3.540e-17
Identity = 154/793 (19.42%), Postives = 336/793 (42.37%), Query Frame = 3
Query: 8802 LDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSN-MSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYL----YIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHI----QKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKD------SLWNDDPNTN 11132
            L+ +  EL  +S  +  +L E+ + +K+   +    +WI E  ++  S +YG DL S  +L  +      +++ H+  LQ    E + +I++ ++   +I E+   +  ++ ++    ++    L +A   Y+F +D      WI D ++L +  E+G         VK+H  +  EI +   +I+++ +QAR L    +    ++      LE  YE L      R   L  +    +  S+     + +++K   LN  E     +    + ++ E+L  E++  +S    ++E     ++TD +N+    ++++Q++L              K  L+  L    Y  E  E + W++ +  ++   +  G D     +L  +     + L A + K+ ++++  ++L       +  I    S I E    LKD  K R+E L  A ++  F+R+ +D   W+      ++S               D+ +D  EA   R   Q   I  ++++  A + R +  V  ++ +   ++  +          +  + + ++  WN L      +   L++    Q +L   K +  +   +   ++  E +P+ +  +E  I    +    +D+  +++  L++SG  +        + ++EK   I    +K  K   + LT  ++    N DL+ F+ +  +L  W+  NE ++ + D  S+     +   ++ H+ +M  + S K   D I ++   ++L  ++ E E + ++       LWND  +T 
Sbjct:  623 LEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELISKGHFGAGEIEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPP-AYSHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENS--IRDMQDQLNSRWNEFRKLVDQKKGALDSALDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADGHPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASE--------------DVPADLAEA--ERLLAQHEGIKNEIDHYGADYHR-VRDVGEEVTRGQTDAQYM---------FLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTE-MPSTLQAAEAAIKRHEDFLTTMDANEEKIQGLVESGRKLIEEQNVNSEKIQEKVTSIDERHKKNQKTASEVLTRLKD----NRDLQHFLQDCQELTLWI--NEKMLTAQD-VSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEG--QQLMSEKPELEPVVREKLDTLHKLWNDLESTT 1376          

HSP 11 Score: 75.485 bits (184), Expect = 2.962e-12
Identity = 52/224 (23.21%), Postives = 115/224 (51.34%), Query Frame = 3
Query: 1761 LETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRL----QELVTLMTKPSDKHDIRPERVEKL 2420
            ++++ K+++   + L     +RR+ L  +   H+  RDLE+E  W+  ++ +  + + G D  +V  LI++++  + EI  H P  + +      + +   +   EI + L  L   W  L     +R   L+++   Q++YADA +++ W+ E    ++++E   DE   QA++K+H  + + +  + +N + +L    +++V+     SD+  +R  +V+KL
Sbjct: 1456 VDSKHKDVADKFSKLRAPLNKRRKLLLASKEGHQFNRDLEDEILWVKEKMPMAISTDHGKDLPTVQLLIKKNQTLQKEILGHQPRIDDILERGKSMIQDSSLDPQEIEERLGLLKSTWEELAAEGGKRHARLEESLAAQQFYADAAEAEAWMGEQELHMMSEEKAKDEIGAQAMLKKHLVMEQALDDYADN-IHQLANSSRDMVSRGHPESDRITLRQGQVDKL 1678          

HSP 12 Score: 65.4698 bits (158), Expect = 2.926e-9
Identity = 46/212 (21.70%), Postives = 96/212 (45.28%), Query Frame = 3
Query: 1587 STDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAE 2222
            S D GK   ++  L+ KHN    ++        Q   +  + +   K      +    +E ++K + G    +  +++ R  +L++  +Y++   D  + + W+ + +++++  E GHD  S   L+++H+  E EI +H P  + L   A  L    +    E+   L  L Q +  L  + + R+  L+D+    K +++A+    WI E
Sbjct:  670 SDDYGKDLTSSLRLISKHNAFRGEMSGHRGPLQQTVAEGEELIS--KGHFGAGE----IEERIKEVKGQWTEMEALAEDRERRLREAYSYYQFQADANDAEAWILDTLRLVSTSEVGHDEYSTQTLVKKHKEIEEEILSHRPAIDALHEQARGLPPA-YSHSPEVDGRLPALEQRYEELVALAAHRKQALQDSLALHKMFSEADACLLWIDE 874          

HSP 13 Score: 63.1586 bits (152), Expect = 1.465e-8
Identity = 66/276 (23.91%), Postives = 126/276 (45.65%), Query Frame = 3
Query: 1587 STDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTL-ETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSL-----DFLSQGWTNLERIKSERRNLLKDAYECQKYYADA-------EDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTK 2375
            S +  K  + A+ +L+KH +++  L   +D  +Q+   SRD +    S+      R TL + Q+  L      L +++++R+ +L+++    +L RD+E+ ++W+S    V  + E G DY  V  L  +   +  + S       + ++ A++L     I  G    +      D L++ W +L  +   R  +L  +YE  ++Y DA       +D Q+ I E        E G D    +A+ + HTA   +I       +K++QE  + + K
Sbjct: 1616 SEEKAKDEIGAQAMLKKHLVMEQALDDYADNIHQLANSSRDMV----SRGHPESDRITLRQGQVDKLYA---SLKDLAEERQGKLQEHHRLCQLKRDVEDLEHWISEREVVAASHELGQDYEHVTMLRDKFREFSRDTSN----IGQERVDAVNLMADDLISSGHSENATVADWKDQLNEAWADLLEMIDTRSQMLAASYELHRFYQDAKETLGQIQDKQKQIPE--------ETGRDLNTAEAMQRMHTAFEHDIQALSAQ-VKQVQEDASRLQK 1871          

HSP 14 Score: 62.7734 bits (151), Expect = 1.732e-8
Identity = 78/398 (19.60%), Postives = 172/398 (43.22%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQA--DSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQELVTLMTKPSDKHDIRPERVEK 2417
            W++E    LN       +++ E    + E +  E+N    R   + E+A  L + +  ++++I      + +RW + + L++ K+   DS  L      L    T+    +  K   ++  LG        L  K   ++  LKA+  +   +  ++    D        P +   +  +L ++      L +  ++R E L +       +RDL++ ++WLS     + +++   D A   RL+ +HE  ++EI  +   +++++    ++++ Q   D +   + + L  L  GW  L ++   R  LL   +  Q++  D +  + ++     ++ + E  +   A +A IKRH   L  +   EE    ++Q LV    K  ++ ++  E++++
Sbjct:  871 WIDEKEQWLNVTEIPEKLEDLEVVQQRFETLEAEMNNLASRIASVNEVAGQLLTTDQRNENSIRDMQDQLNSRWNEFRKLVDQKKGALDSA-LDIQNYHLECNETVCWMREKTKVIESTQSLGNDLAGVTALQRKLTGMERDLKAIQGKVGDLRSEAEKLADG------HPQKAPAIIGRLSDIDETWGELKDTMKRREETLGEASKLQGFLRDLDDFQSWLSRAQTAVASEDVPADLAEAERLLAQHEGIKNEIDHYGADYHRVRDVGEEVTRGQ--TDAQYMFLQQRLKALDTGWNELGQMWENRHQLLSQGHSFQQFLKDTKQVEGFLNNQEYVLSHTEMPSTLQAAEAAIKRHEDFLTTMDANEE----KIQGLVESGRKLIEEQNVNSEKIQE 1255          

HSP 15 Score: 60.077 bits (144), Expect = 1.223e-7
Identity = 56/251 (22.31%), Postives = 115/251 (45.82%), Query Frame = 3
Query: 1593 DLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLD---------FLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            + G    A +  L KH  ++  + A S+R   +N  +    D L+++N   D R+ L  +  N+    + L E+   RR++L  N    ++ +DL    +W  +    + +++ G     V  L++ H + E++I+         ++ ++     +F+ + E +K  D          L Q +  L  + + RR+ L+++    K++ D  + + WI E   L+L+ + G D  ++  LI +H A   E+S
Sbjct:  456 NFGVDLTAVEAALRKHEAIETDILAYSERVQAVNAVA----DELEAENYH-DVRRILARKC-NVIRLSDYLRELVTARRQRLHMNLELQRMFQDLHYLMDWTEDMKGRLQSEDYGKHLHGVEDLLQTHTLVEADIAVQAE-----RVKSVTAVAQKFMTEDEGYKPCDPELVRNRVHLLEQRYAELCNLSAARRSKLEESRRLWKFFWDMGEEEAWIREQSRLLLSDDYGKDLTSSLRLISKHNAFRGEMS 695          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 543.117 bits (1398), Expect = 1.297e-155
Identity = 311/767 (40.55%), Postives = 481/767 (62.71%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-----DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP-IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER   +  +A  LE+ NYH    I+ R  ++   W+ L +L+ ++     +L   +++        M +     D +K  + S D GKH L  +DLL+KH LV+  +   +DR   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + +++++ + G D  SV+RL  +H+ +E E+S     +   +K     +++  F  + +I + +  + + W NLE + + R+  L+D     ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+
Sbjct:   37 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKAR-----RLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRF--ATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSE-KIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIA 795          

HSP 2 Score: 269.626 bits (688), Expect = 3.485e-71
Identity = 254/1164 (21.82%), Postives = 550/1164 (47.25%), Query Frame = 3
Query: 2913 YDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDL-ESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKAD---RQINSV 6350
            ++  +++ + + + + + EL  LAR RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +   LI S  P  E++I+               + K++ R       W +  +L    + +L  A SI  ++   +E +  I +K  ++ +   +G D      L+RK   + RD+ AI++++   +   + ++  +P +   + +++ EI++++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EIN  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q F ++  Q E+ ++ Q   L       +++  E A+KT  +    +D  + ++ ++  + R+     N +S+KI  + D +  +  K         + L+++ E  KF ++  ELS WI++K+L   + +Y +  NL  K  KH+A  AE+ SN   L+KI   GN LI      +  VK+ +  +   W++L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE++++ + + + +L+ +A  ++++G      D +  + E+R +EL    L PL N+R   L  + + HQF  DV+ E+ W+EE  P AT  D+G +L     L  K++ L  EI GH+    ++ E  K +  + S +  + +  R   L+  W  L ++ + R  +L+ S   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+  Q       E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV + N  A+ L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +    +   W+ L++  + + L+L    D    +  +++ + ++ ++  Q++A    R ++SV
Sbjct:  816 FNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPS-EKEIK-------------AQQDKLNTR-------WSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIEL----LAPL-NERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGH-----PE-SERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSV 1946          

HSP 3 Score: 244.202 bits (622), Expect = 1.879e-63
Identity = 346/1589 (21.77%), Postives = 688/1589 (43.30%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANH---SIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRS-------ISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEK--------LMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVEDVRSRKLLKKQASA 11282
            +++  DL    +L  KH+ F   +S    R   L   I   +EM    HF  + I     D  ++   L       + +L +         ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ +    + L  ++A L   +   S + +  +  I E++ +L   ++ R  AL++A  L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    I+++   + +RW   +  ++  K+ L+ A  + NY+ E       I+++ K+++  ++ G+D+  V  L+RK  G+ERDL A+  K   L++  +    L+A H   +  I  +  EI +  E++    K R + L  + +  + ++D         +    I     PN    A   L  H+ +K  +NN +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQ+ L+   Q H +        Q  L   K+ +  LNN + +    ++  N++A  +         + + A E+K    ++++   +L    ++D  +   K +  +D   S ++K        LMR    L   +E+Q+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LI+E   +   + EK+  L    +EL++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  ++  K++++ ++ +A  +  E    T ++  Q  ++  RF++L   L      L  ++ +++F+ DV  E+ W++++M LA   + G +L      +K++ TL  EI       + I ++++ + D +    + I     +L+  +  L    E+R  +L  +   QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS KTS       +   E +   Q+++ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + ++ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A + +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y+    + +  H     K +              +++ +F  + +  E+WL   E  + S   +  +SV E+E+  K HE + K   +   +F A++R T +  L           + S   DDP T +     +     +  N S  + +S  +  P+     D +S+  ++ Q +A
Sbjct:  665 DDYGKDLTSVVRLYCKHKAFEDEMS---GRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQ-SLVKKHKDVAEEIANYRSTIDALHEQAAAL-PEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLIHS---GHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAE---KLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQSLLS---QSHAY--------QLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKI--NAVVDTGRRL----VNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR----LKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKS-TDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLS-KTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSV----------NHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYL----QCRSMHTVPKPKALSQKPV---------LEVHQFSRDASVAEAWLFGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNS-TRCSFTADDPETAM----AENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAA 2140          

HSP 4 Score: 109.383 bits (272), Expect = 1.306e-22
Identity = 166/825 (20.12%), Postives = 341/825 (41.33%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHD------CGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSN-EFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLV 6434
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RV ++    R+ E +   D ++I  R D V+     L      +++ LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++        G +  K   P+   ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L  KH   E E+  +  +L +  ++  EM  + HF  E I + I+ ++ + A L  L   R   L+D    +QF  D D    W+ +     + +D G        L  KHK +  EI  ++  +  L E    L  E       DV+ R   +++ +  L + A  RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++    +   + ++A   K N     +  FR  ++  ++AL +     N+  E +E ++WI EK K+ +S  E G DL  +  L+ +     + +   E ++    + A +L      +++ I     ++ + W+ + T    +      A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++++      K++    +     +D     + + +  L+  W +L +    +   L     Y +     K++ AFLN     +      N++ AA  AI+  + F  ++   E  +  +V
Sbjct:  425 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQ--VIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEE--RFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLN---TRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLAEAEKLLTQH----ENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVV 1230          

HSP 5 Score: 104.375 bits (259), Expect = 4.860e-21
Identity = 201/1043 (19.27%), Postives = 424/1043 (40.65%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEAN-LDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI----NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHE-WDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   +   LE    +    +    + + +++   +L   + G      E+L +K   +  DI        A+ +  +RF   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV     + +  + E++    + L  +K    ++ +D      I   +  + ++  +L+     R K L+D   + +F  + D +++       I+S  +   D  + Q  V   ++  +  AN  + ID +  +  +L + +       +S  + NR   + ++  +L      +K  L++ L   K    A+    WI      +E+E + +   +PEKL+       + ++LE E+ +  S +  ++     LI   HP +  +K     ++ +W +     +  +  L  A    +   E NE  + I  K   +E    T +LGNDL    +L  K   +E +L      L  L+++A ++  +     + I+D + ++     ++   +  R  +L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EIN ++     + + G+ + +  +      +  R +AL   W+ L K  ++R+  L  S   + FL D         +   ++N  +  L + ++ N +   ++       + T +       N   DT R++    N+  + +E   +K +      +  RA  ND    L++ ++   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +  NQL+ ++   +E I   +    H  W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    +++  K +++++   A  L
Sbjct:  458 VEAATKKHEAIETDIAAYEERVLAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERF------NSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWI------VEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIES---TQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRD-------TKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIE---EKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLI-AEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQAL 1447          

HSP 6 Score: 89.3521 bits (220), Expect = 1.914e-16
Identity = 204/1060 (19.25%), Postives = 435/1060 (41.04%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRD----IESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTI--------VCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPE---------ADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERD-------LNALNEKFAKLRQ----AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTE-LINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEI---LEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLI-SENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMS 9707
            V  +NF  DL   E    KH     +I+  ++RV A+      L+   + D   I +  D+ ++  + L +  +     +E  L  Q+++  +L   D    W+DE    + + D   + L  +  LLQK+  + A+I+        +   +    T      E +K          V ++   + +L   + +R + L+E++ L  FF E+   E W REKE ++S+++ G DL   + L  K           +A  D ++  +  LLQ  TI   E         ++ IR R K I+ +W  L++     K RL +    + +  +   +   + D L++V   D G D  S + L +K   +  +       ++AL+E+ A L +    + D+ + L              I++  ++LA L + R   L  +   +K+  +A A C++ + + E  +N    P   +         + L+  MNN+  +   +  + R+L      + S   S+ E +    D+LNT        V +T++A       L+  + +  +   C   + W+  + K    ++ + + L    D+   +  +R ++ +   R+   ++  L ++    EKL  +     +    +   + + +  +   L    + L    +LQ+  + ++D  +W+ R +  IAS+            + +H    +E+   E D Q   D G+ +   +  A  + + +++  LD    EL  M + +   L ++     + R  +   +++N  E +       N+L + E   + Q D    +++ +E++ ++ +    ++N+ N  +  I E+   I++R  +      +    L D   + +F  D      WI +KM  A       +     +++K H   M+E+A+  + ++ I+K+   L       +  ++ + + L   +E L +  + +  +L      + F     +++  L+     + + + G D  S   L+KK + L  ++D+      +L  +   +S
Sbjct:  446 VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMD----WMDEMKVLLLSQDYGKHLLGVE-DLLQKHALVEADIAIQADRVRAVNASAQRFATG----GEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCK----------HKAFEDEMSGRSGHLLQ--TIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSG------------IEERYKELAELARLRKQALQDALTLYKMFSEADA-CELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQL------IHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDA-------LSSALSIQNYHLECNETKSWIREKTK----VIESTQELGN--DLAGVMALQRKLTGM--ERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLK-HQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALS 1448          

HSP 7 Score: 87.4261 bits (215), Expect = 7.205e-16
Identity = 189/959 (19.71%), Postives = 399/959 (41.61%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA----SSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIR----ESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKD---------------HIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHI---QKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++ +  +++ +  +L  +   DIK    +  +VI  +  L E L      L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    +++      ++A     +R  +            I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E E+I  S +YG DL SV +L  +    E +++     L    +E + MI E+++ +  IRE+   I  ++  L          L D    Y+F +D      W+ D +++ +  ++G         VK+H  +  EIA    +I+++ +QA  L +   F    ++   + +E  Y+ L      R   L       +  S+    E+ + +K   LNN +     +    +  + ESL  E++ ++S    +++    +        KE +K  Q+KL              K+ L+  L I+    E  E  +WI+ +  ++   +E G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I      +K   K R+E+L  A ++  F+R+ +D   W+                             +T+  I+ E          + N  A+ E+ L    +Q E   NE N  +E Y   +D                +  + + ++  WN L      +++ L+++   QL+L   K   ++   +   +   E LP ++  +E  I    +    +D+  +++N ++ +G  + +        +EEK + I    K  +   ++L  R    + N +++KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E I K+ +
Sbjct:  455 LPAVEAATKKHEA---IETDIAAYEERVL--AVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEER-FNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKE-IKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLS----------------------------RTQTAIASE---------DMPNTLAEAEKLL----TQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTE-LPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMR---LKDNREMQKFLQDCQELSLWI--NEKMLTARD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGN--QLIAEKPETEAIVKEKM 1356          

HSP 8 Score: 81.2629 bits (199), Expect = 4.861e-14
Identity = 184/955 (19.27%), Postives = 403/955 (42.20%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINL----VEANLDKLKSLASIVLKDRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLL---KNISHNTNGFKDTCRKINVLPELVE--AVTKKFNETSDNFESFRASLNDKQNALENCQDFLN-------FQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQE--DMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R+     +   ++     ++  +  +   +  L+  L   L+ R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    V A     +  A+     +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +      D+ + ++ +    AF D++  R   L +   E      + +  SEKI  R   + ++   L      +K  LE+     +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +  S+++ +H+    L +      D V++ L  I+E++K+L      +++ L  A +    F+E  A  L   +  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++   GH  ++ I  +  KL  R ++   LV++    L   L    +  + ++   WI E+ +   +  + G  L   + L  K   +  ++   +  + +L +  + L+ E  P   + +  R   + + W+ ++    +R+  L  ++  +QFL D +D   W++     +  + +D+ N                LA  + LL   +NI +  N +++  +K+  + E+V       ++       ++     N+     EN Q  L+       F  +  + EA+++ ++ +    E   +L+  E         + +++  E+++    +   +L+  +N  S++I    +  D +H+ +R    A+    +     E+ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I    N+L  + P    ++ E++  L+ +W++L
Sbjct:  440 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYG---KDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTD-VQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEK-EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAE-HPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAI--ASEDMPN---------------TLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNR--AGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEEL 1366          

HSP 9 Score: 78.1814 bits (191), Expect = 3.926e-13
Identity = 85/405 (20.99%), Postives = 181/405 (44.69%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDM---KRLQELVTLMTKPSDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++    L +    ++  +  + S +   W++L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q+        ++  +++      KS +    QRQ +E +   L   +N       +R++ L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  L+++++  + EI  H      IF + K+   D S    +    I + L  L   W+ L     +R   L++++  Q+YY D  +++ W++E    ++++E   DE +  +++K+H  L + +  + E      K  + LV      S++  +R  +V+KL
Sbjct: 1291 WINEKMLTARDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALSQEGKSTDEVDGQRQVVEVRFIELLAPLN-------ERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSS----LNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKL 1679          

HSP 10 Score: 61.6178 bits (148), Expect = 3.814e-8
Identity = 78/381 (20.47%), Postives = 170/381 (44.62%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLIN-SKQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE 2330
            K   +A   E W+ E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  + + S+  I  +   +  RW + ++L++ +K A S  L+     L    T     +  K   ++ +LG        L  K   ++  L A+  +   +  ++    + L++++  PDQ Q +  +L  ++     +    + R E L +     + +RDL++ ++WLS     + +++  +  A   +L+ +HE  ++EI+ +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R++LL  ++  Q +  D + ++ ++     ++ + E  N+  A +A IK     +  +   EE
Sbjct:  854 KMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEA----EKLEAEH--PDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEE 1224          

HSP 11 Score: 55.4546 bits (132), Expect = 3.278e-6
Identity = 77/390 (19.74%), Postives = 169/390 (43.33%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP--IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  + K + +  EI   + R   + E +  +  ++  + +AI+ R +D+Q  W  L +    +     ++   +  +             E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   Q+  L     GL ++S++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  + + H+     + +   A DL  +       I +  D L++ W +L  +   R  +L  ++E  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1490 QFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQS---QVDKLYA---GLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARD-TGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1865          

HSP 12 Score: 55.0694 bits (131), Expect = 4.145e-6
Identity = 93/450 (20.67%), Postives = 190/450 (42.22%), Query Frame = 3
Query: 2904 ELHYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE--GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQ-WEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTE-VNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNIT------SALGRLDD-KMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL 4220
            E H + E I  +Q++++KL+  LK L+  R+  L+      Q  +E D   +++  +E     ++ G     +  +++++     + A ++G I      +  + S++ M ++ I    +          D + ++  +K+ +N+ W  L +L   + + L  +  +  F     E+   I  K   L ++ +G D+ + E L+R       DI A+ +++ + +     ++  Y  +  + + ++  E+ + +  L +A + R+  L + G+  +F +  ++    + ++   IE Q  P+DVSSVE  +   + +K EI                   D  NDS  T      S L R    + +S+      +    K  LE  +F ++    E+ +  Q   L S     SVD+VE  +K H          D R  +L +  T L
Sbjct: 1661 EGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR----EFARDTGHIG-----QERVDSVNHMADDLINSGHS----------DAATIAE-WKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEE-LGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEI-------------------DARNDSFTTCIELGKSLLARKHYLQCRSMHTVPKPKALSQKPVLEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVL 2070          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 554.673 bits (1428), Expect = 2.588e-160
Identity = 311/762 (40.81%), Postives = 483/762 (63.39%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEIS 2318
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEIT 794          

HSP 2 Score: 273.863 bits (699), Expect = 1.465e-72
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  +++ + A + +   E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL ++R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  814 HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHNGHPSEK-EIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-SERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 3 Score: 271.552 bits (693), Expect = 6.412e-72
Identity = 337/1497 (22.51%), Postives = 661/1497 (44.15%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARD-LEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L    H +S + K  +  I E+  ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    IR++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+         +VT            TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I +++++ + D +    + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A
Sbjct:  664 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ-SLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHN---GHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMG-------EMVTQG---------QTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNREAASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 4 Score: 154.451 bits (389), Expect = 2.585e-36
Identity = 331/1730 (19.13%), Postives = 714/1730 (41.27%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSI---KISLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSI---SSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E     +K +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ +D   D     + + K K +  ++  Y   +  +    +       +   +   +  + ++  E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ + +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  +++  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V      L  + E              +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R     +  +      TV     E++     D  +   +AE K   + + ++ L E +    Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK-IRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQ----EGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAE--------------ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT---IAEWK-DGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2068          

HSP 5 Score: 132.494 bits (332), Expect = 1.112e-29
Identity = 328/1668 (19.66%), Postives = 685/1668 (41.07%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE-----GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M   +      D+   G     +E + +K+  +  D+A  + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      +D L   AS + +      ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L  N  P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L  +   +    ++ +  ++ D   +  + A +   +L  + + ++FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   S++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      N++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  493 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDY---GKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD-GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2074          

HSP 6 Score: 125.561 bits (314), Expect = 1.463e-27
Identity = 305/1517 (20.11%), Postives = 621/1517 (40.94%), Query Frame = 3
Query: 6678 TEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHRE-FVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
             E LL KH     +I++  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS+N++G D     SL  K  +           ID + + A+ L Q       E+ +++ R   I  R   +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q A  +  N    H       +KEI           + + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +  +    K +E F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  +   E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  NN ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D    RR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+     +++    F A
Sbjct:  563 VEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ----AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHN---GHP-----SEKEI-----------RAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTA 1969          

HSP 7 Score: 108.997 bits (271), Expect = 1.476e-22
Identity = 145/705 (20.57%), Postives = 295/705 (41.84%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKK----DAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI--NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDD 6110
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + ND G        L  KHK +  EI  ++P +  L E    L +  +     DV+ R   +++    + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++  N  P   E +  + ++ +  +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+
Sbjct:  424 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ--AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDN 1113          

HSP 8 Score: 97.0561 bits (240), Expect = 5.389e-19
Identity = 248/1289 (19.24%), Postives = 523/1289 (40.57%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDI--DDNLDANHSIKISLKQK--EIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKT------------------LMNNRKIKENRIMD------------------LCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVI----LNNLKSLSTVEDVTENIDAKR--------------------------SISSLVSAREQKTV-----KGSLLEILEKLRKDQISDIKLA------EGKYKSVIDG--------FSSLNEKLM-RIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE-IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLIS-VEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATR---------AQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNK-------LVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDW 10178
            V  N+   D   T+ L+ KH++ A  I+     +  L      L +  H +  ++        +R +++ +  R  +  L +      +  E+D    W+DEK Q +  + +    LE+   +  ++++L  E++        +   + +L+ N HP  +E +     +  +W Q      ++  AL  A  +  +  E +  ++W REK  ++ S  +LG+DL   M+LQ KLT         EA++  + + A +L   ++    +A  I SR   I   W+ +K  L+  +  L EA KL  +  +L      +      +  +D  + +   EKL  +   I+ +++   E + K+R   ++      DA +   + L+Q+   +     +L  + + R + L+ S+ Y + ++D K        Q  ++  +  P   + A  A+K  ++  T                  L+++  I  +RI +                  L  +LK++R++       Q  S+   +  L T Q+      +   + W K Q  + E      +L+  E E   L+++  + + +    L  L  +  V + T    A+R                           I S    ++  +V     K  +LE   ++RK +I +++        EGK    +D         F  L E L  R H +L+S KE+ + ++ VED I W+  +M +A+  ++   +  +   +KK++    E++ ++P I    +  + +I+++ + + E I +++ DL      L   ++ + +RL E  K  ++        +W++E E    S     D  S V  LK+ Q+ +E  +  + E +  + + +  ++ +++  +  I  + + ++  +  L +  +     L +   L++ + +V     WI ++  +A   E+G           +HVT++ E              + ++++   A +L +  H     I   +  L  ++  L    + R   L A+    +F  D  EI  R+ DK   L   E G D+ +   L +   +   +I    +   +L E  + +   Y     + ++  +N+       L++  E    + +   +   ++  +R+   ++ W+++    +  +E  +D      L+         ++A  +       +GK L+  K+  S EI+     +TE+   + D ++ R E L+  LEVH F R+A+    W
Sbjct:  767 VSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ-AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNM-QIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL---ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQY---MFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKML-TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLAS-KEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQI-LEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDY--------EHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPE-ELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRD---LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAW 2032          

HSP 9 Score: 90.8929 bits (224), Expect = 3.898e-17
Identity = 190/949 (20.02%), Postives = 405/949 (42.68%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EI     +I+++ +QA  L  + H     ++     +E   + +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +  +     KE ++  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  454 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKH----ALVEADIA-IQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1355          

HSP 10 Score: 90.5077 bits (223), Expect = 5.735e-17
Identity = 192/1039 (18.48%), Postives = 419/1039 (40.33%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +    +    + + +++   +L   + G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +   N    ID +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  ++     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+  +      +      +   W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  457 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAE---SPD---VKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1446          

HSP 11 Score: 86.2705 bits (212), Expect = 1.056e-15
Identity = 87/405 (21.48%), Postives = 187/405 (46.17%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  L+E    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A++ Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1290 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLSE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSS---LNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1679          

HSP 12 Score: 84.3445 bits (207), Expect = 3.626e-15
Identity = 180/957 (18.81%), Postives = 391/957 (40.86%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +++ +H+  + L  + H +   VK  L  I+E+ K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++  +GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W+ L
Sbjct:  439 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVL 1365          

HSP 13 Score: 77.411 bits (189), Expect = 5.624e-13
Identity = 361/1857 (19.44%), Postives = 752/1857 (40.50%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSE---EIASLQEDMQH--EWDRLLTFASQKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKI-KYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI-SVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDD---NLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  SN+ G D    + L  +     + I      + T +E A+ L ++     +    +A ++E  +   E  RL     +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I +  +D  K   +     +      Y  +            +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +     + D   S +++++ K     +E L  L++++ + L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NI+T S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +    +    LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  +     L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  285 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRL-----RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTK----FMELLEPLSERKHNLLA-SKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIITDSSSLNAEAIRQ---RLADLKQLWGLLIEETE----KRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2062          

HSP 14 Score: 64.3142 bits (155), Expect = 5.193e-9
Identity = 78/369 (21.14%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  N + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  853 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1211          

HSP 15 Score: 55.4546 bits (132), Expect = 2.239e-6
Identity = 76/394 (19.29%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   + +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1489 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1865          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 555.058 bits (1429), Expect = 2.306e-159
Identity = 311/764 (40.71%), Postives = 484/764 (63.35%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNY 796          

HSP 2 Score: 283.878 bits (725), Expect = 1.398e-75
Identity = 389/1756 (22.15%), Postives = 752/1756 (42.82%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARD-LEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVEDVRSRKLLKKQASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLT----QHEVPLLSDNIRNATITVPESYKKRNFVIHVK 11798
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L    H +S + K  +  I E+  ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    IR++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I +++++ + D +    + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A++R T LE L  +R+++E   K    + DPNT +      + +     +     G     +P                  A  G              S  +A   E    +N   +  T +K    V S       P     + S L  +S  +  +  L T +          AQ  G + RK    +   KA+ RSW   Y  ++   + +YKD  +  +      EVP+   +++ A   V   YKK+  V  ++
Sbjct:  664 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ-SLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHNGH---PSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNREAASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKGDQVSQNG-----LP------------------AEQG--------------SPRMAGTMETSEMVNGAAEQRTSSKESSPVPS-------PTLDRKAKSALPAQSAATLPARTLETPA----------AQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPV---SLKEAICEVALDYKKKKHVFKLR 2277          

HSP 3 Score: 275.018 bits (702), Expect = 6.317e-73
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  +++ + A + +   E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL ++R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  814 HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHNGHPSEK-EIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-SERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 4 Score: 157.532 bits (397), Expect = 2.742e-37
Identity = 328/1730 (18.96%), Postives = 715/1730 (41.33%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSI---KISLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSI---SSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E      + +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ +D   D     + + K K +  ++  Y   +  +    +       +   +   +  + ++  E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ + +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  +++  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R     +  +      TV     E++     D  +  +  +G    + + ++ L E +    Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE-EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQE----GKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDG----LNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2068          

HSP 5 Score: 134.035 bits (336), Expect = 3.443e-30
Identity = 328/1668 (19.66%), Postives = 685/1668 (41.07%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE-----GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M   +      D+   G     +E + +K+  +  D+A  + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      +D L   AS + +      ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L  N  P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L  +   +    ++ +  ++ D   +  + A +   +L  + + ++FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   S++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      N++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  493 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDY---GKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD-GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2074          

HSP 6 Score: 130.954 bits (328), Expect = 3.377e-29
Identity = 305/1517 (20.11%), Postives = 621/1517 (40.94%), Query Frame = 3
Query: 6678 TEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
             E LL KH     +I++  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS+N++G D     SL  K  +           ID + + A+ L Q       E+ +++ R   I  R   +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q A  +  N    H       +KEI           + + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  +   E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  NN ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D    RR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+     +++    F A
Sbjct:  563 VEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ----AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHN---GHP-----SEKEI-----------RAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTA 1969          

HSP 7 Score: 108.997 bits (271), Expect = 1.566e-22
Identity = 166/818 (20.29%), Postives = 339/818 (41.44%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI--NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIE-YANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESL-ANHETV 6419
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + ND G        L  KHK +  EI  ++P +  L E    L +  +     DV+ R   +++    + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++  N  P   E +  + ++ +  +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+      K++    +     +D     + + +  L+  W +L + + N++ L L     Y       K++ AFLN     +       ++  A  AI+  + F  ++ AN E +
Sbjct:  424 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ--AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNL-LSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI 1225          

HSP 8 Score: 100.138 bits (248), Expect = 6.262e-20
Identity = 247/1289 (19.16%), Postives = 525/1289 (40.73%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDI--DDNLDANHSIKISLKQK--EIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKT------------------LMNNRKIKENRIMD------------------LCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVI----LNNLKSLSTVEDVTENIDAKR--------------------------SISSLVSAREQKTV-----KGSLLEILEKLRKDQISDIKLA------EGKYKSVIDG--------FSSLNEKLM-RIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE-IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLIS-VEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATR---------AQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNK-------LVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDW 10178
            V  N+   D   T+ L+ KH++ A  I+     +  L      L +  H +  ++        +R +++ +  R  +  L +      +  E+D    W+DEK Q +  + +    LE+   +  ++++L  E++        +   + +L+ N HP  +E +     +  +W Q      ++  AL  A  +  +  E +  ++W REK  ++ S  +LG+DL   M+LQ KLT         EA++  + + A +L   ++    +A  I SR   I   W+ +K  L+  +  L EA KL  +  +L      +      +  +D  + +   EKL  +   I+ +++   E + K+R   ++      DA +   + L+Q+   +     +L  + + R + L+ S+ Y + ++D K        Q  ++  +  P   + A  A+K  ++  T                  L+++  I  +RI +                  L  +LK++R++       Q  S+   ++++ T Q+      +   + W K Q  + E      +L+  E E   L+++  + + +    L  L  +  V + T    A+R                           I S    ++  +V     K  +LE   ++RK +I +++        EGK    +D         F  L E L  R H +L+S KE+ + ++ VED I W+  +M +A+  ++   +  +   +KK++    E++ ++P I    +  + +I+++ + + E I +++ DL      L   ++ + +RL E  K  ++        +W++E E    S     D  S V  LK+ Q+ +E  +  + E +  + + +  ++ +++  +  I  + + ++  +  L +  +     L +   L++ + +V     WI ++  +A   E+G           +HVT++ E              + ++++   A +L +  H     I   +  L  ++  L    + R   L A+    +F  D  EI  R+ DK   L   E G D+ +   L +   +   +I    +   +L E  + +   Y     + ++  +N+       L++  E    + +   +   ++  +R+   ++ W+++    +  +E  +D      L+         ++A  +       +GK L+  K+  S EI+     +TE+   + D ++ R E L+  LEVH F R+A+    W
Sbjct:  767 VSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQA-HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNM-QIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL---ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQY---MFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLW-INEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLAS-KEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQI-LEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDY--------EHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPE-ELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRD---LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAW 2032          

HSP 9 Score: 93.5893 bits (231), Expect = 7.169e-18
Identity = 190/949 (20.02%), Postives = 405/949 (42.68%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EI     +I+++ +QA  L  + H     ++     +E   + +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +  +     KE ++  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  454 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKH----ALVEADIA-IQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1355          

HSP 10 Score: 90.8929 bits (224), Expect = 4.502e-17
Identity = 192/1039 (18.48%), Postives = 419/1039 (40.33%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +    +    + + +++   +L   + G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +   N    ID +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  ++     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+  +      +      +   W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  457 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAE---SPD---VKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1446          

HSP 11 Score: 87.0409 bits (214), Expect = 7.054e-16
Identity = 87/405 (21.48%), Postives = 187/405 (46.17%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  L+E    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A++ Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1290 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLSE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSS---LNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1679          

HSP 12 Score: 84.7297 bits (208), Expect = 3.415e-15
Identity = 180/957 (18.81%), Postives = 391/957 (40.86%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +++ +H+  + L  + H +   VK  L  I+E+ K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++  +GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W+ L
Sbjct:  439 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVL 1365          

HSP 13 Score: 80.1073 bits (196), Expect = 9.151e-14
Identity = 361/1857 (19.44%), Postives = 752/1857 (40.50%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSE---EIASLQEDMQH--EWDRLLTFASQKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKI-KYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI-SVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDD---NLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  SN+ G D    + L  +     + I      + T +E A+ L ++     +    +A ++E  +   E  RL     +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I +  +D  K   +     +      Y  +            +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +     + D   S +++++ K     +E L  L++++ + L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NI+T S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +    +    LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  +     L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  285 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRL-----RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTK----FMELLEPLSERKHNLLA-SKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIITDSSSLNAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2062          

HSP 14 Score: 64.3142 bits (155), Expect = 4.317e-9
Identity = 78/369 (21.14%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  N + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  853 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1211          

HSP 15 Score: 56.225 bits (134), Expect = 1.518e-6
Identity = 76/394 (19.29%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   + +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1489 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1865          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 555.058 bits (1429), Expect = 2.306e-159
Identity = 311/764 (40.71%), Postives = 484/764 (63.35%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   36 SARLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNY 796          

HSP 2 Score: 283.878 bits (725), Expect = 1.398e-75
Identity = 389/1756 (22.15%), Postives = 752/1756 (42.82%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARD-LEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSLWNDDPNTNIKRRETQKVYQEQNANDSLHRGNSGSKIPPVKPVVEDVRSRKLLKKQASAGQLDIQPTFIRPIKFSTAIADIDEEDTKINSMEDVFTLAKVVKHVTSFSTKKRDPLKRSNSSSDLEIESQGSTNSDILRTCSAEAPSSTTQKAQFSGPVTRKQVLTSKGMKAAVRSWKPYYAALDGHGLNYYKDKIALLT----QHEVPLLSDNIRNATITVPESYKKRNFVIHVK 11798
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L    H +S + K  +  I E+  ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    IR++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I +++++ + D +    + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A++R T LE L  +R+++E   K    + DPNT +      + +     +     G     +P                  A  G              S  +A   E    +N   +  T +K    V S       P     + S L  +S  +  +  L T +          AQ  G + RK    +   KA+ RSW   Y  ++   + +YKD  +  +      EVP+   +++ A   V   YKK+  V  ++
Sbjct:  664 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ-SLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHNGH---PSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNREAASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKGDQVSQNG-----LP------------------AEQG--------------SPRMAGTMETSEMVNGAAEQRTSSKESSPVPS-------PTLDRKAKSALPAQSAATLPARTLETPA----------AQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPV---SLKEAICEVALDYKKKKHVFKLR 2277          

HSP 3 Score: 275.018 bits (702), Expect = 6.317e-73
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  +++ + A + +   E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL ++R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  814 HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHNGHPSEK-EIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-SERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 4 Score: 157.532 bits (397), Expect = 2.742e-37
Identity = 328/1730 (18.96%), Postives = 715/1730 (41.33%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSI---KISLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSI---SSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E      + +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ +D   D     + + K K +  ++  Y   +  +    +       +   +   +  + ++  E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ + +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  +++  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R     +  +      TV     E++     D  +  +  +G    + + ++ L E +    Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAE-EHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQE----GKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDG----LNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2068          

HSP 5 Score: 134.035 bits (336), Expect = 3.443e-30
Identity = 328/1668 (19.66%), Postives = 685/1668 (41.07%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE-----GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M   +      D+   G     +E + +K+  +  D+A  + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      +D L   AS + +      ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L  N  P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L  +   +    ++ +  ++ D   +  + A +   +L  + + ++FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   S++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      N++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  493 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDY---GKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD-GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2074          

HSP 6 Score: 130.954 bits (328), Expect = 3.377e-29
Identity = 305/1517 (20.11%), Postives = 621/1517 (40.94%), Query Frame = 3
Query: 6678 TEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
             E LL KH     +I++  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS+N++G D     SL  K  +           ID + + A+ L Q       E+ +++ R   I  R   +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q A  +  N    H       +KEI           + + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  +   E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  NN ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D    RR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+     +++    F A
Sbjct:  563 VEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ----AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHN---GHP-----SEKEI-----------RAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTA 1969          

HSP 7 Score: 108.997 bits (271), Expect = 1.566e-22
Identity = 166/818 (20.29%), Postives = 339/818 (41.44%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDA----VKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI--NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLK----IKYPNNSD----LIVEEIDNLNYLWQQLIE-YANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESL-ANHETV 6419
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + ND G        L  KHK +  EI  ++P +  L E    L +  +     DV+ R   +++    + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++  N  P   E +  + ++ +  +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+      K++    +     +D     + + +  L+  W +L + + N++ L L     Y       K++ AFLN     +       ++  A  AI+  + F  ++ AN E +
Sbjct:  424 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ--AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNL-LSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI 1225          

HSP 8 Score: 100.138 bits (248), Expect = 6.262e-20
Identity = 247/1289 (19.16%), Postives = 525/1289 (40.73%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDI--DDNLDANHSIKISLKQK--EIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKT------------------LMNNRKIKENRIMD------------------LCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVI----LNNLKSLSTVEDVTENIDAKR--------------------------SISSLVSAREQKTV-----KGSLLEILEKLRKDQISDIKLA------EGKYKSVIDG--------FSSLNEKLM-RIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE-IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLIS-VEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATR---------AQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNK-------LVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDW 10178
            V  N+   D   T+ L+ KH++ A  I+     +  L      L +  H +  ++        +R +++ +  R  +  L +      +  E+D    W+DEK Q +  + +    LE+   +  ++++L  E++        +   + +L+ N HP  +E +     +  +W Q      ++  AL  A  +  +  E +  ++W REK  ++ S  +LG+DL   M+LQ KLT         EA++  + + A +L   ++    +A  I SR   I   W+ +K  L+  +  L EA KL  +  +L      +      +  +D  + +   EKL  +   I+ +++   E + K+R   ++      DA +   + L+Q+   +     +L  + + R + L+ S+ Y + ++D K        Q  ++  +  P   + A  A+K  ++  T                  L+++  I  +RI +                  L  +LK++R++       Q  S+   ++++ T Q+      +   + W K Q  + E      +L+  E E   L+++  + + +    L  L  +  V + T    A+R                           I S    ++  +V     K  +LE   ++RK +I +++        EGK    +D         F  L E L  R H +L+S KE+ + ++ VED I W+  +M +A+  ++   +  +   +KK++    E++ ++P I    +  + +I+++ + + E I +++ DL      L   ++ + +RL E  K  ++        +W++E E    S     D  S V  LK+ Q+ +E  +  + E +  + + +  ++ +++  +  I  + + ++  +  L +  +     L +   L++ + +V     WI ++  +A   E+G           +HVT++ E              + ++++   A +L +  H     I   +  L  ++  L    + R   L A+    +F  D  EI  R+ DK   L   E G D+ +   L +   +   +I    +   +L E  + +   Y     + ++  +N+       L++  E    + +   +   ++  +R+   ++ W+++    +  +E  +D      L+         ++A  +       +GK L+  K+  S EI+     +TE+   + D ++ R E L+  LEVH F R+A+    W
Sbjct:  767 VSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQA-HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNM-QIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL---ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQY---MFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLW-INEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLAS-KEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQI-LEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDY--------EHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPE-ELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRD---LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAW 2032          

HSP 9 Score: 93.5893 bits (231), Expect = 7.169e-18
Identity = 190/949 (20.02%), Postives = 405/949 (42.68%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EI     +I+++ +QA  L  + H     ++     +E   + +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +  +     KE ++  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  454 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKH----ALVEADIA-IQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1355          

HSP 10 Score: 90.8929 bits (224), Expect = 4.502e-17
Identity = 192/1039 (18.48%), Postives = 419/1039 (40.33%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +    +    + + +++   +L   + G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +   N    ID +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  ++     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+  +      +      +   W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  457 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAE---SPD---VKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1446          

HSP 11 Score: 87.0409 bits (214), Expect = 7.054e-16
Identity = 87/405 (21.48%), Postives = 187/405 (46.17%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  L+E    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A++ Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1290 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLSE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSS---LNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1679          

HSP 12 Score: 84.7297 bits (208), Expect = 3.415e-15
Identity = 180/957 (18.81%), Postives = 391/957 (40.86%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +++ +H+  + L  + H +   VK  L  I+E+ K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++  +GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W+ L
Sbjct:  439 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVL 1365          

HSP 13 Score: 80.1073 bits (196), Expect = 9.151e-14
Identity = 361/1857 (19.44%), Postives = 752/1857 (40.50%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSE---EIASLQEDMQH--EWDRLLTFASQKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKI-KYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI-SVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDD---NLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  SN+ G D    + L  +     + I      + T +E A+ L ++     +    +A ++E  +   E  RL     +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I +  +D  K   +     +      Y  +            +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +     + D   S +++++ K     +E L  L++++ + L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NI+T S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +    +    LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  +     L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  285 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRL-----RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTK----FMELLEPLSERKHNLLA-SKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIITDSSSLNAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2062          

HSP 14 Score: 64.3142 bits (155), Expect = 4.317e-9
Identity = 78/369 (21.14%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  N + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  853 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1211          

HSP 15 Score: 56.225 bits (134), Expect = 1.518e-6
Identity = 76/394 (19.29%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   + +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1489 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1865          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 551.592 bits (1420), Expect = 5.001e-159
Identity = 309/758 (40.77%), Postives = 481/758 (63.46%), Query Frame = 3
Query:   60 KSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEF-DILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIF 2324
            + R ++LQ++RE +QKKTFTKW+NSHL R + ++ DL+ DLRDG++L+ L+EV+S   L K  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL LGLIWTIILRFQIQ++ +ETE   EKKSAKDALLLWCQ KT GY NV+I +F  SWRDG+AFNALIH H P+LID+ KL   N   NL  AF +AE+ L +  LLDPED+ V+ PD+KSI+TYV + Y  F+KMK      KR+GK++ NA+E  +MIE YE L  +LL+WI++ II LN R F NSL  +Q+++  F  YRTVEKPPKF E+  ++  LF I  K + NN K Y P EG LI ++  AW+ LEKAEH RE+ LR EL+RQE+LEQ A +F++KA++RE+WL+E   +++  N G  +   EA   K E +  +I   +ER Q +  +A  LE+ NYH    I+ R  ++   W+ L +L+ +++    ++   +  +       M++ D +K  + S D GKH L  +DLL+KH LV+  +   ++R   +N  ++ F  +   +   P   Q +  ++ ++      L +++ +RR +L+++    K   ++ EE+ W+  + K++++ + G D  SV+RL+ +H  +E E+S     F +      D+   +     +I + + ++ + W NLE++ + R+  L++A    ++ ADA+D   W+ +   +V + + G+DE +TQ+L+K+H  + EEI+ +
Sbjct:   29 EGRFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARR-QRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKF--ATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNY 783          

HSP 2 Score: 274.633 bits (701), Expect = 8.421e-73
Identity = 268/1307 (20.50%), Postives = 607/1307 (46.44%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFN--QRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSN--ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSL--SKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDG----HFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLK-SIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSK-TKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNN-SDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKL----VSFSXXXXXXXXXXXXXXIQSD--IDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAF-------QEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKA 6749
            H +  +++ + A + +   E+  L R RK  L+ +   ++ F E D+   ++  KE   N  Q      D+E I+ ++E++  ++   + R+  ++ +                   A+ L +   P +K ++  +  ++  +W +  +L   K+ +L  A SI  ++   +E +  I +K  ++ +  ++G D      L+RK   + RD+ AI++++   +   + ++  +P +   +  ++ EI D++ +++  L+ R+  L  A  + +F+ D  + +  L+     I ++ +P  ++  E  + Q E +K EI+  E +  K++ +  +V + + +     +   L  LD     L      R   L  +   Q+F ++  Q E+ ++ Q   L       +++  E A+K   +    +D  + ++ ++  + R+     N +S++I  + D + D+  K         + L+++ +  KF ++  ELS WI++K+L  ++ +Y +  NL  K  KH+A  AE+ SN   L+KI   G  LI      +  VK+ L  + + W+ L + T+ K ++L  A++   F ++ AD+ +    +E  +++   G DL S   L+ K  +LE+++E + + + +L+ +A  ++++G      D + +  + + +EL    L PL ++R  NL  + + HQF  DV+ E+ W+ E  P AT  D+G +L     L  K++ L  EI GH+P + ++ E  +++  + S +  + +  R   LK  W  L ++ + R  +L+ +   +Q+  D  +   W++E+  Y+   +K  D     + + K + +   +  Y   +  +S  +             PE  E ++ + ++    +   +    +++  L+          E+ ++E WI E++ +A S+E G+D + +  L++R+    + +  +G++RV T N  A++L+ S +S +  IA  ++ +   W  LL     +     A+ E+HKF    K+    +   +  L  +  +D+N ++   +    F  +++ + TQ+  +   A +L+  Y  + +D I +  + +   W+ L++    + ++L    D    +  +++ + ++ ++  Q++A  +   V     +++L       + NH+ +  ++     SF+  +   +     +   S+   + +L+   K K+ +++W  + E + +    + ++HQ +   +        QE  +        ++E EKL+ +H  F  + +  D+R  A
Sbjct:  801 HAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQI-------------------ARQLMHNGHPSEK-EIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL----LEPL-SERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSH-----PE-SERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDV----SSVEL------LMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRL----ILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          

HSP 3 Score: 273.478 bits (698), Expect = 1.814e-72
Identity = 336/1497 (22.44%), Postives = 662/1497 (44.22%), Query Frame = 3
Query: 6651 NNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEM---KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKL--TEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSC---VKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGF--------SSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARD-LEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN----YYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTN----SVITEEMNGLKDNFK-------IRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYP-DAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEAL--PTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
            +++  DL    +LL+KHR F   +S    R       I   ++M   +HF  + I        ++   L       + +L    +      ++DD + W+ + L+ + + D   +    +  L++K+K +  EI+ + P  + L  +++ L    H +S + K  +  I E+  ++   ++ R  AL++   L   F E DA E W  EKE  ++  ++   L+    +Q +    EP    Q   +R+ ++ Q A QL+       P    IR++   + +RW   +  ++  K+ L  A  + NY+ E       I+++ K+++  +D G+D+  V  L+RK  G+ERDL A+  K + L++  +  ++   + +  I  +  EI D  E++    K R   L  + +  + ++D         +    I     PN    A   L  H+ +K  ++N +    ++ D+              + +Q +    TD Q   +++ L +      E    W  RQN L++      FL   +  E +L  Q    + +L + +  +T+E     I  +    + + A E+K    +++E   +L    +SD  +   + +  +D           + +E LMR    L   ++LQ+  Q  ++   WI  KML A D +Y++  NL +K  KH+ F++E+ +N+  +      G +LISE   +   + EK+  L    + L++ +  K +RL +  K   +T+       W++  E   +S +YG DL SV  L ++Q  +E  +   K++++ +Q +A  +  E    T ++  +   +  +F++L E L    +NL  ++ +++F+ DV  E+ W+ ++M LA   + G +L      +K++ TL  EI      I+ I +++++ + D +    + IR    +L+  +  L    E+R  +L      QQ+  D  E E  ++++ L + + EK  DEQS ++++KK + L   ++  +    +LS+ +  +  D   ++ E +   Q+K+ ++   ++      +  L+     +   RE +++  WI  + ++    E G+DY+    L ERF  + +       + ++            N  + E+ N+     + I E  +GL + +         R + L  + E+H F  +A ++                          F  +Q DK +  +  E  +  + V  L+     FE D++A+ +Q+ +   ++ RLQ  Y  D  D I  +  EV + W  L  A   +R +L +T     +    +DL+ W   E+V I  +EA   P DV+  ELL+      K EID+++      I+ G  + +   Y  + ++EK   + +  K M D    R E     +++ +F  + +  E+WL+  E  + S   +  +SV E+E+  K HE + K   +   +F A
Sbjct:  651 DDYGKDLTSVMRLLSKHRAFEDEMS---GRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ-SLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQA--SRVAVVNQIARQLMHN---GHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDM------------GEMVTQGQ----TDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ----EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKI--NAVVETGRRL----VSDGNINSDRIQEKVDSIDDRHRKNREAASELLMR----LKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKS-TDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPES-ERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTV----------NNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEI--------------------------FGRIQ-DKHKK-LPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM--EDV-IRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSS--REIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          

HSP 4 Score: 156.377 bits (394), Expect = 7.014e-37
Identity = 331/1730 (19.13%), Postives = 717/1730 (41.45%), Query Frame = 3
Query: 4344 KFDENANELSEWIDDKLLAIEEENYKDLFNLPE---KLQKHKALEAEIKSNISSLEKIHDCGNDL-------IKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGH----FDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQ----FSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-W-----MTKNEHILIKQN-----CLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKL--QQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQI---KDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSI---KISLKQKEIKD---DLEQLAVL----TKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSW-PNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKRSI---SSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHA--SSVEIGEKVIDLDNQ----LKELKTMSDF---KLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDA-EIL------YRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIAT 9341
            +FD  A     W+ +    + ++N+   F+LP      +KH+A+E +I +    ++ +     +L       IKR   +KD V  +       W+ L      + ++L       +  + +  I+   D ++ ++ +   G  L   + L+ KH ++E+++  Q E +  +   A + A DG      D + I D +  +E    +L  L  +R + L+++ +  +F +++ +E  WI E     + +DYG+ L   ++L +KH+    E++G        ++ G+D+  E     +K +  R   +++ W  LE+ +  RK +L+ ++   QF  D +DI  W+ +    V+ +D   D     + + K K +  ++  Y   +  +    +       +   +   +  + ++  E ++     R      + AL++         E    E WIDEK++  ++ +  E L+ +E ++ R+ S    +     RV   N+ A QL+ + +   +EI + Q+ +   W +      +K     +A  I  ++  C +    +  +   +   T+D      G   +Q+      ++L  ++ +L D+   A KL+ ++P+ +  I+  +  ++ +W+++      +   L            + +  ++L+   T + ++   N++  A + +   +     + N+E   QK+    E +            Q+D   M  ++    QAL+  W     M +N   L+ Q+      LRD  Q  +    QE  +        LE  E  + K  +F   +   ++++ A+      L    + + D I    D    R +K  +   ++  +L + +     L++  + + W++EK+   Q  + D++ N   + L    K++A  AE+++++   +++  +  +L++ +       K  +  + + W  L S +Q ++  L +A    +F      ++ W    E  + +++ G DL     L  K        +V +  I+ +   A  L Q         D + S+   +++++  L   L   K+ L  + ++H +  +   + D+I    +R+ L    D G ++ +V+ L +K   +++++     +         IDD  + + +I     SL  + I+    DL+QL  L    T++R   L  +++  +   DA A  +  + + EL  +S     D +SA + LK H  L+  + +     +++    R L  D +  +  I+ +   V           + L + +K+      +R+ +L+E  +L       +  EQW+  +    +V+  + +     E VT   +  R     +  +      TV     E++     D  +   +AE K   + + ++ L E +    Q+L++  EL +     ++    I++K     +    D+  +    + H  F       E DIQA +    R + E+ A   +   G+K  D+  +    L+  K++ D    +  RL++T  +F++   V   + W+ +  +  E+     D+ SVE L      I+ +I++  +   +  E   +++   +Y + +I+E       + LQL E  K   +   D  E L      ++F  D      W+  +    +  EIG S+ E ++ +K+H       AT
Sbjct:  413 RFDRKAAMRETWLSENQRLVSQDNFG--FDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL-------WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK-IRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAE-LTRLR------KQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIR-EKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQG---------QTDAQYMFLRQRL--QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWL----KHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQE----GKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRD---VEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPR---------IDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDA-AEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKV-----------DKLYAGLKDLAE---ERRGKLDERHRLFQLNREVDDLEQWIAER----EVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT---IAEWK-DGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTF-------EHDIQA-LGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKE-------KLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAAT 2055          

HSP 5 Score: 133.65 bits (335), Expect = 5.150e-30
Identity = 328/1668 (19.66%), Postives = 685/1668 (41.07%), Query Frame = 3
Query: 2910 HYDKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKE-----GDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKE----IDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPN--PDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFN-------LPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHP-KKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL--DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIAN---RIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKT---KDRNAIDFGTKRIQQFSKELENMKTQLDDI-SMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNE------INTQVKADRQINSVLAANEAI-QLGKKFAESLANHETVLQKLV--SFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNIS-VTDDRVKALSVFIPTLKEMKHFDY-------DNINSLFDDCVK----RRQ------KLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAEL-VTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIIT---QTANQLLQRKTIPAPEADN-----IRSRSKAI---RSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFA 7712
            ++D + I  ++  + +L+  L  L RAR+  LE +    + F+E    M++M   +      D+   G     +E + +K+  +  D+A  + R+  ++       +      E  + CD ++            + +R   +   +++L +L  ++   LE +  +  F     E    I +K  IL+ D+ G D  S   L  K +    ++       E+    G+ +      E ++ +EKI+E    I + +  L+     RK  L  A  +H+F  D+ + +  + ++  I+ +  +  D  S ++ +++ + +  EI      +D L   AS + +      ++   L  ++++ K + +    R + L+D L   K + E D  E  I ++   L+++     ++D+E       +L   ++   +RV  +++   +L  N  P  ++I  + DK+  + ++       KK  L + L    +    NE   WI +K   IE  + +DL N       L  KL   +     I++ +S L+K      + ++  HP +  A+   L  I + W+++    +++E  L +AS+  +F  +L D        +  + +  + N L  A+ L+ +H  +++E++   E+  K++    EM   G  D + +     ++ L+    +L  +   R + L  +  + QF  D  Q   ++          +   +L  A     K +  +T ++ ++  +  ++E+G+ L  +   +    ++ +  ++ D   +  + A +   +L  + + ++FL D  ++ LWI EK      + +D+  D+  N   + +K ++   +LA+    L  I       K+  + I+  PE    V +K       +E   ++   K   L +      F    ++++ W+   +    S+++G+DL  +  L  +       +E+ +  ++     A Q L  +   ++E+ S +  +Q ++  LL   S++     A++EIH+FN+  +D    V  + + L + T    +   +    K+ Q   KE++  + ++DDI   + N +      N++ I + + +L  LW  LIE   ++  +LE        Y    E+ A+++E         + K ++   S+L  ++ + Q  + +AE++       + LV  S  E          ++++ + + D+ E+R   +  L+E      H L + N  R++  +    A +EV    +    D E    L  + R FA +   +  +RV  ++     L    H D        D +N  + D ++    R Q      +LH  Y D +      Q          DK+  + E+L       +  NT+E    L + +     +I A   +  QL   +A L       K+++ +     +LE W  LL   + R   L +  D   FF  +  +  W  +    + A E   D+    S++  +    G K   +AR D  T   +    LL RK   + E           R + I     RW+ L+  LE           +H +  +  +    +  +   +  ++ G  +D VEKL ++    E+     +E+F+
Sbjct:  480 YHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDY---GKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDG----EGYKPCDPQV------------IRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDM----IAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIE--STQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQK----EAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRD-MGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSD-GNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKML----TAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIE------KEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQA-QALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVG-ERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEER---RGKLDE-----RHRLFQLN--REVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQ----------DKHKKLPEEL------GRDQNTVET---LQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVS---SVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILE-----------VHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFS 2061          

HSP 6 Score: 129.798 bits (325), Expect = 6.841e-29
Identity = 305/1517 (20.11%), Postives = 621/1517 (40.94%), Query Frame = 3
Query: 6678 TEKLLAKHRNFAHNISVTDDRVKALSV-----------FIPTLKEM-------KHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQ-AEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKS-ANTALKVHDELKTLMNNRKIKENRIMDLCRKLKE-DRNIVT--SSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNK-------RQNRLNEYIQLHTFLETCEAEEQWL---------------LTQNKKCDVILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDL---ISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSD---AEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELV-------KNLQNKLVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQ-IEKSNNESNRL-QEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQI---VEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLD-EKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDA 11033
             E LL KH     +I++  +RV+ ++            + P   ++         F Y  +  L     +RR +L ++ R          +W     E  ++  W+ EK ++I + D     L   + LL K++A   E+S     FEQ + +  +++  +H  SE+ +  +  I E+W  L   S  R   L+EA  L  F  + D ++AW  +   +VS+N++G D     SL  K  +           ID + + A+ L Q       E+ +++ R   I  R   +       K  L +   L+  ++E       I ++ + +        ++ +E ++ +   +E ++N    + A + Q A  +  N    H       +KEI           + + D LN  +  F+ + D K   D  L    + N     N++KS      KV +  + L N+       +M L RKL   +R++V   + ++   +     + +     + +LS + E  + W +       R+  L E  +L  FL   +  + WL               LT+ +K      N+K  + +++  E+    R +  +V+   Q       + + ++L               +++  G++ L++       +LS     Q+  +  +    ++ N+  + +       +      +KK  +F++ ++ANE  I A ++ G+RL+S+ + +S  I EKV  +D++ ++ +  +   L RL +     K+ +  +    WIN  EK+  + +   D    +  + LK Q    E  + S+KE L  I++E   +I+E     + ++E+   ++  +  L    +  +  L D   AE+  +  +D+   L  ++ ++Q    ++ G  L   +  +K+   L +++  R + IE ++ QA+ L      + D++ ++R  ++  +  L     ER + LLA+K   QF  DV +  + + ++  L  + + G + Q+   L+KK ++L  EI         + E++ N+ TD  +   E +       K L   L+E  E    +         YY    E+E    W+  Q + ++ EE  KD    +S++++     QA+      +  +    + L+ + +P S  I    S + +   GLKD  + R+  L     +    RE +DL  WI                           +++     S E  Q    V  L+  F +F RD   +  + ++  NN ++ L    + DA   I +  + + + W  L   ++ +   L  + +L  +    K++    + ++ K+   E L  D    E L  +    + +I +   ++ +L    D  +  A Y G     +++++N + + WK++ D    RR       D  +F   + DL  W+   E++++ ++ ++  + V  +E    NH+     +++    F A
Sbjct:  550 VEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQL---AAERRARLEESRR----------LW-KFFWEMAEEEGWIREK-EKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ----AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHN---GHP-----SEKEI-----------RAQQDKLNTRWSQFRELVDRKK--DALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLA----GVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIK--NEIDNYEEDYQKMRDMGEMVT---QGQTDAQYMFLRQRL---------------QALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWIN--EKMLTAQDMSYDEARNLHSKWLKHQAFMAE--LASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQ---SDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGK-STDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAE---AWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWI---------------------------AEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAAT-IAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLP--EELGRDQNTVETLQRMHTTFEHDIQALGTQVRQL--QEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWM---EDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTA 1956          

HSP 7 Score: 108.997 bits (271), Expect = 1.514e-22
Identity = 145/705 (20.57%), Postives = 295/705 (41.84%), Query Frame = 3
Query: 4026 AQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSK--RKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD-KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKK----DAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKI--NVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNE-FGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDD 6110
            A++F ++    E+ +S+    +   N    +  VE A K H  +   I   + RVQ++    R+ E +   D ++I  R D V+     L      ++  LE +L   K  +    + +W+D+ K+L + ++  K L  + + LQKH  +EA+I      +  ++             K      ++D +  ++  +++L     ++  +L ++    +F   +A+        E ++ +   G DL S   L+ KH   E E+  +  +  +  ++  +M  + HF  E I + I  +  + A L  L   R   L++    HQF  D D    W+ +     + ND G        L  KHK +  EI  ++P +  L E    L +  +     DV+ R   +++    + +    RK  L  +    +   + +   LWI EK  ++N       N QI  ++  L+ I     + +  + N +          R++  N  P   E +  + ++ +  +  FR  ++ K++AL +     N+  E +E ++WI EK K+ +S +  G DL  +  L+ +     + +   E ++    + A +L      +++ I S   ++   W+ + T    + A    A ++ +F +   DF   ++    ++ S+    N +    K + Q     EN+K ++D+
Sbjct:  411 ARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ--AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLN-------NMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMP-NTLTEAEKLLTQH----ENIKNEIDN 1100          

HSP 8 Score: 99.3673 bits (246), Expect = 1.336e-19
Identity = 247/1289 (19.16%), Postives = 525/1289 (40.73%), Query Frame = 3
Query: 6642 VKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLV-SANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDI--DDNLDANHSIKISLKQK--EIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKT------------------LMNNRKIKENRIMD------------------LCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQNKKCDVI----LNNLKSLSTVEDVTENIDAKR--------------------------SISSLVSAREQKTV-----KGSLLEILEKLRKDQISDIKLA------EGKYKSVIDG--------FSSLNEKLM-RIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRV-NLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE-IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLIS-VEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATR---------AQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNK-------LVXXXXXXXXXXXXXXNNLNYYLYIRESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDW 10178
            V  N+   D   T+ L+ KH++ A  I+     +  L      L +  H +  ++        +R +++ +  R  +  L +      +  E+D    W+DEK Q +  + +    LE+   +  ++++L  E++        +   + +L+ N HP  +E +     +  +W Q      ++  AL  A  +  +  E +  ++W REK  ++ S  +LG+DL   M+LQ KLT         EA++  + + A +L   ++    +A  I SR   I   W+ +K  L+  +  L EA KL  +  +L      +      +  +D  + +   EKL  +   I+ +++   E + K+R   ++      DA +   + L+Q+   +     +L  + + R + L+ S+ Y + ++D K        Q  ++  +  P   + A  A+K  ++  T                  L+++  I  +RI +                  L  +LK++R++       Q  S+   ++++ T Q+      +   + W K Q  + E      +L+  E E   L+++  + + +    L  L  +  V + T    A+R                           I S    ++  +V     K  +LE   ++RK +I +++        EGK    +D         F  L E L  R H +L+S KE+ + ++ VED I W+  +M +A+  ++   +  +   +KK++    E++ ++P I    +  + +I+++ + + E I +++ DL      L   ++ + +RL E  K  ++        +W++E E    S     D  S V  LK+ Q+ +E  +  + E +  + + +  ++ +++  +  I  + + ++  +  L +  +     L +   L++ + +V     WI ++  +A   E+G           +HVT++ E              + ++++   A +L +  H     I   +  L  ++  L    + R   L A+    +F  D  EI  R+ DK   L   E G D+ +   L +   +   +I    +   +L E  + +   Y     + ++  +N+       L++  E    + +   +   ++  +R+   ++ W+++    +  +E  +D      L+         ++A  +       +GK L+  K+  S EI+     +TE+   + D ++ R E L+  LEVH F R+A+    W
Sbjct:  754 VSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQ-AHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNM-QIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKL---ESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQY---MFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLW-INEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLAS-KEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQI-LEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDY--------EHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPE-ELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRD---LMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAW 2019          

HSP 9 Score: 92.4337 bits (228), Expect = 1.626e-17
Identity = 190/949 (20.02%), Postives = 405/949 (42.68%), Query Frame = 3
Query: 8316 LSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWI-RNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVE---------IGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNL-------NYYLYIRESEEILTWIKNQN-ILVIIEEYGKDYDDCLSLIERFDSYXXXXXXXXXXXXXXXXXXXXXXLEKNPFSREIENTNSVITEEMNGLKDNFKIRKEALQGALEVHAFVREANDLIDWXXXXXXXXXXXXXXPSEKTDEAEFCDMQSDKTEAIISREFNQPLSIVRKLENNFAKFERDLEAVNSQIEKSNNESNRLQEIYPDAKDHIVDKTEEVEKTWNILKVAVNQKRNKLTETKKLQLWLVQYKDLLSWTKAENVKITSVEALPTDVAGSELLIVISNEHKLEIDSKSQELNKLIKSGDDIKSTAKYIGQIVEEKQNHIQKIWKNMCDNLTSRRELYEQNIDLRKFMLEINDLESWLVKNENLMKSLDEKSFKSVPEIEEAFKNHEDYMKIVESEKIKFDAIKRQTKLEKLFQQRKEKERIAKDSL 11108
            L  VE  T+  +A   I + ++A E++    +++ +  +L  +   DIK    +  +VI  +  L E L    Q L     LQ++ Q++   + W+   K+L+ S    +  + + + ++KH    + VEA+   IQA    G    ++  A+  E         I ++V  ++   +EL  ++  +  RL E+ + +K+   +     WI E EKI  S +YG DL SV +L  +    E +++      +   +E + MI E ++ +  IRE+   I  ++  L +        L +A +L++F +D      W+ D +++ +  ++G         VK+H  +  EI     +I+++ +QA  L  + H     ++     +E   + +      R   L       +  S+    E+ +++K   LNN +     +    +  + ESL  E++ ++S    +++    +  +     KE ++  Q+KL              K+ L       NY+L   E  E  +WI+ +  ++   ++ G D    ++L  +     + L A + K+ +++   ++L  E    ++ I +  + I++    +K   K R+ +L  A ++  F+R+ +D   W+      I+S               DM +  TEA       + L+    ++N    +E D + +    E         Q ++      +  + + ++  WN L      ++N L+++   Q +L   K   ++   +   +   E +PT + G+E  I    +    +D+  +++N ++++G  + S        ++EK + I    +   +  +      + N DL+KF+ +  +L  W+  NE ++ + D  S+     +   +  H+ +M  + S K   D I+++    +L  ++ E E + K+ L
Sbjct:  441 LPAVEAATKKHEA---IETDIAAYEERV--QAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKH----ALVEADIA-IQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKE-IRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHL---ECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASE--------------DMPNTLTEA------EKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMF------LRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTE-MPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWI--NEKMLTAQD-MSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGM--QLISEKPETEAVVKEKL 1342          

HSP 10 Score: 90.8929 bits (224), Expect = 4.451e-17
Identity = 192/1039 (18.48%), Postives = 419/1039 (40.33%), Query Frame = 3
Query: 3114 IEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDID-------AIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDK-LKSLASIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIES-------IISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQ-------KHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA----SEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPEL-VEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRW-NSQLKSIELGEDR--VKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNI--DNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKL 6134
            +E   KK+EAI  D+AA   R+  +  +               R+ +A+   +I       +++ R   +I  WE L +L   + + LE    +    +    + + +++   +L   + G      E+L +K   +  DI         + +  ++F   G+G K   P +   + +++  ++  Y +L     +R+  L  +  + KF  +  E E  + E   I+ +    KD++SV   + +    + E++    + ++ +K    ++ ++      I   +  + ++  +L+     R K L++A    +F  + D I++       I+S  +   D  + Q  V   ++  +   N    ID +  +  +L +   E   +PD   +  R   + ++  ++      +K  L++ L   K    A+    WID+K      E + +   +PEKL+       + ++LE E+ +  S +  ++     L+   HP +  ++     ++ +W +     + K+  L  A    +   E NE  + I  K   +E    T  LGNDL    +L  K   +E +L      L+ L+++A ++  +     + IL  + ++     ++   +  R ++L +  K  QF  D+D    W+   + +    D   +L +A KL  +H+ +  EI+ ++     + + G+ + +  +      +  R +AL   W+ L K  ++R++ L  S   +QFL D      ++  + Y +  ++     +     I K +     + T D   + I    N   +T R++     +  + + +K +   D     R + ++    L++ +D   F  +  E+  WI+EK   A    + E      +L  +W   Q    EL  ++  +    +   QL+  +      +      +   W+ L +    K  +   A +   F ++C D    ++     I      KD  +++   K+ Q    ++E  K +++++   A  L
Sbjct:  444 VEAATKKHEAIETDIAAYEERVQAVVAV--------------ARELEAENYHDI------KRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYK---PCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAE---SPD---VKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEK------EQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIES---TQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDF---MTTMDANEEKI----NAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDE----ARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL 1433          

HSP 11 Score: 86.6557 bits (213), Expect = 9.210e-16
Identity = 87/405 (21.48%), Postives = 187/405 (46.17%), Query Frame = 3
Query: 1239 WLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQADSGKLAFXXXXXXXXXXXXMEFD----ILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLP----IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEE--NDMKRLQELVTLMTKP-SDKHDIRPERVEKL 2420
            W+NE +    +M+     +N  ++  K +    E+ + KE   K+++  + L S    ++  +  + + +   W+ L+    +K     +  F  +          + D     L+ QI S D GK   +   LL+K  +++ Q++       ++  +++      KS +    +R T++T+   L   +  L+E    R+  L  +   H+  RD+E+E  W+   + + T+ + GH+  +V  LI++++  + EI  H P    IF + +    D S    +    I + L  L Q W  L     +R   L++A++ Q+YY DA +++ W++E    ++++E   DE +  +++K+H  L + +  + E  + + +    +   + P S++  +R  +V+KL
Sbjct: 1277 WINEKMLTAQDMSYDEA-RNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTK----AQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTKFMEL---LEPLSE----RKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSS---LNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL 1666          

HSP 12 Score: 84.7297 bits (208), Expect = 3.498e-15
Identity = 180/957 (18.81%), Postives = 391/957 (40.86%), Query Frame = 3
Query: 3432 SINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKD----RPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTE-----LKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENY-KDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQA-SEQSEFNENLADILRKF-DTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVS------PMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEA---------VTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRI--QQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQL 6209
            S NQ+L  ++ DN GFD  + E   +K + +  DI A + R++    +   ++     ++  +  +   +  L+  L   L  R+  L     + K   +       ++E+  ++ +Q   K +  VE  +Q+   ++ +I +    +  + + A     D    +P D   I   +  ++   + L     +R   L+++    KF+ E  + E  I ++   L S +    +  V   L  H    AF D++  R     +   E      + +  SEKI  R   + ++   L      +K  LE      +F  +A+++  W+ D L  +   +   D ++    ++KHK +  EI +   +++ +H+  + L  + H +   VK  L  I+E+ K++   T  +++ L    +    F+E  AD    + D  E  +   Q+   L   + +  +   LE E+  Q   +A + Q A ++  +GH  ++ I  +  KL  R ++   LV+++   L   L    +  + ++   WI E+ +   +  D G  L   + L  K       + G +  +V +     DLQ+E        P   + + +R   + D W+ ++    +R+  L  ++  +QFL D +D   W++     +   D       + N + + + +        T  +NI +  + +++  +K+  + E+V           + ++       +        ++QN L     +  F  +  + EA+++ ++ +    E    L+  E    +    + +++  E+++    E   +L+   N  S+ I    + +     +    AS+   +     ++ KF + C++ S  +N   ++    + D  A +  +K +  Q F  EL + K  LD I     +L  + P    ++ E++  L+ +W+ L
Sbjct:  426 SENQRL--VSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKH---RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASAL-PQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSE--ADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRK-------LTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASED-------MPNTLTEAEKLL-------TQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYD-EARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVL 1352          

HSP 13 Score: 78.9518 bits (193), Expect = 1.791e-13
Identity = 361/1857 (19.44%), Postives = 752/1857 (40.50%), Query Frame = 3
Query: 4287 LHGKCGGKKID--LENDLEFAKFDENANELSEWIDDKLLAIEEENYKD-LFNLPEKLQK---HKALEAEIK-SNISSLEKIHDCGNDLIKRNHPKKDAVKD--ILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTA-----------QLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENIL---DEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQRE---VSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSD--KDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFK---DTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSE---EIASLQEDMQH--EWDRLLTFASQKNAKFDAAEEIHKFNKT--CKDFSDMVN--IDNISLFSKTKDRNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKI-KYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAE-SLANHETVLQKLVSFSXXXXXXXXXXXXXXIQ--SDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNI-SVTDDRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTLDKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSD-----LDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLR-QAEDIDD---NLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNE-YIQLHTFLETCEAE------EQWLLTQNKKCD--VILNNLKSLSTVEDVTENIDAKRSISSLVSAREQKTVKGSLLEILEKLRKDQISDIKLAEGKYKSVIDGFSSLNE----KLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANY-EDRVNLSNKVKKHREFVSEV-EANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYL---TSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESL 9641
            + GK  GK +D  +E +    K++  A++L EWI+  ++ +    + + L  + ++LQ    ++ +E   K +   +LE +       ++ N+ K    ++  ++  I++ W++L     ++E  L     + E  E LA   R+FD    M +T              G DLP+ ++   KH  +E+++    E +  +   A E+  + + D + I    D + +L      L  L+  R   L+ NL   +   ++   + W++E +      DYG+ L     L  KH  +  +I      V  +  S +    +     P   + +  R   ++  +  L + A +R+ +L+ S    +F  +  +   WI EK   ++  D  KDL +      +M+L S +   A  D +     H     K   D   + +   E +        E   N E   A    ++  LE       FQ +  +++AW+ +  KI  SN+ G D    + L  +     + I      + T +E A+ L ++     +    +A ++E  +   E  RL     +K A  D       F++   C+ + D     ++N+ +  K +D   I     R +    E+ N  +++  ++  A +L    +P+  ++  ++ D LN  W Q  E  ++K   L         + +  E+ +++ E    +++ + + + LA   A+Q      E  L   E  L  L   +E L ++        +   ++I D+ E+   T +     + +   +   Q  LRD+    S  +  +  +   +    L E EKLL +H N  + I +  +D  K   +     +      Y  +            +LH  + + ++ LS    +   LR++     +++ + + +    +   TLE     ++K +     + A+E +   ++     LV++ +  S+  +  V +I ++  +    + +    LK+ +DL  F  +   +  W  EK  +++A ++  D         +  QA + E    K+     +D I +   QL+  K  P  EA  ++ +   +   W+VL++  +    RL +A K   +      +   +      ++  D+G D+ SV  L +KQ  +E  +    ++  +L+ QA+ +     + D   S +++++ K     +E L  L++++ + L  S    +  +D +   D  L   E + +++  +   +  T   +  + +TL    +  + RI D+    +  +NI+T S +   E++     +L  +++     ++ET+    KR  RL E +     + +  EAE      E +++++ K  D    ++ LK    +E   E  D   ++  L      KT +  + +        +   I + + K   +  G   L E    KL   H++    +E+ +L Q       WI  + ++A      +D  +++   ++ REF  +     +  +    +    LI+  H+ +  I E    L+    +L  + D + + L  + +  K+    +     I +  K       G D  +VE L+R     E DI +   Q++ +QE+A  +  +  Y      DI+++   +   +  L +  +     L D    +RF S V   + W++D ++    +E    ++  +  +  H  + +EI  R  S  +  +  + L  R H+A ++I+ +   L    + + +  E+R+  L       QF+ D    E  L  +   L++ E G        L+K+ E+ 
Sbjct:  272 VEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLA---RRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRL---WEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTS------VMRLLSKH--RAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAI---RKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRL-----RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQH---RFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQ-DKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKL---QQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQ-EYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEK--MLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEW----LDKIEKEGMQLISEK--PETEA-VVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALSQEGKSTDEVDSKRLTVQTK----FMELLEPLSERKHNLLA-SKEIHQFNRDVE---DEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDI---FERSQNIITDSSSLNAEAIR---QRLADLKQLWGLLIEETE----KRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVE--DYAETVHQL-----SKTSRALVAD-----SHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQ-------WIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKL-PEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARL--QAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAF 2049          

HSP 14 Score: 64.3142 bits (155), Expect = 5.214e-9
Identity = 78/369 (21.14%), Postives = 166/369 (44.99%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINSKQ-ADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSK--TQFIPDGE---IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWI-AEHFPLVLNKENGNDEGATQALIKR 2291
            K   +A   E W++E    LNNM     +++ E   ++ E +  E+N    R   + ++A  L  N + S+  I  +   +  RW + ++L++ K+ A    L+     L    T     +  K   ++ DLG        L  K   ++  L A+  + + +  ++    + L+S++  PDQ Q + ++L  +S     +    + R   L +     + +RDL++ ++WLS     + +++  +      +L+ +HE  ++EI  +   + K++    D+ +  TQ   D +   + + L  L  GW  L ++   R+NLL  ++  Q++  D + ++ ++  + + L   +     EGA  A+ K+
Sbjct:  840 KMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEA----EKLESEH--PDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMR----DMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQ 1198          

HSP 15 Score: 55.4546 bits (132), Expect = 2.136e-6
Identity = 76/394 (19.29%), Postives = 169/394 (42.89%), Query Frame = 3
Query: 1206 KFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYH-SKDAISTRNSDIQNRWKKLQDLINSK-----QADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESEISAHLPIFNKLKISALDLSKTQFIPDGE-----IHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEISIFEENDMKRLQE 2354
            +FN+       W+ E + +  + + G  +Q  +  I K + +  EI   + R   + E + N+ +++   + +AI  R +D++  W  L +    +     +A   +  +  +          E  ++     S +  K   +A  +L+KH +++  ++  ++  +Q++  SR  +     ++     RQ+   +L        GL +++++RR +L +     +L R++++ + W++    V  + E G DY  V  L  R   +  +         + ++  ++    + I  G      I +  D L++ W +L  +   R  +L  +YE  K+Y DA++    I +     L +E G D+   + L + HT    +I       +++LQE
Sbjct: 1476 QFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMM-----SEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKL------YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGN----IGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHK-KLPEELGRDQNTVETLQRMHTTFEHDIQAL-GTQVRQLQE 1852          
BLAST of Spectrin beta chain, non-erythrocytic 5 vs. Ensembl Mouse
Match: Sptb (spectrin beta, erythrocytic [Source:MGI Symbol;Acc:MGI:98387])

HSP 1 Score: 537.724 bits (1384), Expect = 1.018e-154
Identity = 314/765 (41.05%), Postives = 481/765 (62.88%), Query Frame = 3
Query:   42 STKQSEKSRVQELQEDREGIQKKTFTKWMNSHLKRANAKVDDLFKDLRDGKILMTLMEVISNVNLGKRNRGTLRVQNIENVNKALKYI-QSKVILENIGAEDIVDGNHRLILGLIWTIILRFQIQEMIIETESG-EKKSAKDALLLWCQNKTRGYKNVDIKDFHKSWRDGLAFNALIHAHCPNLIDYSKLSPENHQANLTQAFTIAEKELSIPTLLXXXXXXXXXXXXKSILTYVSSLYLSFAKMKTENTGAKRVGKIVSNALEISRMIEDYEKLVRNLLQWIQKKIIKLNGRDFPNSLNEMQKEMLEFKEYRTVEKPPKFAERSTIDEKLFQIILKQKENNMKHYFPSEGLLIKEVEVAWDNLEKAEHAREMVXXXXXXXXXXXXXXATKFNKKASLRESWLNEIVSVLNNMNAGTTIQNFEAQINKEELVANEINTTKERFQKLKELAINLESNNYHSKDAISTRNSDIQNRWKKLQDLINS-KQADSGKLAFXXXXXXXXXXXXMEFDILKPQINSTDLGKHYLAAKDLLEKHNLVDCQLKALSDRFNQINYKSRDFLDSLKSQNLTPDQRQTLETQLKNLSGDINGLNEVSQQRREQLKQNCNYHKLMRDLEEEKNWLSNEIKVMTNKETGHDYASVLRLIRRHEVYESE---ISAHLP-IFNKLKISALDLSKTQFIPDGEIHKSLDFLSQGWTNLERIKSERRNLLKDAYECQKYYADAEDSQQWIAEHFPLVLNKENGNDEGATQALIKRHTALLEEI 2315
            S +  E+SR++ L ++RE +QKKTFTKW+NSHL R + ++ DL+KDLRDG++L+ L+EV+S   L +  +G +R+  +ENV+KAL+++ + +V LEN+G+ DIVDGNHRL+LGLIWTIILRFQIQ+++++T+ G E +SAKDALLLWCQ KT GY +V++ +F  SW+DGLAFNALIH H P+LID+ KL   N + NL  AF +AE++L I  LLDPEDV  E PD+KSI+TYV + Y  F+KMK      KRVGK++ +A+E  +MIE Y  L  +LL WI++ I  LN R F NSL+ +Q+++  F  YRTVEKPPKF E+  ++  LF I  + + NN K Y P +G L+ ++  AW++LE+AE+ RE+ LR+EL+RQE+LEQ A +F++KA++RE+WLNE   ++   N G  +   EA   K E +  +    +ER + L++LA  LE  NYH +  I  R  +I   W  LQ+L+ S +Q     LA        + +I    D +K  I S + GKH L  +DLL+KH L++  +    D+   I   +  F +    Q   P   Q ++ ++ +L    + L+ ++  R+ QL+Q+    K   +++E ++W+  + ++ ++ + G D  SVL L R+H+ +E E   + AHL  IF +    A D+   +     +I   +  +S  W +L+ + + R+  L+DA    ++  DA+D + W+ +   L+  ++ G DEGAT+AL K+H   LEE+
Sbjct:   36 SARLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHSIDW-MDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFAEGKGYQPCDP---QVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQE----ADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEEL 792          

HSP 2 Score: 241.891 bits (616), Expect = 7.447e-63
Identity = 296/1319 (22.44%), Postives = 581/1319 (44.05%), Query Frame = 3
Query: 2916 DKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYM--KGKEGDFNQRGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIIN-QWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDIL-NDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLKDR--PNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFI----DKIDNRVQSLSKRKTELKPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSI-ELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFSKTKDRNAIDFGTKRIQ-QFSKELENMKTQLDDISMAANKLKIKYPN-NSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKAD---RQINSV---LAANEAIQL-----GKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNE-WMTKNE--HILIKQNCL--RDIHQINSSTAFQEVKVKVNNFDLDLEETEKLLAKHRNFAHNISVTDDRVKALSVFIPTLKEMK 6785
            D  ++  +   L KL+ ++   A  R   L+ +   +  F E D+   +M  KGK  D     +   D+E ++ +++ I+D             ++++L+  ID +         A  L     P  +S    +Y++ +N +W+    +  ++ ++++ A  ++ +    +E  + I  K  ++ +  ++G D      ++RK   L RD+ AI+ R+   +     + +++P +   + ++  +++ L+  LQ+AL+ ++  L  A  +  F+ D  + +  L+     + ++ +P+ +   E  +QQ   +K EI+    +  ++K+    V++ +  P+   +   L  LD    +L+     R   L   L  Q+F K+  Q E+I+S Q   L  + P  S+   E  ++   +    +    DKI + V S +K   E   N  S KI  +   + D+  K + K     + L+++LE   F +N  EL+ WI+DKLL   + +Y +  NL  K  KH+A  AE+ S+   LE I   G  L+      KD V + L+ + + W++L +  + K ++L  A       +  AD+ +    +E  +++  LG DL +   ++ K   LE ++  + E L +L   A  +  +      +I  E R L+L    L PL  +R   L+ +    Q + D++ E  W+EE  P A   DYG +L        K++ L  EI GH P V ++L  G++L +  + +  +D+E R   L+  WD L + A  R  +L  +   +Q+  D  +   WI+E+  YV   +   D +     I+ LK       T +   +NI       +      +  PE  E + +   +    +   +    +++  LEN       + E  ++E WI EK+ +A S E G+D   +  LRD++    +    +G++RV   N    +L+ + +S +  IA  ++ +   W  LL     +     A+ ++H++  T  +   +++  +  L        +      R+   F +EL  +  Q+      A +L+  Y    +D I  +   ++  WQ L++    +  QL    D    +  +++ L+++  I  Q++     R ++SV   L  ++ I+       K F+  L   E++LQ+    S                 +I + L++    +Q +N+ W  +++  H+L+ + C   RD     +    QE  +   +F   ++  EKL+ +H  F  + +   +R  AL    PT  E+K
Sbjct:  815 DSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFD-ILD------------QEMKTLMAQIDGV------NLAANNLVESGHP--RSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAE--GNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEELFADAPSLGAEAGDTDMSI--EKRFLDL----LEPL-GRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELVK-AAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEE---GAIVMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGH--PE-GEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVDNVNTIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQAS----------------DEIREKLQQVISRRQEMNDKWEARSDRLHMLL-EVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEK--PTTLELK 2077          

HSP 3 Score: 149.828 bits (377), Expect = 6.417e-35
Identity = 205/958 (21.40%), Postives = 424/958 (44.26%), Query Frame = 3
Query: 7158 WHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQAKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPAPEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNELGLISDQIKDRLKLVK-VKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIKISLKQKEIKDDLEQLAVLTKQRSDFLNLSYRYFKIVKDAKALCDVSLQQT--------ELINVSSWPNDSKSANTALKVHDEL----KTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQL-NTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTF------LETCEAEEQWLLTQNKKCDVILNNLKSLSTVEDVTENIDAKR-SISSLVSAREQKTVKGSLL--EILEKLRKDQISDIKLAEGKYKSVIDGFSSLNEKLMRIHQMLSSEKELQELSQKVEDHITWIRNKMLIASDANYEDRVNLSNKVKKHREFVSEVEANEPDIQAAIDFGKRLISENHASSVEIGEKVIDLDNQLKELKTMSDFKLKRLIETIKEFKWTRRVEGFISWINETEKIFESHNYGNDLISVEKLKRQQMDIEVDINSHKEQLQSIQEEADTMINENNYLTSDIREQSAIINNRFLQLGEFLKNHSNNLSDAEILYRFHSDVYYELDWIQDKMQLANKEEIGSSLAEADRFVKQHVTLMSEIATRAQSIESIKKQARDLEDRNHFAKDQIRAERTNLENSYERLCNAKEERFNKLLANKNYQQFASDVIEIEMRLNDKTLLLNNFEKGSDEQSCLNLMKKLESLYLEIDMESSNFVKLSEKTSNMSTDYQNKTKELVKNLQNKLVXXXXXXXXXXXXXXNNLN--YYLYI--RESEEILTWIKNQNILVIIEEYGKDYDDCLSLIERFDSY 9950
            + Q+L++++ R   L+EA DL   F E DA E W  EK   +   ++ + L+    +Q +        +   A+ID +   AN L++      P +  ++     +  RW   +  +   +  ++ A +++NY  +    S  I D+ K+V+  KD G D+  V  ++RK +G+ERD+ A+ ++ + L +            S  +     E K+D+ Q      +++D   L    +K ++DA    ++SL +         +L +  +W + ++ A  +  + + L    + L  +  IKE   +D  R   +D + V +S     E     D QL     E L +     +  W  R N L + +    F       E   + +++ L   +  D +      +   ED   +++  R  I S V +  +   +G+L   +I+EK        ++L E ++K         NEK      +L    ELQ   Q  ++   WI +K+L + D +Y++  NL NK  KH+ F++E+ +++  ++     G++L++E       + E++  L    +EL++ +  K ++L          +       WI   E    S + G DL +V ++  +   +E  +N  KE+L+ +  +A +       L ++  +    I  RFL L E L      L  ++   +   D+  E  W+++++ LA   + G++L     F+K++ TL +EI   A  +E + ++ ++L          I     +L++S++ L  A   R  +L      QQ+  D  E E  ++++ L + + E   DE+  + ++K+       ++    N  +L+ +  ++ +    + +++++ LQ ++ +    ++      +  L   Y+L+   RE++++  WI  + ++   +E G+D+D    L ++F  +
Sbjct:  830 YQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGH---PRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALER-----------ESQYLMESHPEQKEDIGQ------RQADVEKL----WKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIKEE--IDAHR---DDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKIMEK--------VQLIEDRHKKN-------NEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEELFADAPS-------LGAEAGDTDMSIEKRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDEPPKDEEGAIVMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIR-LQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDF 1735          

HSP 4 Score: 144.436 bits (363), Expect = 2.909e-33
Identity = 327/1687 (19.38%), Postives = 688/1687 (40.78%), Query Frame = 3
Query: 3423 LRES-INQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLASIVLK------DRPNDSN-ITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAFIDKIDNRVQSLSKRKTEL--KPNPDSEKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDD--KLLAIEEENYKDLFNLPEKLQKHKALEAEIKSNISSLEKIHDCGNDLIKRNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASE-QSEFNENLADILRKFDTVEG-MMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWI-EEHRPSATLNDYGRSLPDAVKLANKHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKN---ISHNTNGFKDTCRKINVLPE-LVEAVT--------KKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGEDRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAE-------EIHKFNKTCKDFSDMVNIDNISLFSKTKD--RNAIDFGTKRIQQFSKELENMKTQLDDISMAANKLKIKYPNNSDLIVEEIDNLNYLWQQLIEYANQKGLQLEYCRDYLVLYDKIKESLAFLNEINTQVKADRQINSVLAANEAIQLGKKFAESLANHETVLQKLVSFSXXXXXXXXXXXXXXIQSDIDDMLEKRNKTKQALNEWMTKNEHILIKQNCLRDIHQINSSTAFQEVKVKV---NNFDLDLEETEKLLAKHRN-----FAHNISVTD------DRVKALSVFIPTLKEMKHFDYDNINSLFDDCVKRRQKLHDNYRDIESKLSNQQIWLTLLRESDDKNFWVDEKLQQIKTL-DKSANTLEEKLHLLQKYKALNAEISAHEPEFEQLMVKSAELVTNQHPKSEEFKTIVCNILEKWHQLLSESQKRSSALKEAKDLLMFFDELDAVEAWQREKEFLVSANELGSDLDHCMSLQ------AKLTEPVGGKQVDEARIDIITQTANQLLQRKTIPA-PEADNIRSRSKAIRSRWDVLKNDLEAYKNRLNEAFKLHNYYNE----LGLISDQIKDRLKLVKVKDFGSDIDSVEKLRRKQNGIERDLNALNEKFAKLRQAEDIDDNLDANHSIK----ISLKQKEIKDDLEQLA-VLTKQRSDFLNLS--YRYFKIVKDAKALCDVSLQQTELINVSSWPNDSKSANTALKVHDELKTLMNNRKIKENRIMDLCRKLKEDRNIVTSSIASQNESVPPTDDQLNTVQENLLSCVKETQNAWNKRQNRLNEYIQLHTFLETCEAEEQWLLTQ 8276
            +RE+ +N+   ++  DN G+D  + E  K+K + +  D  A + R++  + L   ++K    +   +  +   I  L+  LQ  L  R+  L     + K   D   +   ++E+   I +    K +  VE  +Q+ + ++ +I +     DK+K++ +  L+       +P D   I   +  L+     L +    R   L+ +    KF+ E D+ ES I ++     S++    +  V    + H      +  +D  ++ + +   ++  +      +I  R  +V  + + L      +K DL++   F +F  +A++L  W+ D  +LL+ E+   +D        +KHK    E++ +   +E +        +      D V + L+ + + ++++    E +  KL +A +  + F E  +D    + T +G  +    + N L   + +  + +IL+ E++T M  +  +   A+ + + GH     +     +L  R      +V+++   +   L+ + +  D ++  +WI ++ +   +  D G+ L   + +  K   L  ++   +   V+ LE       E  P  K+D+  R   ++  W  L+     ++  L  ++  + FL D +D   W++                 +A + +  + +   L   + LL+    I    +  +D   ++    E ++E  T        ++      ++++ R     + N L  C  F  FQ +  + EA +  ++      E  + L   E    ++   L S+E   D++ +  ++ N+L+   N  S +I    E +Q   DR      + N K   A        E+  F + CK+ +  +N   ++    + D  RN  +   K  Q F  EL + +  L++I     +L  + P   D++ E ++ L+ LW++L   A  K  QL   R   +      +   ++  +  Q+++D     +   N  +   K   E +   +  L++L +        E  D    I+    D+LE   + K+ L   ++K      K    RD   +   T + E ++ +    ++  +L+  +  + K++        H   V D      + VKA  +    ++E       + ++L +    R Q+L D +         QQ +L    ++ +   W+ E  Q++    D+     E  + +L+++      +  +    +QL  ++  L++  HP+ E+   +   + +++  L   +++R   L+    L     E D +E W  EKE + S+ E+G D DH   L+      A+ T  +G ++VD           N +++R       EA  I      +   W  L   ++     L  ++ LH Y+      LGLI ++ ++       +D G D  + E   R     ER+L+ L     +++Q +D+   L   ++ +    I  K++E+    + L      +R+  ++ +  +R+F +V+D  +  +  ++Q   I     P D  S    LK H  +K  +N R     +    C +L E      S +  Q+++     D++    + ++S  +E  + W  R +RL+  +++  F       E WL+ Q
Sbjct:  433 MRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAI---QGDKVKAITAATLQFAEGKGYQPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVG-QDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEEFRDSPD-VTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGE--SDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRD-RVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLS-----------------MAQKAVASEDMPESLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKI---MEKVQLIEDR----HKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKH-QAFMAELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEELFA-DAPSLGAEAGDTDMSIEKRFLDLLEPLGRRKKQLE--LSK-----AKLQISRD---LEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAH-------EAQQYYL----DAGEAEAWISE--QELYVFSDEPPKDEEGAIVMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVD---------NVNTIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDEKHREL-----PEDVGLDASTAESFHRVHTAFERELHLLG---VQVQQFQDVATRLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQ---IETQERPRDVSSVELLLKYHQGIKAEINTRA----KNFSTCLELGE------SLLQRQHQA----SDEIREKLQQVISRRQEMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQ 2028          

HSP 5 Score: 139.043 bits (349), Expect = 9.825e-32
Identity = 206/1050 (19.62%), Postives = 423/1050 (40.29%), Query Frame = 3
Query: 2916 DKENIEKKQAELNKLFCELKGLARARKINLEGSNLCHQFFKECDSFMEYMKGKEGDFNQ--RGSIATDIEGIKKKYEAIIDDLAANSGRITYISDLESLIQSIDPMLEEDIRKCDAKILSNIPFPVDKSKVSNRYKEIINQWEKLNKLKCDKEKSLEGASSIDLFNKTGDELRESINQKLDILNDDNVGFDKESNENLKRKFQNLLRDIDAIKSRMERFKYLGDGVKKTYPTEVNYVNEKIKEIDDLYGKLQNALEKRKNDLNNAGNVHKFINDSKENEQRLNELNGIIENQIIPKDVSSVETSIQQLEPLKYEINLVEANLDKLKSLA-SIVLKDRPNDSNITSALGRLDDKMKSLKDKETKRDKDLKDALEAQKFYKECDQIESIISQQNCKLDSINPQLSVDDVENALKTHANLAAF---IDKIDNRVQSLSKRKTEL-KPNPDS-EKINNRNDKVLDKMNKLHGKCGGKKIDLENDLEFAKFDENANELSEWIDDKLLAIEEENYKDLFNLPEK---LQKHKALEAEIKSNISSLEKIHDCGNDLIK-RNHPKKDAVKDILKTIDEKWKKLNAGTEDKEKKLHQASEQSEFNENLADILRKFDTVEGMMKTAQLGNDLPSAKSLIGKHNILESELETQMENLAKLKQKASEMAKDGHFDKENILDEIRKLELRCAKLTPLVNQRNSNLKDNLKWHQFAFDVDQELQWIEEHRPSATLNDYGRSLPDAVKLAN---KHKKLITEINGHKPVVVNLLESGKDLQREVSPMYKKDVETRSKALKDDWDRLEKQADDRKHKLDLSANGRQFLDDFNDIGLWITEKSYYVNQSDKDLDNDQIANRIMKLKSINVDLATYDTLLKNISHNTNGFKDTCRKINVLPELVEAVTKKFNETSDNFESFRASLNDKQNALENCQDFLNFQDEISEVEAWIDEKQKIADSNEFGEDLQQMEDLRDRWNSQLKSIELGE-DRVKTCNENANQLLKSQNSRSEEIASLQEDMQHEWDRLLTFASQKNAKFDAAEEIHKFNKTCKDFSDMVNIDNISLFS 6017
            D + I+ + + L + F EL  +A  RK  LE S    +FF E D    ++K KE  ++    G   T +  +++K++A  D+L            L+ + Q  D M+ +               P    ++  R KE+  QW+ L +L   ++K L+ A +   F    D+L+  +     +L+ ++VG D+ +   L +K +  L +++  +  ME  ++   G  + +    +  N +++ +  LY ++    E R + L  A +++    +S   E  + E    ++   IP  +  +E    + + L  E+  + A +D +   A ++V    P    +     RL+ + ++ +   +++ + +  AL    +  +C++    I  +   ++S        D+   +     L+     +  I +RV +L +    L + +P+  E I  R   V      L     G+++ L    +   F ++ ++   W+     A+  E+  +  +LPE    LQ+H A++ EI ++     ++   G  +I+ +  P    +   L+ +D  W  L    E +   L Q     EF ++           E  +   +  + L +A++ I K       +E   + +       +++  +G+     I+++++ +E R  K      +    LKDNL+   F  +  +   WI +      L     S  +A  L N   KH+  + E+  H+  + N+   G+ L  E  P +K  V  R +AL   W+ L+  A  +  +L  + +    L    D+  WI      +   D   D   +   + KLK++   +      L+ +      F D        P L              F      L  ++  LE  +  L    ++ +   W++E+  +A S ++G +LQ ++    + N  L++  LG   RV+       +L+K+     ++I      +Q  WD L   A+ +  +   A E  ++     +    ++   + +FS
Sbjct:  604 DPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAH------LKQIFQEADDMVAQ----------KQFGHP----QIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEEFRDSPDVTN-RLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKD--LGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPE--SLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWIND----KLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAE-KPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEEL------FADA-------PSLGAEAGDTDMSIEKRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKK-NQTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFS 1609          <