Unc-5 netrin receptor C

Overview
NameUnc-5 netrin receptor C
Smed IDSMED30034642
Length (bp)2982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Unc-5 netrin receptor C (SMED30034642) t-SNE clustered cells

Violin plots show distribution of expression levels for Unc-5 netrin receptor C (SMED30034642) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Unc-5 netrin receptor C (SMED30034642) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Unc-5 netrin receptor C (SMED30034642) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034642

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30034642SMESG000046884.1 dd_Smed_v4_16435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034642SMESG000046884.1 dd_Smed_v4_16435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 134.42 bits (337), Expect = 2.612e-31
Identity = 78/248 (31.45%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+G+F+S+GGHL +P SGVSL IP  AIP G    +++TV R    +P ++D++ LL+PV+ CGP      + V+L + H A      W   L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++G    + +  A+  +++ +F        + YSIR+Y + +T++A + I  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  VW
Sbjct:  532 AFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILL-----KNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGH---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW 770          

HSP 2 Score: 75.8702 bits (185), Expect = 2.803e-13
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    + D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 134.035 bits (336), Expect = 2.923e-31
Identity = 78/248 (31.45%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+G+F+S+GGHL +P SGVSL IP  AIP G    +++TV R    +P ++D++ LL+PV+ CGP      + V+L + H A      W   L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++G    + +  A+  +++ +F        + YSIR+Y + +T++A + I  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  VW
Sbjct:  491 AFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILL-----KNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGH---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW 729          

HSP 2 Score: 75.8702 bits (185), Expect = 3.164e-13
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    + D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   18 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 216          
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 126.331 bits (316), Expect = 8.293e-29
Identity = 102/404 (25.25%), Postives = 178/404 (44.06%), Query Frame = 3
Query: 1497 GTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKR 2699
            GTF  +GG L IP +GVSL +P  AIP G    ++L +++  +  P+    + +LSP + CGP  +   + VIL +PH A V+   W F+L        + +  WE + T + +      Y  +      I+L  L  Y   G+  S ++ K    +Q+ VF+       + YS+R+Y + +T  A + +  +E   GG L    K L F D   NL L ++++    W+     + Q + F  +W S     +  +F  +R S +    +C +   Q         L     ++   S  +   +   TV      Y F  P+          ++++   L   +  GNDWR+LA+++++ +   YF  K  PT  +L+LW+A       +  L S  +   +
Sbjct:  536 GTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQL-----KTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKR---LQLAVFAPALCTSLE-YSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIW-SGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLCSAPGSTVTTQLGPYAFKIPL--------SIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGK 921          

HSP 2 Score: 71.2478 bits (173), Expect = 8.777e-12
Identity = 58/216 (26.85%), Postives = 94/216 (43.52%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL + ++ Y VK +  V + C A P +     C N ++      V+  GL      R  ++          + V  + V E F    Y C C AW+       A    SR + +  +Y R NF + P+ + + ++ ++ L+C PP   P A V WLKN+  I+     +  +    +LII     SD   Y C A ++   R+S  A + V
Sbjct:   45 EPLPYFLQEPQDAYIVK-NKPVELRCRAFPATQIYFKC-NGEWVSQNDHVTQEGLDEATGLRVREVQ---------IEVSRQQVEELFGLEDYWCQCVAWSS------AGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIV 243          
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 125.946 bits (315), Expect = 1.110e-28
Identity = 102/404 (25.25%), Postives = 178/404 (44.06%), Query Frame = 3
Query: 1497 GTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKR 2699
            GTF  +GG L IP +GVSL +P  AIP G    ++L +++  +  P+    + +LSP + CGP  +   + VIL +PH A V+   W F+L        + +  WE + T + +      Y  +      I+L  L  Y   G+  S ++ K    +Q+ VF+       + YS+R+Y + +T  A + +  +E   GG L    K L F D   NL L ++++    W+     + Q + F  +W S     +  +F  +R S +    +C +   Q         L     ++   S  +   +   TV      Y F  P+          ++++   L   +  GNDWR+LA+++++ +   YF  K  PT  +L+LW+A       +  L S  +   +
Sbjct:  547 GTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQL-----KTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKR---LQLAVFAPALCTSLE-YSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIW-SGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLCSAPGSTVTTQLGPYAFKIPL--------SIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGK 932          

HSP 2 Score: 70.8626 bits (172), Expect = 9.773e-12
Identity = 58/216 (26.85%), Postives = 94/216 (43.52%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL + ++ Y VK +  V + C A P +     C N ++      V+  GL      R  ++          + V  + V E F    Y C C AW+       A    SR + +  +Y R NF + P+ + + ++ ++ L+C PP   P A V WLKN+  I+     +  +    +LII     SD   Y C A ++   R+S  A + V
Sbjct:   45 EPLPYFLQEPQDAYIVK-NKPVELRCRAFPATQIYFKC-NGEWVSQNDHVTQEGLDEATGLRVREVQ---------IEVSRQQVEELFGLEDYWCQCVAWSS------AGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIV 243          
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 117.472 bits (293), Expect = 3.041e-26
Identity = 64/203 (31.53%), Postives = 111/203 (54.68%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKL 2099
            A+G+F+S+GGHL +P SGVSL IP  AIP G    +++TV R    +P ++D++ LL+PV+ CGP      + V+L + H A      W   LL+    N + +  WE +     ++F    YI +  E   I+ ++L  Y ++G    + +  A+  +++ +F        + YSIR+Y + +T++A + I  +E + GG+L
Sbjct:  551 AFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKI-LLK----NQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGH---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEILHLERQMGGQL 744          

HSP 2 Score: 75.485 bits (184), Expect = 3.504e-13
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    + D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 81.2629 bits (199), Expect = 2.150e-15
Identity = 102/456 (22.37%), Postives = 189/456 (41.45%), Query Frame = 3
Query: 1440 SLYNVLTTKTNNSFD---GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVD-------FEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKS-------C-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSE---NFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE----DPTDSLLNLWQAQNP-QKFYIKDLMSVFQRYKRFDCVSVLER 2726
            +LY+ +  K+    D    +      S G  L + +SG  L +P  A+     + ++L VS     +P L   E+ LSPVI+ G   V          + V++   H A+      W F L       + E   W+   T   ++   ++++   +          C +M  SL    + G P   NS  A+  + + VF     + Y+    + +R+Y +P T  A ES++  E+  G +L  C  N    +   NL + I ++  G+  +     ++ + Q  + + +  G+  S  F     + + FS  ++ YQ  + +  + +E+                +E  + + ++       +   F L    K EL++LL + + S +DWR LA++++  +   F        PT  LL+LW+A +      + DL+   +   R D V VLER
Sbjct:  222 TLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEG--EKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLY------ADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHP-RRNSLSAAKRVHLAVFGPTEMSAYRR--PFELRVYCVPETGAAMESVWKQED--GSRLL-CESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQN--GLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS---------------NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 646          
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 81.2629 bits (199), Expect = 2.438e-15
Identity = 102/456 (22.37%), Postives = 189/456 (41.45%), Query Frame = 3
Query: 1440 SLYNVLTTKTNNSFD---GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVD-------FEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKS-------C-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSE---NFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE----DPTDSLLNLWQAQNP-QKFYIKDLMSVFQRYKRFDCVSVLER 2726
            +LY+ +  K+    D    +      S G  L + +SG  L +P  A+     + ++L VS     +P L   E+ LSPVI+ G   V          + V++   H A+      W F L       + E   W+   T   ++   ++++   +          C +M  SL    + G P   NS  A+  + + VF     + Y+    + +R+Y +P T  A ES++  E+  G +L  C  N    +   NL + I ++  G+  +     ++ + Q  + + +  G+  S  F     + + FS  ++ YQ  + +  + +E+                +E  + + ++       +   F L    K EL++LL + + S +DWR LA++++  +   F        PT  LL+LW+A +      + DL+   +   R D V VLER
Sbjct:  317 TLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEG--EKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLY------ADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHP-RRNSLSAAKRVHLAVFGPTEMSAYRR--PFELRVYCVPETGAAMESVWKQED--GSRLL-CESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQN--GLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS---------------NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 741          
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 80.8777 bits (198), Expect = 2.628e-15
Identity = 102/456 (22.37%), Postives = 189/456 (41.45%), Query Frame = 3
Query: 1440 SLYNVLTTKTNNSFD---GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVD-------FEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKS-------C-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSE---NFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE----DPTDSLLNLWQAQNP-QKFYIKDLMSVFQRYKRFDCVSVLER 2726
            +LY+ +  K+    D    +      S G  L + +SG  L +P  A+     + ++L VS     +P L   E+ LSPVI+ G   V          + V++   H A+      W F L       + E   W+   T   ++   ++++   +          C +M  SL    + G P   NS  A+  + + VF     + Y+    + +R+Y +P T  A ES++  E+  G +L  C  N    +   NL + I ++  G+  +     ++ + Q  + + +  G+  S  F     + + FS  ++ YQ  + +  + +E+                +E  + + ++       +   F L    K EL++LL + + S +DWR LA++++  +   F        PT  LL+LW+A +      + DL+   +   R D V VLER
Sbjct:  376 TLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPELAVEG--EKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLY------ADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHP-RRNSLSAAKRVHLAVFGPTEMSAYRR--PFELRVYCVPETGAAMESVWKQED--GSRLL-CESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQN--GLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS---------------NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 800          
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 80.8777 bits (198), Expect = 3.680e-15
Identity = 101/456 (22.15%), Postives = 189/456 (41.45%), Query Frame = 3
Query: 1440 SLYNVLTTKTNNSFD---GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVD-------FEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKS-------C-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSE---NFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE----DPTDSLLNLWQAQNPQKF-YIKDLMSVFQRYKRFDCVSVLER 2726
            +LY+ +  K+    D    +      S G  L + +SG  L +P   + +   + ++L VS     +P L   E+ LSPVI+ G   V          + V++   H A+      W F L       + E   W+   T   ++   ++++   +          C +M  SL    + G P   NS  A+  + + VF     + Y+    + +R+Y +P T  A ES++  E+  G +L  C  N    +   NL + I ++  G+  +     ++ + Q  + + +  G+  S  F     + + FS  ++ YQ  + +  + +E+                +E  + + ++       +   F L    K EL++LL + + S +DWR LA++++  +   F        PT  LL+LW+A +      + DL+   +   R D V VLER
Sbjct:  512 TLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPE--LAVEGEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLY------ADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHP-RRNSLSAAKRVHLAVFGPTEMSAYRR--PFELRVYCVPETGAAMESVWKQED--GSRLL-CESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQN--GLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS---------------NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 936          

HSP 2 Score: 52.7582 bits (125), Expect = 1.262e-6
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  498 VFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQS--SLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            V S  +T+  +Y R +F K P++Q +     L+L C  P + P A + W K+       V P   VI  S  SLI+     SD G Y CEA ++   RK+   ++ +
Sbjct:  125 VASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKD----GVVVQPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQI 227          
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 80.4925 bits (197), Expect = 3.744e-15
Identity = 101/456 (22.15%), Postives = 189/456 (41.45%), Query Frame = 3
Query: 1440 SLYNVLTTKTNNSFD---GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVD-------FEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKS-------C-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSE---NFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE----DPTDSLLNLWQAQNP-QKFYIKDLMSVFQRYKRFDCVSVLER 2726
            +LY+ +  K+    D    +      S G  L + +SG  L +P   + +   + ++L VS     +P L   E+ LSPVI+ G   V          + V++   H A+      W F L       + E   W+   T   ++   ++++   +          C +M  SL    + G P   NS  A+  + + VF     + Y+    + +R+Y +P T  A ES++  E+  G +L  C  N    +   NL + I ++  G+  +     ++ + Q  + + +  G+  S  F     + + FS  ++ YQ  + +  + +E+                +E  + + ++       +   F L    K EL++LL + + S +DWR LA++++  +   F        PT  LL+LW+A +      + DL+   +   R D V VLER
Sbjct:  484 TLYDYMEDKSVLGLDTSQNIVAAQIDSNGARLSLSKSGARLIVPE--LAVEGEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLY------ADEGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHP-RRNSLSAAKRVHLAVFGPTEMSAYRR--PFELRVYCVPETGAAMESVWKQED--GSRLL-CESNDFILNEKGNLCICIEDVIPGFSCDGPEVVEISETQHRFVAQN--GLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVS---------------NEPELYDATSEEREKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 908          

HSP 2 Score: 52.7582 bits (125), Expect = 1.386e-6
Identity = 34/107 (31.78%), Postives = 52/107 (48.60%), Query Frame = 3
Query:  498 VFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQS--SLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            V S  +T+  +Y R +F K P++Q +     L+L C  P + P A + W K+       V P   VI  S  SLI+     SD G Y CEA ++   RK+   ++ +
Sbjct:   97 VASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKD----GVVVQPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQI 199          
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0339998)

HSP 1 Score: 70.8626 bits (172), Expect = 5.187e-12
Identity = 80/383 (20.89%), Postives = 148/383 (38.64%), Query Frame = 3
Query: 1503 FSSIGGHLDIPESGVSLFIPRDAIPIGLSQRI-FLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQ 2642
              S GG L +    + LF+P  AI   + + +  L +S   +      ++  L S V+   P    F K VIL +PH   V   QWH  +  +   +     +W    +   +     +++ +      IM + L  + V+ +P      + SI ++++ FS++      N S+RIY + +   + +    VE K GG     S+   F     NL +R+            P    + +Q +  +       NS      S      +   V +  G+  +  T  + +      +    S ++     +    Y     + +   L   TK+ +   L        DWR+LA+++N  +   YF  K  PT+ +LNLW+ +
Sbjct:  660 LGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPH-CLVAPEQWHVHIYHADSEHDELSVNWRRAVSVGEETINTPMFVQLEATHVFIMTEQLGHFTVVAEP---RIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNSRDICANVEAKLGGSFLGESQVFAFTLNSRNLNIRVRSADVE---AAAPYEHAIPYQHILSN-------NSILHCEFSLRRQDQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECR 1028          

HSP 2 Score: 55.0694 bits (131), Expect = 3.297e-7
Identity = 38/138 (27.54%), Postives = 58/138 (42.03%), Query Frame = 3
Query:  393 ISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCA 800
            ++  +    V E+F    ++C C AW+          V S+ +T+  +Y R +F + P S  L +  + EL C PP   P   + W KN   I     P I V    +LI   V    +  Y C A ++   R S  A
Sbjct:  187 VTATIHRDLVDEFFGDGPFKCECHAWSS------RGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITV-SAGTLIFRQVALQHMANYSCSAENIAGRRVSDSA 317          
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0087382)

HSP 1 Score: 70.8626 bits (172), Expect = 5.187e-12
Identity = 80/383 (20.89%), Postives = 148/383 (38.64%), Query Frame = 3
Query: 1503 FSSIGGHLDIPESGVSLFIPRDAIPIGLSQRI-FLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQ 2642
              S GG L +    + LF+P  AI   + + +  L +S   +      ++  L S V+   P    F K VIL +PH   V   QWH  +  +   +     +W    +   +     +++ +      IM + L  + V+ +P      + SI ++++ FS++      N S+RIY + +   + +    VE K GG     S+   F     NL +R+            P    + +Q +  +       NS      S      +   V +  G+  +  T  + +      +    S ++     +    Y     + +   L   TK+ +   L        DWR+LA+++N  +   YF  K  PT+ +LNLW+ +
Sbjct:  660 LGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPH-CLVAPEQWHVHIYHADSEHDELSVNWRRAVSVGEETINTPMFVQLEATHVFIMTEQLGHFTVVAEP---RIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNSRDICANVEAKLGGSFLGESQVFAFTLNSRNLNIRVRSADVE---AAAPYEHAIPYQHILSN-------NSILHCEFSLRRQDQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECR 1028          

HSP 2 Score: 55.0694 bits (131), Expect = 3.297e-7
Identity = 38/138 (27.54%), Postives = 58/138 (42.03%), Query Frame = 3
Query:  393 ISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCA 800
            ++  +    V E+F    ++C C AW+          V S+ +T+  +Y R +F + P S  L +  + EL C PP   P   + W KN   I     P I V    +LI   V    +  Y C A ++   R S  A
Sbjct:  187 VTATIHRDLVDEFFGDGPFKCECHAWSS------RGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITV-SAGTLIFRQVALQHMANYSCSAENIAGRRVSDSA 317          
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0077921)

HSP 1 Score: 57.3806 bits (137), Expect = 7.415e-8
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  453 CEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            CEA N+   LG A+   SR +T+  +  R  F+  P +  +       LEC  P   P   V W K  +K++      ++++D  +L I++  ++D GQY C A +   VR+S  A + V
Sbjct:   98 CEAKNE---LGVAR---SRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKV 211          
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0335384)

HSP 1 Score: 57.3806 bits (137), Expect = 7.415e-8
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  453 CEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            CEA N+   LG A+   SR +T+  +  R  F+  P +  +       LEC  P   P   V W K  +K++      ++++D  +L I++  ++D GQY C A +   VR+S  A + V
Sbjct:   98 CEAKNE---LGVAR---SRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKV 211          
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Match: pyd (gene:FBgn0262614 transcript:FBtr0305297)

HSP 1 Score: 56.6102 bits (135), Expect = 1.266e-7
Identity = 35/91 (38.46%), Postives = 49/91 (53.85%), Query Frame = 3
Query: 1497 GTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPI------LNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHS 1751
            G F S GG L      VSL IP  AIP G+ Q I+ TVS     + +      + + E +LSP+++CGP+ ++F   V L +PH A  T S
Sbjct: 1961 GFFDSNGGTLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPPLDMENGETMLSPLVMCGPQGLEFLVPVTLNIPHCAGRTAS 2051          
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Match: UNC5C (si:ch73-72b7.1 [Source:ZFIN;Acc:ZDB-GENE-100921-23])

HSP 1 Score: 132.494 bits (332), Expect = 2.049e-31
Identity = 78/247 (31.58%), Postives = 128/247 (51.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVW 2231
            A G+F+S+GGHL IP SGVSL +P  AIP G    +++++ R  + +P + + EA+LS V+ CGP      + VIL + H A      W   +L+S     ++   WE +     ++F    Y+ +  E   I+ ++L  Y +IGQ +  ++ K    I++ VF        D Y IR+Y + +T++  + +  +E + GGKL    K+LNF     NL L +++I   W+     + Q V F  VW
Sbjct:  278 ALGSFNSLGGHLIIPNSGVSLLVPAGAIPQGRVYEMYVSLQRTESMRPPVAEGEAVLSAVVSCGPAGALLTRPVILTLHHCAHAHADNWRI-ILKSH----TQHDQWEDVVVVGEENFTTACYVQLGEEACHILTETLGSYSLIGQSICQSAAKR---IKLAVFGPVVTPGLD-YHIRVYCLDDTEDTLKEVLQIEKQMGGKLLDEPKSLNFTYSNHNLRLSVHDIHCQWRSKLLTKYQEVLFSQVW 515          
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Match: UNC5C (si:ch73-72b7.1 [Source:ZFIN;Acc:ZDB-GENE-100921-23])

HSP 1 Score: 132.494 bits (332), Expect = 5.074e-31
Identity = 78/247 (31.58%), Postives = 128/247 (51.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVW 2231
            A G+F+S+GGHL IP SGVSL +P  AIP G    +++++ R  + +P + + EA+LS V+ CGP      + VIL + H A      W   +L+S     ++   WE +     ++F    Y+ +  E   I+ ++L  Y +IGQ +  ++ K    I++ VF        D Y IR+Y + +T++  + +  +E + GGKL    K+LNF     NL L +++I   W+     + Q V F  VW
Sbjct:  416 ALGSFNSLGGHLIIPNSGVSLLVPAGAIPQGRVYEMYVSLQRTESMRPPVAEGEAVLSAVVSCGPAGALLTRPVILTLHHCAHAHADNWRI-ILKSH----TQHDQWEDVVVVGEENFTTACYVQLGEEACHILTETLGSYSLIGQSICQSAAKR---IKLAVFGPVVTPGLD-YHIRVYCLDDTEDTLKEVLQIEKQMGGKLLDEPKSLNFTYSNHNLRLSVHDIHCQWRSKLLTKYQEVLFSQVW 653          
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 120.168 bits (300), Expect = 3.940e-27
Identity = 102/404 (25.25%), Postives = 183/404 (45.30%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFEN---FSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVF 2684
            ++GTF+ +GG L +P +G+SL IP +AIP G    I+LT+ +    +  L   + LLSPV+ CGP  V   + VIL + H +      W  RL +  Y  +     WE +     D   +  Y  +  E   +  + L  + ++G+ LS  + K    +++++F+  +    + Y+IR+Y   +T++  + +  +E + GG+L      L F D   NL L I+++    W+       Q + F  +W S     +  SF  +R S S +  SC+L  +Q        +L+    K I            + +++D        P       F +    ++++   L    P+G DWR+LA+ + + +   F   K  PT  +L+LW+ Q+     +  L +V 
Sbjct:  461 SYGTFNFLGGRLTLPNTGISLLIPPEAIPRGKIYEIYLTIQKKEDMRLPLAGCQTLLSPVVSCGPPGVMLTRPVILCMDHCSDACLENWAIRLKKQSYEGT-----WEDVLLLGEDLLSEPYYCQLEAETCRVFTEQLGRFALVGESLSMAAAKR---LKLLLFAPAYCSTLE-YNIRVYCTDDTQDLLKEVMQMERQLGGRLIDEPHVLLFKDSYHNLRLSIHDMPHTHWRSKLLAGYQEIPFYHIW-SGSQRTLHCSFTLERQSLSTSDLSCTLCVWQVEGEGQSFSLDFNIAKDI------------RPLDSDFLLLENCSPALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLDRHMSFFASKSSPTSVILDLWETQHFHSGNLNQLAAVM 842          

HSP 2 Score: 78.9518 bits (193), Expect = 1.936e-14
Identity = 77/268 (28.73%), Postives = 126/268 (47.01%), Query Frame = 3
Query:  177 VPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIES---LKXXXXXXXXXXXXXXRTRGCQISL-------CQISDIQYRNCSSYSC 944
            +P FL++  + Y VK +  VT++C + P +     C N ++ +      D  LI    + +  +     K +IS     + V + F    Y C C AW+      +++K F R +     Y R NF++ P+ + + ++Q+L L C PP   P A V W +N++ I+    P+  +    +LII+    +D G Y C A ++   RKS  A + V       +WS WS C + CS +R+R C           CQ  D+Q  NC+S  C
Sbjct:   51 LPHFLIEPDDVYIVK-NKPVTLTCRSTPATQIYFKC-NGEWVH-----QDQHLIDRDVDPATGLPVMQVKIDIS----RQQVEKIFGLEDYWCQCVAWSTT-GTQKSQKAFVRIA-----YLRKNFEEEPLGKEVALDQELLLRCHPPEGVPPAEVEWQRNEELIDPKTDPNFFITTDHNLIIKQTRLADTGNYTCVAKNIVARRKSSSATVIVYVDGGWSEWSKWSPCGADCSMWRSRECTQPTPGTGGKDCQGLDLQSLNCTSEQC 301          
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 111.694 bits (278), Expect = 1.689e-24
Identity = 69/248 (27.82%), Postives = 115/248 (46.37%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A  T  S+GG L IP +GVSL +P   IP G    ++L +++        + ++ +LSPV+ CGP  +   + V+L +PH A +    W   L    +  +     WE + T   +      Y+ V  +   I+++ L  Y ++GQ  S     A   +Q+ +F+        +YS+R+Y I +T  A + +  VE   GG L    K L F D   N+ L I++I    W+     + Q + F  +W
Sbjct:  528 ASATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCAQLEPPDWTLTLKMQNHQGA-----WEEVLTVGEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQ--SAPPRPACKRLQLALFAPRAPCLSLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIW 768          

HSP 2 Score: 75.8702 bits (185), Expect = 1.736e-13
Identity = 60/221 (27.15%), Postives = 101/221 (45.70%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANK---QFSYMGRPVSD--TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P+F  +  + + VK +  V +SC A P +     C  +   Q  ++ +   D  TGL+V +               + + V    V E F    Y C C AW+       A    SR + +  +Y R NF++ P+ + + + Q++ L+C PP   P A V WLKN++ I+ A+  +  +  +  LII+    SD   Y C A ++   R+S  A + V
Sbjct:   48 EPLPEFQSEPEDAFIVK-NRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVRE---------------VDISVSRTQVEELFGLEDYWCQCVAWSS------AGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIV 246          
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 111.694 bits (278), Expect = 1.802e-24
Identity = 69/248 (27.82%), Postives = 115/248 (46.37%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A  T  S+GG L IP +GVSL +P   IP G    ++L +++        + ++ +LSPV+ CGP  +   + V+L +PH A +    W   L    +  +     WE + T   +      Y+ V  +   I+++ L  Y ++GQ  S     A   +Q+ +F+        +YS+R+Y I +T  A + +  VE   GG L    K L F D   N+ L I++I    W+     + Q + F  +W
Sbjct:  510 ASATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCAQLEPPDWTLTLKMQNHQGA-----WEEVLTVGEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQ--SAPPRPACKRLQLALFAPRAPCLSLDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIW 750          

HSP 2 Score: 75.8702 bits (185), Expect = 1.824e-13
Identity = 60/221 (27.15%), Postives = 101/221 (45.70%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANK---QFSYMGRPVSD--TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P+F  +  + + VK +  V +SC A P +     C  +   Q  ++ +   D  TGL+V +               + + V    V E F    Y C C AW+       A    SR + +  +Y R NF++ P+ + + + Q++ L+C PP   P A V WLKN++ I+ A+  +  +  +  LII+    SD   Y C A ++   R+S  A + V
Sbjct:   19 EPLPEFQSEPEDAFIVK-NRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTKESLDHITGLVVRE---------------VDISVSRTQVEELFGLEDYWCQCVAWSS------AGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIV 217          
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Match: ndufaf7 (NADH:ubiquinone oxidoreductase complex assembly factor 7 [Source:Xenbase;Acc:XB-GENE-996599])

HSP 1 Score: 150.214 bits (378), Expect = 2.109e-36
Identity = 118/419 (28.16%), Postives = 196/419 (46.78%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGY 2738
            A+GTF+S+GGHL IP SGVSL IP  A+P G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  T   W  +L        S +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ  S +S K    +++ +F        + Y+IR+Y + +T++A + +   E K GG+L    K L+F     NL L I+++    WK     + Q + F  +W      G   + H   +    +  +  LV             +++    I   N + S    KT++  ST    + P    FS+    +++L   L      G+DWR+LA ++ + +   YF  K  PT  +L+LW+AQN  +  +  L +V +   R + +  L     Y
Sbjct:  512 AFGTFNSLGGHLIIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKENMRPPIEDSQTLLTPVVSCGPPGALMTRPVILTMHHCAETTGEDWKMQL-----KEQSVQGQWEDVVFVGEENFTTPCYIQMESEACHILTETLSTYALVGQSTSKSSAKR---LKLALFGPTSCTSLE-YNIRVYCLDDTQDALKEVIQQERKVGGQLLDEPKTLHFKGSTHNLRLSIHDVPHSLWKSKLLAKYQEIPFYHIWS-----GCQRNLHCTFTLERFSLSTVELVC-------KLCVRQVEGEGQIFQLNCTASEVWGKTIS--STITTIVGP--SAFSIPLTIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKPSPTGVILDLWEAQNYPEGNLSTLAAVLEEMGRHETMISLAGEGKY 905          

HSP 2 Score: 73.559 bits (179), Expect = 1.287e-12
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD-----TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C ++        V++     +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   22 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKCNSEWVHQKDHVVNEKVDETSGLIVRE---------------VSIEISRQQVEELFGLEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPGAEVEWLKNEDVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVGKRRSTTATVIV 220          
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Match: fam20a (family with sequence similarity 20 member A [Source:Xenbase;Acc:XB-GENE-5943784])

HSP 1 Score: 135.191 bits (339), Expect = 1.129e-31
Identity = 111/428 (25.93%), Postives = 193/428 (45.09%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEI-AKGWKINQTPQTQLVKFQTVW-KSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLEL-KXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            +S Y  L   +NN    MA+GTF+ +GG L IP +G+SL IP DAIP G    I+LT+ +    +  L   + LL P+I CGP  V   + V++++ H    +   W  RL +     S     WE +   +      H Y H+   +  +  + L  + ++G+ LS ++ K    +++++F+       + YS+R+Y I +T++A + +   E + GG+L    + L+F D   NL L ++++ +  WK       Q + F  +W  SH +L    +      S+   S    +   +    S  + + L K  +    S     + +   V  ++   PF+             ++++   L      G DWRILA+++N+     F   K  PT  LLN W+AQN     +  L +V     + D
Sbjct:  463 QSYYRTLPRGSNN----MAYGTFNFLGGRLRIPNTGLSLLIPPDAIPRGKIYEIYLTLHKQEDVRLPLAGCQTLLGPIISCGPPGVLLTQPVVVVMDHCVEPSLENWTVRLKKQSCEGS-----WEDVLQLDGGSPSHHYYCHLESRRCYLFTEQLGRFALVGESLSMSATKR---LKLLLFAPPCCTTLE-YSMRVYCINDTQDAIKEVIHHEKQQGGQLMDEPRLLHFKDSYHNLRLSVHDMHSTQWKSKLLASYQEIPFYHIWNGSHQNLHCTFTLERFSLSTWDLSCRIWMWQVEGDGQSFNINVNLSKEHRPSEISLEEGEKEAAALVGPNAFKIPFL------------MRQKIITSLDEPSSHGADWRILAQKLNLDSHLGFFISKSSPTAILLNFWEAQNFPNGNLTQLAAVVAEIGKQD 865          

HSP 2 Score: 78.9518 bits (193), Expect = 2.766e-14
Identity = 62/217 (28.57%), Postives = 105/217 (48.39%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVT-KFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++    Y VK +  VT++C A P +     C        G  V  T  ++    +RS  +     + +IS     + V + F   +Y C C AW+      +++K F R +     Y R NF++ P+S+ + ++Q++ L C PP   P A V WLKN++ ++  V  +I +   +SL++     +D G Y C A ++   R+S  A I V
Sbjct:   15 ELLPHFLIEPESVYIVK-NKPVTLNCKATPATQIYFKCN-------GEWVHQTDHVIQHSADRSTGLPVMEVRIDIS----RQQVEKIFGMDEYWCHCVAWSS-SGTSKSQKAFVRIA-----YLRKNFEQEPLSREVSLDQEVMLLCQPPEGIPPAEVEWLKNEEILDPEVDSNIFIGSDNSLLLRQARLADTGNYTCVAKNIVARRRSNSAAITV 213          
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Match: ndufaf7 (NADH:ubiquinone oxidoreductase complex assembly factor 7 [Source:Xenbase;Acc:XB-GENE-996599])

HSP 1 Score: 134.806 bits (338), Expect = 1.549e-31
Identity = 86/277 (31.05%), Postives = 139/277 (50.18%), Query Frame = 3
Query: 1407 TPINNLFVYDESLYNVLTTKTNNSFDG-MAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            TP ++L  Y   L + +T     +     A+GTF+S+GGHL IP SGVSL IP  A+P G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  T   W  +L        S +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ  S +S K    +++ +F        + Y+IR+Y + +T++A + +   E K GG+L    K L+F     NL L I+++    WK     + Q + F  +W
Sbjct:  457 TPQDDLSDYTSKLSSQITHLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKENMRPPIEDSQTLLTPVVSCGPPGALMTRPVILTMHHCAETTGEDWKMQL-----KEQSVQGQWEDVVFVGEENFTTPCYIQMESEACHILTETLSTYALVGQSTSKSSAKR---LKLALFGPTSCTSLE-YNIRVYCLDDTQDALKEVIQQERKVGGQLLDEPKTLHFKGSTHNLRLSIHDVPHSLWKSKLLAKYQEIPFYHIW 724          

HSP 2 Score: 73.9442 bits (180), Expect = 1.134e-12
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 3
Query:   90 FILYSFLVH--FFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD-----TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            F L+S +    FF +  +T    P +   E +P FL++  E Y VK +  V + C A P +     C ++        V++     +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:    2 FCLFSLVADDDFFHELPET---FPSDPP-EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKCNSEWVHQKDHVVNEKVDETSGLIVRE---------------VSIEISRQQVEELFGLEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPGAEVEWLKNEDVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVGKRRSTTATVIV 225          
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Match: fam20a (family with sequence similarity 20 member A [Source:Xenbase;Acc:XB-GENE-5943784])

HSP 1 Score: 134.42 bits (337), Expect = 1.613e-31
Identity = 111/428 (25.93%), Postives = 193/428 (45.09%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEI-AKGWKINQTPQTQLVKFQTVW-KSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLEL-KXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            +S Y  L   +NN    MA+GTF+ +GG L IP +G+SL IP DAIP G    I+LT+ +    +  L   + LL P+I CGP  V   + V++++ H    +   W  RL +     S     WE +   +      H Y H+   +  +  + L  + ++G+ LS ++ K    +++++F+       + YS+R+Y I +T++A + +   E + GG+L    + L+F D   NL L ++++ +  WK       Q + F  +W  SH +L    +      S+   S    +   +    S  + + L K  +    S     + +   V  ++   PF+             ++++   L      G DWRILA+++N+     F   K  PT  LLN W+AQN     +  L +V     + D
Sbjct:  411 QSYYRTLPRGSNN----MAYGTFNFLGGRLRIPNTGLSLLIPPDAIPRGKIYEIYLTLHKQEDVRLPLAGCQTLLGPIISCGPPGVLLTQPVVVVMDHCVEPSLENWTVRLKKQSCEGS-----WEDVLQLDGGSPSHHYYCHLESRRCYLFTEQLGRFALVGESLSMSATKR---LKLLLFAPPCCTTLE-YSMRVYCINDTQDAIKEVIHHEKQQGGQLMDEPRLLHFKDSYHNLRLSVHDMHSTQWKSKLLASYQEIPFYHIWNGSHQNLHCTFTLERFSLSTWDLSCRIWMWQVEGDGQSFNINVNLSKEHRPSEISLEEGEKEAAALVGPNAFKIPFL------------MRQKIITSLDEPSSHGADWRILAQKLNLDSHLGFFISKSSPTAILLNFWEAQNFPNGNLTQLAAVVAEIGKQD 813          

HSP 2 Score: 71.633 bits (174), Expect = 5.267e-12
Identity = 49/163 (30.06%), Postives = 85/163 (52.15%), Query Frame = 3
Query:  333 LIVTKFNRSNQIDPQGTK-WNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            L+V+ F  S Q+ P G     + + +  + V + F   +Y C C AW+      +++K F R +     Y R NF++ P+S+ + ++Q++ L C PP   P A V WLKN++ ++  V  +I +   +SL++     +D G Y C A ++   R+S  A I V
Sbjct:   20 LLVSGF-LSLQLPPSGLPVMEVRIDISRQQVEKIFGMDEYWCHCVAWSS-SGTSKSQKAFVRIA-----YLRKNFEQEPLSREVSLDQEVMLLCQPPEGIPPAEVEWLKNEEILDPEVDSNIFIGSDNSLLLRQARLADTGNYTCVAKNIVARRRSNSAAITV 175          
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Match: fam20a (family with sequence similarity 20 member A [Source:Xenbase;Acc:XB-GENE-5943784])

HSP 1 Score: 134.42 bits (337), Expect = 1.613e-31
Identity = 111/428 (25.93%), Postives = 193/428 (45.09%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEI-AKGWKINQTPQTQLVKFQTVW-KSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLEL-KXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            +S Y  L   +NN    MA+GTF+ +GG L IP +G+SL IP DAIP G    I+LT+ +    +  L   + LL P+I CGP  V   + V++++ H    +   W  RL +     S     WE +   +      H Y H+   +  +  + L  + ++G+ LS ++ K    +++++F+       + YS+R+Y I +T++A + +   E + GG+L    + L+F D   NL L ++++ +  WK       Q + F  +W  SH +L    +      S+   S    +   +    S  + + L K  +    S     + +   V  ++   PF+             ++++   L      G DWRILA+++N+     F   K  PT  LLN W+AQN     +  L +V     + D
Sbjct:  424 QSYYRTLPRGSNN----MAYGTFNFLGGRLRIPNTGLSLLIPPDAIPRGKIYEIYLTLHKQEDVRLPLAGCQTLLGPIISCGPPGVLLTQPVVVVMDHCVEPSLENWTVRLKKQSCEGS-----WEDVLQLDGGSPSHHYYCHLESRRCYLFTEQLGRFALVGESLSMSATKR---LKLLLFAPPCCTTLE-YSMRVYCINDTQDAIKEVIHHEKQQGGQLMDEPRLLHFKDSYHNLRLSVHDMHSTQWKSKLLASYQEIPFYHIWNGSHQNLHCTFTLERFSLSTWDLSCRIWMWQVEGDGQSFNINVNLSKEHRPSEISLEEGEKEAAALVGPNAFKIPFL------------MRQKIITSLDEPSSHGADWRILAQKLNLDSHLGFFISKSSPTAILLNFWEAQNFPNGNLTQLAAVVAEIGKQD 826          

HSP 2 Score: 71.633 bits (174), Expect = 5.312e-12
Identity = 49/163 (30.06%), Postives = 85/163 (52.15%), Query Frame = 3
Query:  333 LIVTKFNRSNQIDPQGTK-WNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            L+V+ F  S Q+ P G     + + +  + V + F   +Y C C AW+      +++K F R +     Y R NF++ P+S+ + ++Q++ L C PP   P A V WLKN++ ++  V  +I +   +SL++     +D G Y C A ++   R+S  A I V
Sbjct:   20 LLVSGF-LSLQLPPSGLPVMEVRIDISRQQVEKIFGMDEYWCHCVAWSS-SGTSKSQKAFVRIA-----YLRKNFEQEPLSREVSLDQEVMLLCQPPEGIPPAEVEWLKNEEILDPEVDSNIFIGSDNSLLLRQARLADTGNYTCVAKNIVARRRSNSAAITV 175          
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 135.576 bits (340), Expect = 7.050e-32
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  +   W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  532 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIW 770          

HSP 2 Score: 78.1814 bits (191), Expect = 3.744e-14
Identity = 63/222 (28.38%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+ A   +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 135.191 bits (339), Expect = 8.659e-32
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  +   W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  551 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIW 789          

HSP 2 Score: 78.1814 bits (191), Expect = 3.817e-14
Identity = 63/222 (28.38%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+ A   +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 135.191 bits (339), Expect = 8.659e-32
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  +   W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  551 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIW 789          

HSP 2 Score: 78.1814 bits (191), Expect = 3.817e-14
Identity = 63/222 (28.38%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+ A   +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 135.191 bits (339), Expect = 8.930e-32
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  +   W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  477 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIW 715          

HSP 2 Score: 67.0106 bits (162), Expect = 1.106e-10
Identity = 43/142 (30.28%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  393 ISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+ A   +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   48 VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 183          
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Match: Unc5b (unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI:894703])

HSP 1 Score: 125.176 bits (313), Expect = 1.125e-28
Identity = 100/404 (24.75%), Postives = 180/404 (44.55%), Query Frame = 3
Query: 1497 GTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKR 2699
            GTF  +GG L +P +GVSL +P  AIP G    ++L +++  +  P+   ++ +LSP + CGP  +   + V+L VPH A V    W F+L        + +  WE + T + +      Y  +  +   I+L  L  Y  +G+  S ++ K    +Q+ +F+       + YS+R+Y + +T  A + +  +E   GG L    K L F D   NL L +++I    W+     + Q + F  VW       +  +F  +R S +   F+C +   Q         L     ++   S  +   +    +      Y F  P+          ++++   L   +  GNDWR+LA+++++ +   YF  K  PT  +L+LW+A+      +  L S  +   +
Sbjct:  536 GTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCAEVIAGDWIFQL-----KTQAHQGHWEEVVTLDEETLNTPCYCQLEAKSCHILLDQLGTYVFMGESYSRSAVKR---LQLAIFAPALCTSLE-YSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQR-ALHCTFTLERHSLASTEFTCKVCVRQVEGEGQIFQLHTTLAETPAGSLDALCSAPGNAITTQLGPYAFKIPL--------SIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEMGK 921          

HSP 2 Score: 70.8626 bits (172), Expect = 6.905e-12
Identity = 64/221 (28.96%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD-----TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++ ++ Y VK +  V + C A P +     C  +  S       +     TGL V    R  QI+           V  + V E F    Y C C AW+   + G  K   SR + I  +Y R NF + P+++ + ++ ++ L+C PP   P A V WLKN+  I+ A   +  +    +LII     SD   Y C A ++   R+S  A + V
Sbjct:   45 EQLPYFLLEPQDAYIVK-NKPVELHCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLRV----REVQIE-----------VSRQQVEELFGLEDYWCQCVAWS---SSGTTK---SRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIV 243          
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Match: sp|O08747|UNC5C_MOUSE (Netrin receptor UNC5C OS=Mus musculus OX=10090 GN=Unc5c PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 4.931e-31
Identity = 80/248 (32.26%), Postives = 131/248 (52.82%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A  +   W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  532 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIW 770          

HSP 2 Score: 78.1814 bits (191), Expect = 2.619e-13
Identity = 63/222 (28.38%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+ A   +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Match: sp|Q7T2Z5|UNC5C_CHICK (Netrin receptor UNC5C OS=Gallus gallus OX=9031 GN=UNC5C PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 8.283e-31
Identity = 78/248 (31.45%), Postives = 130/248 (52.42%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  A+P G    +++TV R    +P + D++ LL+PV+ CGP      + V+L + H A      W  +L       + + P WE +     ++F    YI +  E   I+ ++L  Y ++GQ ++  + K    +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  +W
Sbjct:  532 AFGTFNSLGGHLVIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKEGMRPPVEDSQTLLTPVVSCGPPGALLTRPVVLTMHHCAEPNMDDWQIQLKH----QAGQGP-WEDVVVVGEENFTTPCYIQLDPEACHILTETLSTYALVGQSITKAAAKR---LKLAIFGPLSCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKTLHFKGSTHNLRLSIHDIAHSLWKSKLPAKYQEIPFYHIW 770          

HSP 2 Score: 77.0258 bits (188), Expect = 6.040e-13
Identity = 62/222 (27.93%), Postives = 100/222 (45.05%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN++ I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVCE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEEVIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Match: sp|O95185|UNC5C_HUMAN (Netrin receptor UNC5C OS=Homo sapiens OX=9606 GN=UNC5C PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 1.254e-30
Identity = 78/248 (31.45%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+G+F+S+GGHL +P SGVSL IP  AIP G    +++TV R    +P ++D++ LL+PV+ CGP      + V+L + H A      W   L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++G    + +  A+  +++ +F        + YSIR+Y + +T++A + I  +E + GG+L    K L+F     NL L I++IA   WK     + Q + F  VW
Sbjct:  532 AFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILL-----KNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGH---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW 770          

HSP 2 Score: 75.8702 bits (185), Expect = 1.346e-12
Identity = 61/222 (27.48%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    + D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Match: sp|Q761X5|UNC5C_RAT (Netrin receptor UNC5C OS=Rattus norvegicus OX=10116 GN=Unc5c PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 3.134e-30
Identity = 79/248 (31.85%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+GTF+S+GGHL IP SGVSL IP  AIP G    +++TV R    +P + D++ LL+PV+ CGP      + VIL + H A      W  +L      N + +  WE +     ++F    YI +  E   I+ ++L  Y ++GQ   + +  A+  +++ +F        + YSIR+Y + +T++A + +  +E + GG+L    K L+F     NL L I++I    WK     + Q + F  +W
Sbjct:  532 AFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPNTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQ---STTKAAAKRLKLAIFGPLCCSSLE-YSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDITHSLWKSKLLAKYQEIPFYHIW 770          

HSP 2 Score: 76.2554 bits (186), Expect = 1.135e-12
Identity = 62/222 (27.93%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD------TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C N ++ +    V D      +GLIV +               +S+ +  + V E F    Y C C AW+       A    SR + +  +Y R  F++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +    +LII+    SD   Y C A ++   RKS  A + V
Sbjct:   59 EPLPHFLIEPEEAYIVK-NKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDERVDETSGLIVRE---------------VSIEISRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPMAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIV 257          
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Match: sp|C5IAW9|UN5BB_XENLA (Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 GN=unc5b-b PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 3.480e-28
Identity = 105/411 (25.55%), Postives = 180/411 (43.80%), Query Frame = 3
Query: 1497 GTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVL 2720
            GTF S+GG L  P +GVSL IP+ AIP G    ++L +++           + +LSP+I CGP  +   K VIL VPH A +T S W  +L        S + +WE + T N +      Y  +      I+L  L  Y  +G+  S ++ K    +Q+ +F+       + Y++++Y + +T +A + +  +E   GG L    K L F D   NL L I++I    W+     + Q + F  VW    S   ++        S   +     +  +      ++     S +    S   F   +E +V      Y F  P           ++++   L   +  GNDWR+LA+++ + +   YF  K  PT  +L+LW+A +     +  L S  +   + + + V+
Sbjct:  545 GTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCADITTSDWILQL-----KTQSHQGNWEEVVTLNEETLNTPCYCQLESHSCHILLDQLGTYAFVGESYSRSAIKR---LQLAIFAPMLCTSLE-YNLKVYCVEDTPDALKEVLELEKTLGGYLIEEPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHVWSG--SQRTLHCTFTLERYSLAATELTCKICVRQVEGEGQIFQLHTSLEENVKSFDPFCSHAENSVTTQLGPYAFKIPFL--------IRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVM 936          

HSP 2 Score: 75.485 bits (184), Expect = 1.734e-12
Identity = 63/221 (28.51%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC----ANKQFSYMGRPVSD-TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  + Y VK + +V + C A+P +     C     N+        V D TGL+V    R  QI+           V  + V E F    + C C AW+       A    S+ S +  +Y R NF + P+ + + + Q+  L+C PP   P A V WLKN++ I+     +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   48 ESLPHFLLEPEDAYIVK-NKAVELVCKANPATQIYFKCNGEWVNQNDHITKERVDDVTGLVV----REVQIE-----------VSRQQVEELFGLEDFWCQCVAWSS------AGTTKSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDSTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIV 246          
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Match: E1CHK7 (Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Djunc5A PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 6.776e-57
Identity = 112/224 (50.00%), Postives = 144/224 (64.29%), Query Frame = 3
Query:  135 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADI 806
            + DL+ P E   +G+PKFLV+   FYYV   H   I C+A+PVSH NI CA+KQFSYM    S++GLIV K N  NQ D +G +W  SL V +K V EWFS+Y+C CEAWNQI  + + KKV S  + I ESYF+++FK  P SQ L    KLEL+C PP +KP + V WLKN + I ++ FP I + +   LIIE V +SD G Y C A S  +V+KS  A I
Sbjct:   45 KKDLVQPNEKHYDGIPKFLVEPHPFYYVNKTHPALIICVAEPVSHVNIFCADKQFSYMNTERSESGLIVIKMNHLNQPDSKGNRWKFSLEVKYKDVLEWFSEYKCYCEAWNQITMINKDKKVHSSAALIQESYFQNDFKTTPKSQELREGNKLELQCTPPESKPNSKVTWLKNDELITQSNFPLIIIDESKRLIIEQVLKSDSGNYTCVAQSQGVVKKSKPAVI 268          

HSP 2 Score: 194.126 bits (492), Expect = 6.388e-47
Identity = 137/424 (32.31%), Postives = 228/424 (53.77%), Query Frame = 3
Query: 1479 FDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILST---TNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIG--QPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKE--DPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERN 2729
             D +AWGT ++ GG L +P+SG+SL IPR AI  G S+ +FL V R   + P+++  E LLSPVI+CGP  +   KSVIL +PH A +  S W+ R+L +++ NS   P W+ LST    N  D   +IY  +    + +++  L M C+ G   PLS +S   SI ++I+ FS     E D + IR++ IP+TKEA E++   E K  G+L   SK   F   G ++ L +++++ GW+ + + + Q   +  +W+ + S      F  +    +   FSC++   Q     N+V + +   +S N+ +        ++ NN   +  ++ P+   F LS  T+++L  LL   DPS   W+ LA  M +     +  E   P+D+LL+LW+A+   +  I DL+++ +   R DC  ++E++
Sbjct:  586 LDTIAWGTITTAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHTNIPVIDMMEMLLSPVILCGPPQIQLLKSVILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTIRPVNRSD--SNIYAQLDSTSAHLIIDQLQMICITGCLSPLSDSS--VSIRLRILAFSLPLSSELD-HIIRVHLIPDTKEAIENVIASELKLNGQLLDNSKKFTFSSSGGDIALCLDDLSLGWRCHSSNKMQTFSYSFIWRLNHSQNQEIHFLLEHVDPTRTGFSCNITIQQIDLPQNQVIVRVIKERSPNNRSIIPISLDSRS-NNREFSQAYLDPLQTVFRLSFTTRQQLWPLL---DPS---WQTLANHMLLNGNLNYFSEKMSPSDALLDLWEARCRDEGAIADLINILRVIGRNDCAMIVEQD 997          
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Match: A0A0X3NMZ1 (Netrin receptor UNC5C OS=Schistocephalus solidus OX=70667 GN=UNC5C PE=4 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 5.943e-53
Identity = 98/229 (42.79%), Postives = 139/229 (60.70%), Query Frame = 3
Query:  141 DLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLK 827
            DL+ P E++LEGVP  + Q ++ YY          C+A+PVSHA ++CA+++F +M    SD  L V + + +N+  P G++W+I L V  K V EWF  YEC CE WNQIPAL R KKVFS  +TI E+Y    F+  PI + + V Q+L L C PP  KPT  + WLK+  ++N + FPHI + D + LIIE VT  D G Y C A +L I ++   A +  +E ++
Sbjct:   97 DLVQPHEVNLEGVPVIISQPKKVYYAWEGRPAVFECVAEPVSHAVVLCADQKFPFMAPGTSDR-LRVIQLDSTNRPTPGGSRWHIQLQVRAKDVEEWFGAYECTCEVWNQIPALKRVKKVFSENATIKEAYLEREFQLEPIPEQVTVGQRLLLSCQPPRGKPTPNLYWLKDGARVNHSTFPHIVINDYNQLIIEQVTVGDFGNYTCVADTLGIEKRYASAQVTEVEVVR 324          

HSP 2 Score: 77.411 bits (189), Expect = 1.463e-10
Identity = 41/101 (40.59%), Postives = 57/101 (56.44%), Query Frame = 3
Query: 1470 NNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLL 1772
            N+    + W T S  GG + IPE+G+ L+IP DA+  G+S+ I+L   R     P L DN+ LLSPVI  GP  +   K ++L  PH A V+   W F +L
Sbjct:  729 NSEMGTVTWSTVSGFGGRISIPETGIHLYIPADALAPGISREIYLAACRDQKFWPNLTDNQTLLSPVIQFGPPGLPLLKPLVLTFPHCAQVSQGNWSFSIL 829          
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Match: A0A564YGK8 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6165 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 2.309e-51
Identity = 97/251 (38.65%), Postives = 141/251 (56.18%), Query Frame = 3
Query:   78 MERYFILYSFLVHFFSDAL----QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRP-VSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVI 815
            M    IL + L++  S A     Q D++   E  LEGVP F+ Q    YY          C+A+PVSHA + CA+K F YMG    ++  L VT+ + +  +D  G +W ISL +  K + EWF  Y C CE WN IPAL + KKVFS+ +T++E+Y   +F++ PI + L+  Q+L L C PP  +P   V WLKN K+++   FPHI + D + LI+  V   D G Y C A +L I ++   A++ V+
Sbjct:    1 MNPEIILINVLLYISSGAADASHQKDIVQAHERHLEGVPVFIQQPENVYYAWRGKPAVFECIAEPVSHAVVFCADKTFPYMGNEHTNEQRLQVTRLDSNGNLDADGARWKISLPIRTKDLEEWFDAYVCTCEVWNLIPALKQDKKVFSKNATVVEAYLDRDFQQGPIPEQLVKGQRLLLSCQPPKGEPAPKVYWLKNGKRVDRQTFPHIVIDDYNRLIVNQVELQDEGNYTCVADTLGIEQRYSTAEVTVL 251          
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Match: A0A074ZFP6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06649 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.995e-51
Identity = 105/250 (42.00%), Postives = 144/250 (57.60%), Query Frame = 3
Query:   78 MERYFIL-YSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESL 824
            + RY I+ +  L H ++   Q DL+ P+E  LEGVP FL   +  YY    H  TI C+A+PVSHA I CA +   Y G P     L VT+ +  NQ DP G +W++ L V  K V EWF  Y C CEAWN++  L R KKVFS+ + ++E+Y    F+  P+S +L   ++L L C+PP  KP   V WLK+ K++N+  F HI + D + LIIENVTE D G Y C A  L +  +   A + V  +L
Sbjct:    3 LRRYLIICFLILFHLYTADSQKDLVQPDETHLEGVPFFLKHPKPLYYTMKGHPATIDCVAEPVSHAVIECAEQIIPYKG-PDEPGRLKVTRLDSDNQPDPNGKRWHLELQVRAKEVEEWFDSYVCRCEAWNKVIELQRPKKVFSKEAVVIEAYLDRKFQLEPVSTDLSYGKRLVLTCIPPKGKPEPEVYWLKDGKRVNKDNFAHIILNDYNHLIIENVTEKDAGNYTCVAECLGMEYRYAMAKVTVTANL 251          

HSP 2 Score: 104.375 bits (259), Expect = 7.519e-19
Identity = 101/453 (22.30%), Postives = 188/453 (41.50%), Query Frame = 3
Query: 1515 GGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWE------------------------------ILS--------TTNNDDF-----GQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNK------------------ASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLK--EDPTDSLLNLWQAQNPQKFYIKDLMSVF 2684
            GG +    SGV L +P+ A+     + +++ + R    +PIL D++ LLSPV+  GP  +   + V+L  PH AA+    W+ R++ +   ++   P  E                              IL+         +  D++        I  H+   +  ++ +    YC+IG+ L     +                  A   +++  +S       D Y+IR+Y +P+ ++  E +   E +  G +   +  L F+D G+ +   I +++KGW+      TQ V F+ +W       +  +F  +    + NS SC ++A+Q  N+  R  L + S    N +            N    A P     F  F +   T++ +   + +     N+W+ LA+ M ++    +L    +PT+SLLNLW+A + Q  Y+  L ++F
Sbjct:  708 GGLICSSTSGVYLKVPQGAVHGMSEEPVYVAICRDERIRPILGDHQTLLSPVVQFGPISMHPHQEVVLSFPHCAALDEGPWYLRVVATGVQSALTIPKCEDGKGTKPKICDCNSLFQEYEQGHDSVTRSSILTCWKEVCAVVSQKDEYEIIKSQPGITCHINTSEVHLLTQRPQRYCLIGESLRPKCEQQKLELLPVWPANIRTDGPAKKMLRLTAYSARPTPTMD-YNIRVYILPDIQDILEHVKATELRLDGYVLDTTDPLPFYDTGQGMCFSIEDVSKGWRSRLHMNTQEVPFRHIWGGTQLPTLHCAFTLEHIDHTQNSVSCRIIAFQGMNWEQRKVLHISSDCIDNVT---------SNTNTVPVAIPNNKKTF--FRIKDSTREIICDFMNMQ----NNWQDLAKGMKLESHVPYLANLANPTESLLNLWEAAHRQDQYLGGLKNIF 1144          
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Match: A0A1S8X6W1 (Immunoglobulin I-set domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01654 PE=4 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 1.230e-50
Identity = 95/227 (41.85%), Postives = 130/227 (57.27%), Query Frame = 3
Query:  135 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVI 815
            + D++ P+E  LEGVP+F+   +  YY    H   + C+A+PVSHA ++CA K   Y G P  +  L VT+ + +NQ DP G++W++ L +  K V EWF  Y C CEAW+++  L R KKV SR S I+E+Y    F+  PIS NL V  +L L CVPP  KP   V WLK+   I     P I + D + LIIEN TE D G Y C A  L +  +   + + VI
Sbjct:    5 EVDIVRPDEAHLEGVPQFIQHPKSVYYTMKGHPAILDCLAEPVSHAAVVCAGKVIPYRG-PEEEGRLKVTRLDANNQPDPTGSRWHLELQIFAKEVEEWFDSYTCRCEAWSRVTKLQRPKKVLSRESVIIEAYLEQKFQVEPISTNLTVGDRLTLSCVPPRGKPEPEVYWLKDGIPIKPGTMPQILMNDYNQLIIENATEHDSGNYTCVAECLAVEYRFAQSTVKVI 230          
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Match: unc5c (unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-030131-9196])

HSP 1 Score: 144.436 bits (363), Expect = 8.062e-35
Identity = 82/248 (33.06%), Postives = 135/248 (54.44%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A+G+F+S+GGHL +P SGVSL +P  AIP G    +++TV R    +P ++D + +LSPV+ CGP      + VI+ + H A      W  + LRS+    S++  WE +     ++F    YI +  E   I+ ++L  YC++GQ +S  + K    +++ VF        + Y+IR+Y + +T++A + +  +E + GGKL    K LNF D   NL L ++++    WK     + Q + FQ VW
Sbjct:  529 AFGSFNSLGGHLIVPNSGVSLLVPAGAIPQGRVYEMYVTVHRKETMRPSVDDTQTVLSPVVSCGPPGALLTRPVIITMHHCAEADSEDWLIQ-LRSQ----SQQGQWEDVVVVGEENFTTPCYIQMDEEACHILTETLGTYCLVGQSVSAATTKR---LKLAVFGPVTCTALE-YNIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLNFKDSTHNLRLSLHDVPHTLWKSKLLAKYQELSFQHVW 767          

HSP 2 Score: 73.559 bits (179), Expect = 7.482e-13
Identity = 59/221 (26.70%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C       K+ +   R    +GL+V +                S+ +  + V E F    + C C AW+       A    SR + +  +Y R  F + P+ + + + Q++ L+C PP   P A V WLKN++ I+ A   +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   55 EPLPHFLMEPEEAYIVK-NKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDETSGLVVRE---------------ASIEITRQQVEELFGLEDFWCQCVAWSS------AGTTKSRKAHVRIAYLRKTFDQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIV 253          
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 119.783 bits (299), Expect = 3.838e-27
Identity = 107/419 (25.54%), Postives = 192/419 (45.82%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVF 2684
            +S +  L   T N+    ++GTF+ +GG L +P +G+SL IP +AIP G    I+LTV R    +  L   + L+SPVI CGP  V   + VI+ + H +      W  RL +  Y  +     WE +     +   +  Y  +  E   +  + L  + ++G+ LS  + K    +++++F+  +    + Y+IR+Y   +T++  + +  +E + GG+L      L F D   NL L I+++ +  W+       Q + F  +W       +  +F  +R S S    SC+L  +Q        +L+    K     +S F       V+N + A     P    F +    ++++   L    P+G DWR+LA+ + +++   F   K  PT  +L+LW+ Q+     +  L +V 
Sbjct:  421 QSYFKTLPRDTVNT----SYGTFNFLGGRLTLPNTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLMSPVISCGPPGVVLTRPVIISMDHCSDACPENWAIRLKKQSYEGT-----WEDVLLLGEELVSEPYYCQLEAETCRVFTEQLGRFALVGESLSMAAAKR---LKLLLFAPAYCSTLE-YTIRVYCTDDTQDLIKEVMQMEAQLGGRLIDEPHVLLFKDSYHNLRLSIHDLPQAHWRSKLLTGYQEIPFYHIWSGSQRY-LHCTFTLERLSVSTCELSCTLCVWQVEGEGQSFSLDFNISKDNRPLDSDFLL-----VDNSTPA--LAGP--SAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLERHMSFFASKASPTSVILDLWEVQHFHSGNLNQLAAVM 816          

HSP 2 Score: 82.0333 bits (201), Expect = 1.780e-15
Identity = 78/270 (28.89%), Postives = 128/270 (47.41%), Query Frame = 3
Query:  174 GVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCAD----INVIESLKXXXXXXXXXXXXXXRTRGCQISL-------CQISDIQYRNCSSYSC 944
            G P FLV+  + Y VK +  VT++C + P +     C N ++ +      D  LI    + +  +     K +IS     + V + F    Y C C AW+      +++K + R +     Y R NF++ P+ + + ++Q++ L C PP   PTA V W +N++ I+    P+  +    +LII+    +D G Y C A ++   RKS  A     +N   S +WS WS C + C+ +R+R C           CQ  D+Q  NC+S  C
Sbjct:   34 GFPHFLVEPDDVYIVK-NKPVTLTCRSTPATQIYFKC-NGEWVH-----QDDHLIERTVDPATGLPVMQVKIDIS----RQQVEKIFGLEDYWCQCVAWSTT-GTQKSQKAYVRIA-----YLRKNFEEEPLGKEVALDQEVLLRCHPPEGVPTAEVEWQRNEELIDPKADPNFFITVDHNLIIKQARLADTGNYTCVAKNIVARRKSSSAAVIVYVNGGWSTEWSKWSACGTDCTMWRSRECTQPAPGTGGKSCQGLDLQSLNCTSEQC 286          
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 119.013 bits (297), Expect = 7.716e-27
Identity = 113/453 (24.94%), Postives = 204/453 (45.03%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCV-------SVLERNEGYRL*NSKTFI 2765
            +S +  L   T N+    ++GTF+ +GG L +P +G+SL IP +AIP G    I+LTV R    +  L   + L+SPVI CGP  V   + VI+ + H +      W  RL +  Y  +     WE +     +   +  Y  +  E   +  + L  + ++G+ LS  + K    +++++F+  +    + Y+IR+Y   +T++  + +  +E + GG+L      L F D   NL L I+++ +  W+       Q + F  +W       +  +F  +R S S    SC+L  +Q        +L+    K     +S F       V+N + A     P    F +    ++++   L    P+G DWR+LA+ + +++   F   K  PT  +L+LW+ Q+     +  L +V     + + +        VL     Y + N+ T+I
Sbjct:  426 QSYFKTLPRDTVNT----SYGTFNFLGGRLTLPNTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLMSPVISCGPPGVVLTRPVIISMDHCSDACPENWAIRLKKQSYEGT-----WEDVLLLGEELVSEPYYCQLEAETCRVFTEQLGRFALVGESLSMAAAKR---LKLLLFAPAYCSTLE-YTIRVYCTDDTQDLIKEVMQMEAQLGGRLIDEPHVLLFKDSYHNLRLSIHDLPQAHWRSKLLTGYQEIPFYHIWSGSQRY-LHCTFTLERLSVSTCELSCTLCVWQVEGEGQSFSLDFNISKDNRPLDSDFLL-----VDNSTPA--LAGP--SAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLERHMSFFASKASPTSVILDLWEVQHFHSGNLNQLAAVMAEIGKQEAMIFPGVGWGVLTHTHTYSI-NTHTYI 854          

HSP 2 Score: 80.4925 bits (197), Expect = 5.816e-15
Identity = 77/269 (28.62%), Postives = 127/269 (47.21%), Query Frame = 3
Query:  174 GVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIES---LKXXXXXXXXXXXXXXRTRGCQISL-------CQISDIQYRNCSSYSC 944
            G P FLV+  + Y VK +  VT++C + P +     C N ++ +      D  LI    + +  +     K +IS     + V + F    Y C C AW+      +++K + R +     Y R NF++ P+ + + ++Q++ L C PP   PTA V W +N++ I+    P+  +    +LII+    +D G Y C A ++   RKS  A + V       +WS WS C + C+ +R+R C           CQ  D+Q  NC+S  C
Sbjct:   40 GFPHFLVEPDDVYIVK-NKPVTLTCRSTPATQIYFKC-NGEWVHQ-----DDHLIERTVDPATGLPVMQVKIDIS----RQQVEKIFGLEDYWCQCVAWSTT-GTQKSQKAYVRIA-----YLRKNFEEEPLGKEVALDQEVLLRCHPPEGVPTAEVEWQRNEELIDPKADPNFFITVDHNLIIKQARLADTGNYTCVAKNIVARRKSSSAAVIVYVDGGWSEWSKWSACGTDCTMWRSRECTQPAPGTGGKSCQGLDLQSLNCTSEQC 291          
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 119.013 bits (297), Expect = 9.096e-27
Identity = 113/453 (24.94%), Postives = 204/453 (45.03%), Query Frame = 3
Query: 1437 ESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFL--KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCV-------SVLERNEGYRL*NSKTFI 2765
            +S +  L   T N+    ++GTF+ +GG L +P +G+SL IP +AIP G    I+LTV R    +  L   + L+SPVI CGP  V   + VI+ + H +      W  RL +  Y  +     WE +     +   +  Y  +  E   +  + L  + ++G+ LS  + K    +++++F+  +    + Y+IR+Y   +T++  + +  +E + GG+L      L F D   NL L I+++ +  W+       Q + F  +W       +  +F  +R S S    SC+L  +Q        +L+    K     +S F       V+N + A     P    F +    ++++   L    P+G DWR+LA+ + +++   F   K  PT  +L+LW+ Q+     +  L +V     + + +        VL     Y + N+ T+I
Sbjct:  482 QSYFKTLPRDTVNT----SYGTFNFLGGRLTLPNTGISLLIPPEAIPRGKIYEIYLTVQRKEDLRLPLAGCQTLMSPVISCGPPGVVLTRPVIISMDHCSDACPENWAIRLKKQSYEGT-----WEDVLLLGEELVSEPYYCQLEAETCRVFTEQLGRFALVGESLSMAAAKR---LKLLLFAPAYCSTLE-YTIRVYCTDDTQDLIKEVMQMEAQLGGRLIDEPHVLLFKDSYHNLRLSIHDLPQAHWRSKLLTGYQEIPFYHIWSGSQRY-LHCTFTLERLSVSTCELSCTLCVWQVEGEGQSFSLDFNISKDNRPLDSDFLL-----VDNSTPA--LAGP--SAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLERHMSFFASKASPTSVILDLWEVQHFHSGNLNQLAAVMAEIGKQEAMIFPGVGWGVLTHTHTYSI-NTHTYI 910          

HSP 2 Score: 79.337 bits (194), Expect = 1.385e-14
Identity = 60/215 (27.91%), Postives = 103/215 (47.91%), Query Frame = 3
Query:  174 GVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            G P FLV+  + Y VK +  VT++C + P +     C N ++ +      D  LI    + +  +     K +IS     + V + F    Y C C AW+      +++K + R +     Y R NF++ P+ + + ++Q++ L C PP   PTA V W +N++ I+    P+  +    +LII+    +D G Y C A ++   RKS  A + V
Sbjct:   40 GFPHFLVEPDDVYIVK-NKPVTLTCRSTPATQIYFKC-NGEWVHQ-----DDHLIERTVDPATGLPVMQVKIDIS----RQQVEKIFGLEDYWCQCVAWSTT-GTQKSQKAYVRIA-----YLRKNFEEEPLGKEVALDQEVLLRCHPPEGVPTAEVEWQRNEELIDPKADPNFFITVDHNLIIKQARLADTGNYTCVAKNIVARRKSSSAAVIV 237          
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 107.457 bits (267), Expect = 2.763e-23
Identity = 68/248 (27.42%), Postives = 111/248 (44.76%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            A  T   +GG L IP +GVSL +P   IP G    ++L +++           + +LSPV+ CGP  +   + VIL +PH A +    W   L       +     WE + T   +      Y+ V  +   ++++ L  Y ++GQ  S     A   +Q+ +F+        +YS+R+Y I +T  A + +  +E   GG L    K L F D   NL L I++I    W+     + Q + F  +W
Sbjct:  484 ASATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCAQLEPPDWSLTL------KTQTNQAWEEVLTVGEESLSSPCYLQVEEQNCHVLMEQLGTYGLVGQ--SVPPQPACKRLQLALFAPRAPCLSLDYSLRVYCIHDTPHALKEVLELERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIW 723          

HSP 2 Score: 72.7886 bits (177), Expect = 1.305e-12
Identity = 67/258 (25.97%), Postives = 111/258 (43.02%), Query Frame = 3
Query:   69 SPKMERYFILYSFLVHFFSDALQTDLILPEEMD---LEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANK---QFSYMGRPVSD--TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            +P +    +  SF+  + +D      +LP+       E +P+F  +  + + VK +  V +SC A P +     C  +   Q  ++ R   D  TGL+V + + S               V    V E F    Y C C AW+       A    SR + +  +Y R NF++ P+ + + + Q++ L+C PP   P A V WLKN+  I+     +  +     LII+    SD   Y C A ++   R+S  A + V
Sbjct:   13 APLLALVLVCGSFV--YGADGSDYSEVLPDSFPSAPAEPLPEFQSEPEDAFIVK-NRPVKLSCKAAPATQIYFKCNGEWVNQNDHVTRESLDQITGLVVREVDIS---------------VSRTQVEELFGLEDYWCQCVAWSS------AGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIV 246          
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010609.1 (pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1 gene:ENSPMAG00000009605.1 transcript:ENSPMAT00000010609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 2.343e-30
Identity = 108/407 (26.54%), Postives = 183/407 (44.96%), Query Frame = 3
Query: 1494 WGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSC-IMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQT-QLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKT--EYF-LKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKR 2699
            +GTF  +GG L IP SG+SL +P  AIP G   +++LTV R    +P+L  ++ LLSPV+ CGP  V     VIL + H A +    W   L R   ++S     WE +     +            E++C ++ ++   Y V+G+ L   + K    +++  F+ +     + YS+R+Y + +  E+   +  +E + GG+L      L+F     NL L I+ I      N+   T Q + F  VW     L  ++       +   ++     +  Q      +V L+L+         ++ S + +      S     + P  + F L    +++L   L   +P GNDWR+LA  + I     EYF  +  PT  +L+LW+AQ+ +   +  L SV +   R
Sbjct:  578 YGTFGCMGGRLVIPNSGLSLLVPPGAIPSGQFYQMYLTVHRDEDKRPVLEGSQTLLSPVVSCGPPSVPLLSPVILSLRHCAELNSEDWALGLKRQ--LDSGH---WEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEALGPAAVKR---LRLAAFAPSVCPSLE-YSLRLYCLNDDAESLAEVVELEKQLGGRLLEEPTTLSFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPGCQRL--LHCTFALERAGLSSTEFSCKLCVQQLEGEGQV-LQLR-----TTLLNAPSATDDSPTEAASAGSALVGP--QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINSASMEYFETRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGR 965          

HSP 2 Score: 81.2629 bits (199), Expect = 8.463e-16
Identity = 65/221 (29.41%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSD-----TGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +  + Y V+ +  VT+SC A P +     C  +        + +     TG  V    R  Q D           V  + V E F    Y C C AW+   A G +K   SR + +  +Y R NF++ P+ +++L++ ++ L C PP+A P A V WLKN++ I+  +  +  +    +LII+    +D   Y C A +L   R+S  A I V
Sbjct:   55 EPLPHFLQEPEDAYIVR-NKPVTMSCAASPATQIYFKCNGEWLHQKAHHIEERVDETTGRSV----REVQTD-----------VSRQQVEELFGLEDYWCQCVAWS---AAGTSK---SRKAYVRIAYLRKNFEQEPLGKDVLLDHEVLLHCRPPDAIPQAEVEWLKNEEIIDPVIDQNFYITVDHNLIIKQTRLADSANYTCVAKNLVAKRRSSTATITV 253          
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 8.075e-26
Identity = 112/420 (26.67%), Postives = 173/420 (41.19%), Query Frame = 3
Query: 1482 DGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDD-----FGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQII--VFSENFYQECDNYSIRI----YTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQT-QLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYF-LKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKR 2699
            D   +GTF  +GG L I  SGVSL +P  AIP G   ++++T+ R    +P L +++ LLSPV+ CG   V     VIL + H A ++   W   L R      S  P  E+L              Q + + VT   +   L S   YC             S F+ +   V  ++++  C     R+    Y   +T + F+ +  +E + GG+L      LNF     NL L I+ I      N+   T Q + F  VW     L          S SS        V    G       L+L+         ++ S + +      S     + P  + F L    +++L   L   +P GNDWR+LA  + I +   YF ++  PT  +L+LW+AQ+ +   +  L SV +   R
Sbjct:  509 DTTVFGTFCCLGGRLTIAHSGVSLLVPPGAIPPGQFYQMYITIHREKEKRPALENSQTLLSPVVSCGAPSVPLLSPVILSLRHCAELSPEDWALSLKR----QLSSGPWEEVLRQGEEPARPPSCHWQRVSVSVTSTTA--HLVSFCYYC-------------SSFMSVCGRVCHQDYFSPCLCVCGRVCHQYYCSSSTHDQFKEVVELEKQLGGRLLEEPTTLNFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPGCQRLLHCTFALERASLSSTEFSCKLCVQQLEGEGQ---VLQLR-----TTLLNAPSATDDSPTEAASAGSALVGP--QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINRYGNYFEMRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGR 899          

HSP 2 Score: 65.4698 bits (158), Expect = 5.829e-11
Identity = 59/223 (26.46%), Postives = 100/223 (44.84%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC----ANKQFSYMGRPVSD-TGLIV----TKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +  + + V+ +  VT+ C A P +     C     +++  Y    +S+ TG +V    T  +R    DP                      + C C AW+   A G  K   SR + +  ++ R NF++ P+ +++ +N ++ L C PP A P A V W+K+K+ I+     +  +    +LII+    SD   Y C A +L   R+S  A + V
Sbjct:    8 EPLPIFLTEPNDGFIVQ-NKPVTLDCSASPATQIYFKCNGEWLHQKALYTQEHLSEITGKVVREVHTNVSRQQVEDPYR-----------------LEDFWCQCVAWS---ASGTTK---SRKAFVKVAHLRKNFEQEPLGKDVPLNHEVLLHCRPPEAIPPAEVEWMKDKELIDPEEDSNFYITVDHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTV 206          
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003861.1 (pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 gene:ENSPMAG00000003466.1 transcript:ENSPMAT00000003861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 6.539e-21
Identity = 65/247 (26.32%), Postives = 112/247 (45.34%), Query Frame = 3
Query: 1494 WGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG-WKINQTPQTQLVKFQTVW 2231
            + TF  +GG L IP SGV L +P  AIP G   +++LTV R     P+L+ ++ LLSPV+ CGP  +     VIL + H A ++   W   L R       E    E+L            +  +      ++ ++   Y V+G+ L   + K    +++  F+ +     + YS+R+Y + +  E+   +  +E + GG +      L+F     +L L ++ +    W  N   + Q + F  VW
Sbjct:  528 YATFGCLGGRLLIPSSGVGLLVPPGAIPHGHFYQMYLTVHRGEDSGPVLDGSQTLLSPVVSCGPPSIPLLSPVILSLRHCAELSPEDWALSLKRQLSSGHWE----EVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEALGPAAVKR---LRLAAFAPSVCPSLE-YSLRLYCLNDDTESLAEVVELEKRLGGHMVGEPSTLHFKANSGHLQLSMHAVPDTLWTNNVHSKLQEIPFWHVW 766          

HSP 2 Score: 77.7962 bits (190), Expect = 8.712e-15
Identity = 64/219 (29.22%), Postives = 97/219 (44.29%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLI---VDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +L + Y V+ +  VT+SC A P +     C  +  S     V              Q   QGT  ++  +   V  + V  ++    Y C C AW+   A G +K   SR + +  +Y   NF+  P  +     QK++L C PP+A P A V WLKN+  I+     +  +    +LII+    SD   Y C A +L   R+S  A + V
Sbjct:   34 EPLPHFLQELEDAYIVR-NKPVTMSCAASPATQIYFKCNAEWVSQQAHHV-------------QQRTDQGTGRSVREVQTDVSRQQVEVYYGPEPYWCQCVAWS---AAGTSK---SRKAYVRIAYLHKNFEMEPQGKEEPQGQKIQLHCRPPDAVPPAEVEWLKNEMLIDPEEDSNFHITADHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTV 232          
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Match: tjp1a (tight junction protein 1a [Source:ZFIN;Acc:ZDB-GENE-031001-2])

HSP 1 Score: 78.1814 bits (191), Expect = 8.427e-15
Identity = 45/120 (37.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query: 1449 NVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDN--EALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEK 1802
            + L+ +  +S    A G F S GG L   E+GVS+ +PR AIP GL Q I+  V + ++  P L+    E LLSP+++CGP  + F K V L +PH AA+    W F L  S+ +    +
Sbjct: 1624 SALSEEEGHSVVATARGVFDSNGGVLSSVETGVSVVVPRGAIPEGLEQEIYFKVCQDNSIIPALDKEKGETLLSPLVMCGPHGLRFLKPVELRLPHCAAMNPDGWSFALKSSESITGDPR 1743          
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002817.1 (pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-1 gene:ENSPMAG00000002526.1 transcript:ENSPMAT00000002817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.364e-10
Identity = 34/82 (41.46%), Postives = 49/82 (59.76%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDN--EALLSPVIICGPEIVDFEKSVILIVPH 1730
            A G F + GG L   E+GVS+ IP+ AIP  + Q I+  V + ++  P L+    E LLSP+++CGP  + F K V L +PH
Sbjct: 1592 ARGVFDTHGGVLSSVETGVSIIIPKGAIPPAVEQEIYFKVCKDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPH 1673          
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Match: EDO46601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN0])

HSP 1 Score: 108.997 bits (271), Expect = 3.985e-24
Identity = 70/259 (27.03%), Postives = 124/259 (47.88%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYS----IRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILR--INEIAKGWKINQTPQTQLVKFQTVWKSHDSL 2249
            AWG     GG L IP +G+SL++P  A+P G  + I++ + + SA  P L   +ALLSP ++CGPE + F + V L +PHNAA+ + +      +++   S++   W  L + + D   + I  ++      +ML       V+G+P         + I+++ F      +CD       +++Y IP TK A E      ++ G       K  +  +   ++ ++  ++E+   WK   TP  Q + F  VW S + +
Sbjct:  599 AWGRIDHNGGQLVIPNTGISLYVPPSALPQGQEEVIYIAMMKRSAKYPQLRPGQALLSPAVVCGPEGLQFNEPVFLKLPHNAALKNGEIPHLEGKTRSGESTDATTWRTLESLDGDPESRPIS-YLDENSVEMMLTHFSDQTVVGEP-------EYLKIKVVPF-----LQCDGAQFDCRVQVYLIPRTKAALEEAILDASRVGLIQADTGKLFSLMNTSRDVRVKACLHEVDTKWK-PVTPVQQALPFSQVWSSVEDM 843          
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Match: EDO41849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S398])

HSP 1 Score: 88.9669 bits (219), Expect = 5.458e-18
Identity = 67/256 (26.17%), Postives = 117/256 (45.70%), Query Frame = 3
Query: 1485 GMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILN--DNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNK--ASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSH 2240
              A G F+  GG L   ESGVS+FIP  AIP G+ Q I+  V + +   P L+    E LLSP+++CGP    F KSV L +PH AA+T   W F  L+S    +     W  +S    +   +     V      +++     + + G+  S  + +  AS+F Q  + +  +          +    N   A   +   E   G   +S    ++     +++ +++ +IA GW I+++   + ++FQ  W+++
Sbjct:  811 ATARGIFTHEGGVLSSEESGVSIFIPEGAIPKGVEQEIYFKVCKENNIMPPLDTEKGETLLSPLVMCGPHGTKFLKSVELRLPHCAAMTPDGWSF-ALKSSDTPTGMPTQWRNVSLPGQEHKDK---CQVDPNSVSVLVDHFSSFSLAGEARSNATKRMVASVFAQPPMTNSEWL-------FHVVLADNMDSARREVQQAETACGRLQFSPFVPIDVHGDAKDVRVQLRDIADGW-ISRSACKKYIEFQDTWEAY 1054          
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Match: EDO41850 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S399])

HSP 1 Score: 56.225 bits (134), Expect = 4.872e-10
Identity = 30/66 (45.45%), Postives = 40/66 (60.61%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILN--DNEALLSPVIICG 1682
            A G F+  GG L   ESGVS+FIP  AIP G+ Q I+  V + +   P L+    E LLSP+++CG
Sbjct:   10 ARGIFTHEGGVLSSEESGVSIFIPEGAIPKGVEQEIYFKVCKENNIMPPLDTEKGETLLSPLVMCG 75          
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Match: EDO45713 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRZ5])

HSP 1 Score: 59.3066 bits (142), Expect = 6.347e-9
Identity = 54/240 (22.50%), Postives = 105/240 (43.75%), Query Frame = 3
Query: 1515 GGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHK----PILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAV-THSQWHFRLLRSKYVNSSEKPDW--EILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFF-DGGENLILRINEIAKGWKINQT-PQTQ 2207
            G  L  P +GV L +P +    G+   ++  +     H     P LN++E LLSP I   P+  + ++ + + +PH A + T +QW  R+L     ++   P+W  +++S    +     +  +VT+            Y V+G P++    K  +     VF+       +   +  Y + + + + + +   EN+ G +++ C K  +   D    + L+I  +  GWK+    PQ Q
Sbjct:  394 GNVLWFPTAGVKLHLPHEFYGEGVDNEVYGKIKIGVHHDRPSLPTLNEHEVLLSPAIRIRPDGAELQEPITIEIPHTADLGTDNQWSLRVLTC--YDTQAGPEWTDDLMSVKCGE---LSVSFNVTKLGV--------AYAVVGSPVNLRLAKKRMVCA--VFAAQHIPGNEPVDVVCYLLDDCESSLKRVR--ENEHGQEMYGCLKKCHLHTDPNGEIRLQIANLTDGWKVQSIEPQRQ 616          
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Match: EDO35240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM31])

HSP 1 Score: 49.6766 bits (117), Expect = 1.103e-6
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 3
Query:  534 FRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKK-INEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
             RS F+  P   ++ +  +  L+C PP  +P   V WLKN K  + + V   I+ +   +L+I    ++D+G Y C A +    RKS  A + +
Sbjct:    1 LRSKFRAEPKDLSITIGNRAILKCNPPKGRPAPTVTWLKNTKAYVPDGV--RIQKVSPGNLVISIAQKADMGTYQCVAANAVGRRKSRVATVTI 92          
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 151.754 bits (382), Expect = 4.742e-37
Identity = 114/413 (27.60%), Postives = 183/413 (44.31%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAK-GWKINQTPQTQLVKFQTVWKS-----HDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            A G+F+S GGHL +P SGVSL +P  AIP G    + +TV R  + +P + D + +LSPV+ CGP      + VIL + H A      W  +L      N     +WE +     ++F    Y+ +  E   I+ ++L  YC++GQ +   + K    +++ VF        D Y IR+Y + +T++A + +  +E + GGKL    K LNF D   NL L I+++    WK     + Q + F  VW       H +  +          S            Q    SN +  EL+            +   +   N  +   P        F +    +++L   L      GNDWR+LA ++N+ +   YF  K  PT  +L+LW+AQ+     + +L +V +   R D
Sbjct:  538 AHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQL-----KNRLSMGEWEDVVVVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSIGKAAAKR---LKLAVFGPVSCTTLD-YHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEEELQ---------CIDTSLMDPASNITTLTGP------NAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 926          

HSP 2 Score: 73.559 bits (179), Expect = 7.603e-13
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +  E Y VK +  V + C A P +     C       K  +   R   ++GL+V +                S+ +  + V E F    Y C C AW+       A    SR + +  +Y + +F++ P+ + + + Q++ L+C PP   P A V WLKN++ I+ A   +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   62 EPLPHFLFEPEEGYIVK-NKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGLVVRE---------------ASIEITRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIV 260          
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 151.369 bits (381), Expect = 6.208e-37
Identity = 114/413 (27.60%), Postives = 183/413 (44.31%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAK-GWKINQTPQTQLVKFQTVWKS-----HDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            A G+F+S GGHL +P SGVSL +P  AIP G    + +TV R  + +P + D + +LSPV+ CGP      + VIL + H A      W  +L      N     +WE +     ++F    Y+ +  E   I+ ++L  YC++GQ +   + K    +++ VF        D Y IR+Y + +T++A + +  +E + GGKL    K LNF D   NL L I+++    WK     + Q + F  VW       H +  +          S            Q    SN +  EL+            +   +   N  +   P        F +    +++L   L      GNDWR+LA ++N+ +   YF  K  PT  +L+LW+AQ+     + +L +V +   R D
Sbjct:  557 AHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQL-----KNRLSMGEWEDVVVVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSIGKAAAKR---LKLAVFGPVSCTTLD-YHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEEELQ---------CIDTSLMDPASNITTLTGP------NAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 945          

HSP 2 Score: 73.559 bits (179), Expect = 7.611e-13
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +  E Y VK +  V + C A P +     C       K  +   R   ++GL+V +                S+ +  + V E F    Y C C AW+       A    SR + +  +Y + +F++ P+ + + + Q++ L+C PP   P A V WLKN++ I+ A   +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   62 EPLPHFLFEPEEGYIVK-NKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGLVVRE---------------ASIEITRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIV 260          
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 151.369 bits (381), Expect = 6.881e-37
Identity = 114/413 (27.60%), Postives = 183/413 (44.31%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAK-GWKINQTPQTQLVKFQTVWKS-----HDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFD 2705
            A G+F+S GGHL +P SGVSL +P  AIP G    + +TV R  + +P + D + +LSPV+ CGP      + VIL + H A      W  +L      N     +WE +     ++F    Y+ +  E   I+ ++L  YC++GQ +   + K    +++ VF        D Y IR+Y + +T++A + +  +E + GGKL    K LNF D   NL L I+++    WK     + Q + F  VW       H +  +          S            Q    SN +  EL+            +   +   N  +   P        F +    +++L   L      GNDWR+LA ++N+ +   YF  K  PT  +L+LW+AQ+     + +L +V +   R D
Sbjct:  523 AHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQL-----KNRLSMGEWEDVVVVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSIGKAAAKR---LKLAVFGPVSCTTLD-YHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEEELQ---------CIDTSLMDPASNITTLTGP------NAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 911          

HSP 2 Score: 73.9442 bits (180), Expect = 6.928e-13
Identity = 59/221 (26.70%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFS--KYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL +  E Y VK +  V + C A P +     C       K  +   R   ++GL+V +                S+ +  + V E F    Y C C AW+       A    SR + +  +Y + +F++ P+ + + + Q++ L+C PP   P A V WLKN++ I+ A   +  +    +LII+    SD   Y C A ++   R+S  A + V
Sbjct:   47 EPLPHFLFEPEEGYIVK-NKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGLVVRE---------------ASIEITRQQVEELFGPEDYWCQCVAWSS------AGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIV 245          
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 132.494 bits (332), Expect = 4.354e-31
Identity = 79/248 (31.85%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAK-GWKINQTPQTQLVKFQTVW 2231
            A G+FSS GG L +P SGVSL IP  A+P G    +++TV R    +P + D + +LSPV+ CGP      + V++ + H A     Q     L+S+    S++  WE +     ++F    Y+ +  E   I+ ++L  YC++GQ LS  + K    +++ +F        + Y IR+Y + +T++A + +  +E + GGKL    K L+F D   NL L I+++    WK     + Q + FQ VW
Sbjct:  484 ALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQ----SQQNQWEDVVVVGEENFTTPCYVQMDDEACHILTETLGTYCLVGQSLSAATIKR---LKLAIFGPVTCAAME-YHIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVW 723          

HSP 2 Score: 70.8626 bits (172), Expect = 4.900e-12
Identity = 59/221 (26.70%), Postives = 96/221 (43.44%), Query Frame = 3
Query:  171 EGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E +P FL++  E Y VK +  V + C A P +     C       K+ +   R   ++GL+V +                S+ +  + V E F    + C C AW+       A    SR + +  +Y R  F + P+ + + + Q++ L+C PP   P A V WLKN + I+ A   +  +    +LII+    SD   Y C A ++   R S  A + V
Sbjct:   41 EPLPVFLMEPEEAYIVK-NKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDENSGLVVRE---------------ASIEITRQQVEELFGPEDFWCQCVAWSS------AGTTKSRKAHVRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIV 239          
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 132.494 bits (332), Expect = 5.172e-31
Identity = 79/248 (31.85%), Postives = 129/248 (52.02%), Query Frame = 3
Query: 1491 AWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAK-GWKINQTPQTQLVKFQTVW 2231
            A G+FSS GG L +P SGVSL IP  A+P G    +++TV R    +P + D + +LSPV+ CGP      + V++ + H A     Q     L+S+    S++  WE +     ++F    Y+ +  E   I+ ++L  YC++GQ LS  + K    +++ +F        + Y IR+Y + +T++A + +  +E + GGKL    K L+F D   NL L I+++    WK     + Q + FQ VW
Sbjct:  492 ALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQ----SQQNQWEDVVVVGEENFTTPCYVQMDDEACHILTETLGTYCLVGQSLSAATIKR---LKLAIFGPVTCAAME-YHIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVW 731          

HSP 2 Score: 63.5438 bits (153), Expect = 8.596e-10
Identity = 53/210 (25.24%), Postives = 88/210 (41.90%), Query Frame = 3
Query:  204 EFYYVKSDHSVTISCMADPVSHANIIC-----ANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSK--YECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            E  Y+  +  V + C A P +     C       K+ +   R   ++GL+V +                S+ +  + V E F    + C C AW+       A    SR + +  +Y R  F + P+ + + + Q++ L+C PP   P A V WLKN + I+ A   +  +    +LII+    SD   Y C A ++   R S  A + V
Sbjct:    4 EEAYIVKNKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDENSGLVVRE---------------ASIEITRQQVEELFGPEDFWCQCVAWSS------AGTTKSRKAHVRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIV 192          
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Match: SMESG000046884.1 (SMESG000046884.1)

HSP 1 Score: 1649.03 bits (4269), Expect = 0.000e+0
Identity = 884/889 (99.44%), Postives = 887/889 (99.78%), Query Frame = 3
Query:   78 MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKXXXXXXXXXXXXXXRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENXXXXXXXXXXXXXXXXXXXXXXTFRRKHLLKKSRDLNVKSKAIKADPNNENLHACRSISSSTDCMVDEFRSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNXXXXXXAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL 2744
            MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICA KQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFK+IPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKWSSWSFCDSSCSSFRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENVIYISLSILVFLLFAIFLAVVFTFRRKHLLKKSRDLNVKSKAIKADPNNENLHACRSISSSTDCMVDE RSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNSSSSSSAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQH+YIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQNGNYSNRVTLELKSGKSINHSNSSFSRSS+KTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL
Sbjct:    1 MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICATKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKRIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKWSSWSFCDSSCSSFRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENVIYISLSILVFLLFAIFLAVVFTFRRKHLLKKSRDLNVKSKAIKADPNNENLHACRSISSSTDCMVDELRSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNSSSSSSAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHVYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQNGNYSNRVTLELKSGKSINHSNSSFSRSSDKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL 889          
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Match: SMESG000046884.1 (SMESG000046884.1)

HSP 1 Score: 1642.09 bits (4251), Expect = 0.000e+0
Identity = 883/891 (99.10%), Postives = 886/891 (99.44%), Query Frame = 3
Query:   78 MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKXXXXXXXXXXXXXXRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENXXXXXXXXXXXXXXXXXXXXXXTFRRKHLLKKSRDLNVKSKA--IKADPNNENLHACRSISSSTDCMVDEFRSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNXXXXXXAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL 2744
            MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICA KQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFK+IPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKWSSWSFCDSSCSSFRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENVIYISLSILVFLLFAIFLAVVFTFRRKHLLKKSRDLNVKSK   IKADPNNENLHACRSISSSTDCMVDE RSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNSSSSSSAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQH+YIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQNGNYSNRVTLELKSGKSINHSNSSFSRSS+KTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL
Sbjct:    1 MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICATKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKRIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKWSSWSFCDSSCSSFRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFENVIYISLSILVFLLFAIFLAVVFTFRRKHLLKKSRDLNVKSKGKTIKADPNNENLHACRSISSSTDCMVDELRSIPNSNHLQASNRNKTLSIDSENLVPYSAINSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNSSSSSSAQTPINNLFVYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHVYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQNGNYSNRVTLELKSGKSINHSNSSFSRSSDKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL 891          
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 382.104 bits (980), Expect = 6.307e-117
Identity = 291/920 (31.63%), Postives = 458/920 (49.78%), Query Frame = 3
Query:  135 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQID-PQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLKXXXXXXXXXXXX------XXRTRGCQI-SLCQISDIQYRNCSSYSC-WSMGNVLDQFENXXXXXXXXXXXXXXXXXXXXXXTFRRKHLL----KKSRDLNVKSKAIKADPNNENLHACRSISSSTDCMVDEFRSIPNSNHLQASNRNKTLSIDSENLVP------YSAINSDTVDVGTCYHSSCLSTEGRSFIP---------KDVGLSIFNXXXX----XXAQTPINN---------LFVYDESLYNVLTTKTNN-SFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSE-------KPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQE--CDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEG 2735
            + D +   E  LEG+P F+ +    YYV       I C+A+PVSH NIIC  + FSYM   +S++ L V K N++N+ D   G +W  SL + +  V+EWF+ + CVCEAWNQIP+L  AKKV SR   I E+YF+SNFKK+P S+ ++  Q L L CVPP +KP A V W+KNKK++ E     IK++++  L+IE+   +D G Y C A SL+  R SP A + + ES+  +  +   +  +        RTR C    +C+  D    +C+   C  S  ++ D  +  +Y+ L + V +L  +   +    RRK LL         LN+    +  D  N  +    +IS+    ++D   S+ N      + +   LS    NL P       S+ N+ +  +   Y+S+      +  I          K    S+ N+       + + TPIN+         L +  ES+ N     + N     +AWGT S+IGG L +P+SG++L I   +     S  ++L VSR   + PIL+DNE LL+P+++ GP+ V   K  +L VPH+A +    W  RLL     + ++       +P W+ ++T   +     IY H+    + IML      C++GQ  S    KA+  +++  F           NY+IRIY   +TKEAFES+  +E K G  L   +  + F D   NL   I E++ GWK   T + Q + FQ +W    S  +  +F FD    S  S +C + AYQ+G YS +  + +K  K    ++       EK +    +   ++ P+   F +S+ T+K+L  LL    P GNDW+ L R++++     YF+ K  PTD+L+ LW+++N  +  + DL+   +   R DC ++LE + G
Sbjct:   39 ENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLTNGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFEN--NRIKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWSACDGNCKKTRTRNCNSKGVCKEID----SCTKKECELSTSSLQDARDIAMYVGLFVAVTILVMVITIIFCLIRRKALLPLRSTMRYPLNINGNGVAYDVKNSLIKNSNTISTKNPYIMDT--SLAN-----LTQQRSYLSQSPPNLPPPTCLSEISSTNAYSTGIDFSYNSTGSGKFSQPLISNSSSASTTNKSKATSLSNTDHKPDPLTVSGTPINSRPPSALYHELSLDRESICNSPPFVSENIDISTLAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSADLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIGCETDQTPIYTHLDPYAAFIMLDQPQKICLVGQ--SYPGGKATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIETKLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTFDNIDPSQQSLTCRITAYQSGFYSQKQVITIKQDKLDRSNHKRDLIQHEKVLLYSESNNTYLDPLMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESDCG 943          
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Match: SMESG000073898.1 (SMESG000073898.1)

HSP 1 Score: 223.016 bits (567), Expect = 6.781e-60
Identity = 105/226 (46.46%), Postives = 150/226 (66.37%), Query Frame = 3
Query:  135 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 812
            + DL+ P E   +G+PKF+++ + FYYV   H  TI C+A+PVSH NI CA+KQFSYM + +S++GL V K N  NQ DP+G +W  S +V++K + EWFS+Y+C CEAWN+I ++ + KKV S  + I ESYF++ FK  P +  L   +KL L C PP++KP + V WLKNK+ I  + +P + + +   LII+ V++SD G Y C A S  IV+KS  A I V
Sbjct:   39 KKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITV 264          

HSP 2 Score: 188.348 bits (477), Expect = 1.239e-48
Identity = 132/424 (31.13%), Postives = 230/424 (54.25%), Query Frame = 3
Query: 1479 FDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILST---TNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIG--QPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNND-STAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKT-EYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLER 2726
             + +AWGT ++ GG L +P+SG+SL IPR AI  G S+ +FL V R  A+ P+++  E LLSPVI+CGP      K +IL +PH A +  S W+ R+L +++ NS   P W+ LST    N  D   ++Y  +    + +++  L M C+ G   PLS  S   SI ++++ FS     E D+  IR++ IP+TKEA E++   E K  G+L   SK L+F   G ++   +++++ GW+ +   + Q   + +VW+ + S         +    + + FSC++   Q     N+  + +   +++N+ +        ++V+ + S AY  + P+   F LSS T+++L  LL       + W+ LA  M +     YF  K+ P+D+LL+LW+++  ++  I DL+++ +   R DC  ++E+
Sbjct:  577 LETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSD--ANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLS--VSIRLRVLAFSLPLSSEVDHL-IRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAY--LDPLQTVFRLSSATRQQLWPLL------DSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQ 987          
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 209.92 bits (533), Expect = 9.713e-56
Identity = 138/427 (32.32%), Postives = 221/427 (51.76%), Query Frame = 3
Query: 1488 MAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSE-------KPDWEILSTTNNDDFGQHIYIHVTREKSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQEC--DNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNXXXXXXXXXXXXXXXXXLVAYQNGNYSNRVTLELKXXXXXXXXXXXXXXXXEKTVNNDSTAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKK-TEYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEG 2735
            +AWGT S+IGG L +P+SG++L I   +     S  ++L VSR   + PIL+DNE LL+P+++ GP+ V   K  +L VPH+A +    W  RLL     + ++       +P W+ ++T   +     IY H+    + IML      C++GQ  S    KA+  +++  F           NY+IRIY   +TKEAFES+  +E K G  L   +  + F D   NL   I E++ GWK   T + Q + FQ +W    S  +  +F FD    S  S +C + AYQ+G YS +  + +K  K    ++       EK +    +   ++ P+   F +S+ T+K+L  LL    P GNDW+ L R++++     YF+ K  PTD+L+ LW+++N  +  + DL+   +   R DC ++LE + G
Sbjct:  535 LAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSADLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIGCETDQTPIYTHLDPYAAFIMLDQPQKICLVGQ--SYPGGKATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIETKLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTFDNIDPSQQSLTCRITAYQSGFYSQKQVITIKQDKLDRSNHKRDLIQHEKVLLYSESNNTYLDPLMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESDCG 959          

HSP 2 Score: 200.29 bits (508), Expect = 1.203e-52
Identity = 103/231 (44.59%), Postives = 145/231 (62.77%), Query Frame = 3
Query:  135 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQID-PQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESL 824
            + D +   E  LEG+P F+ +    YYV       I C+A+PVSH NIIC  + FSYM   +S++ L V K N++N+ D   G +W  SL + +  V+EWF+ + CVCEAWNQIP+L  AKKV SR   I E+YF+SNFKK+P S+ ++  Q L L CVPP +KP A V W+KNKK++ E     IK++++  L+IE+   +D G Y C A SL+  R SP A + + ES+
Sbjct:   39 ENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLTNGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFEN--NRIKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESV 267          
The following BLAST results are available for this feature:
BLAST of Unc-5 netrin receptor C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5C2.612e-3131.45unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5C2.923e-3131.45unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5B8.293e-2925.25unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5B1.110e-2825.25unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5C3.041e-2631.53unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-52.150e-1522.37Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-52.438e-1522.37Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-52.628e-1522.37Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-53.680e-1522.15Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-53.744e-1522.15Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-55.187e-1220.89gene:FBgn0034013 transcript:FBtr0339998[more]
unc-55.187e-1220.89gene:FBgn0034013 transcript:FBtr0087382[more]
robo37.415e-830.00gene:FBgn0041097 transcript:FBtr0077921[more]
robo37.415e-830.00gene:FBgn0041097 transcript:FBtr0335384[more]
pyd1.266e-738.46gene:FBgn0262614 transcript:FBtr0305297[more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5C2.049e-3131.58si:ch73-72b7.1 [Source:ZFIN;Acc:ZDB-GENE-100921-23... [more]
UNC5C5.074e-3131.58si:ch73-72b7.1 [Source:ZFIN;Acc:ZDB-GENE-100921-23... [more]
unc5a3.940e-2725.25unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b1.689e-2427.82unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b1.802e-2427.82unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndufaf72.109e-3628.16NADH:ubiquinone oxidoreductase complex assembly fa... [more]
fam20a1.129e-3125.93family with sequence similarity 20 member A [Sourc... [more]
ndufaf71.549e-3131.05NADH:ubiquinone oxidoreductase complex assembly fa... [more]
fam20a1.613e-3125.93family with sequence similarity 20 member A [Sourc... [more]
fam20a1.613e-3125.93family with sequence similarity 20 member A [Sourc... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc5c7.050e-3232.26unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c8.659e-3232.26unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c8.659e-3232.26unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c8.930e-3232.26unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5b1.125e-2824.75unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08747|UNC5C_MOUSE4.931e-3132.26Netrin receptor UNC5C OS=Mus musculus OX=10090 GN=... [more]
sp|Q7T2Z5|UNC5C_CHICK8.283e-3131.45Netrin receptor UNC5C OS=Gallus gallus OX=9031 GN=... [more]
sp|O95185|UNC5C_HUMAN1.254e-3031.45Netrin receptor UNC5C OS=Homo sapiens OX=9606 GN=U... [more]
sp|Q761X5|UNC5C_RAT3.134e-3031.85Netrin receptor UNC5C OS=Rattus norvegicus OX=1011... [more]
sp|C5IAW9|UN5BB_XENLA3.480e-2825.55Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E1CHK76.776e-5750.00Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Dju... [more]
A0A0X3NMZ15.943e-5342.79Netrin receptor UNC5C OS=Schistocephalus solidus O... [more]
A0A564YGK82.309e-5138.65Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A074ZFP62.995e-5142.00Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X6W11.230e-5041.85Immunoglobulin I-set domain protein (Fragment) OS=... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5c8.062e-3533.06unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5a3.838e-2725.54unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5a7.716e-2724.94unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5a9.096e-2724.94unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b2.763e-2327.42unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010609.12.343e-3026.54pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1... [more]
ENSPMAT00000008404.18.075e-2626.67pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
ENSPMAT00000003861.16.539e-2126.32pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 g... [more]
tjp1a8.427e-1537.50tight junction protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000002817.13.364e-1041.46pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466013.985e-2427.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418495.458e-1826.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418504.872e-1045.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457136.347e-922.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352401.103e-629.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-72b7.14.742e-3727.60netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.16.208e-3727.60netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.16.881e-3727.60netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
unc5c4.354e-3131.85netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
unc5c5.172e-3131.85netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of Unc-5 netrin receptor C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046884.10.000e+099.44SMESG000046884.1[more]
SMESG000046884.10.000e+099.10SMESG000046884.1[more]
SMESG000025091.16.307e-11731.63SMESG000025091.1[more]
SMESG000073898.16.781e-6046.46SMESG000073898.1[more]
SMESG000025091.19.713e-5632.32SMESG000025091.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034642 ID=SMED30034642|Name=Unc-5 netrin receptor C|organism=Schmidtea mediterranea sexual|type=transcript|length=2982bp
GTCATTAAATGGATTTGATTGGTTCTTTATATAACTATAAAATCGGGTAA
ACATTTTCTGTGGGAAGTTCACCTAAAATGGAGCGATATTTTATTTTATA
TTCTTTTCTCGTTCACTTTTTTTCAGACGCTTTACAAACTGATTTGATCT
TGCCAGAAGAAATGGATTTAGAAGGTGTCCCGAAATTTCTTGTGCAACTA
AGGGAATTCTACTATGTGAAATCGGATCATTCAGTAACCATTTCATGTAT
GGCTGATCCGGTATCGCATGCAAATATCATTTGTGCTAACAAACAATTTT
CCTACATGGGCAGGCCTGTGTCTGATACCGGATTAATTGTTACCAAATTT
AATCGGAGTAACCAAATTGACCCTCAAGGAACAAAATGGAATATTAGTTT
GATCGTGGATCACAAATCTGTTTCTGAATGGTTTAGCAAGTATGAATGCG
TATGTGAAGCATGGAATCAAATTCCAGCCCTTGGGAGAGCTAAAAAAGTC
TTCAGTAGAACTTCAACAATTTTGGAATCATATTTTCGGTCAAATTTCAA
AAAGATTCCAATAAGTCAAAATTTATTGGTAAATCAGAAACTAGAATTGG
AATGCGTTCCTCCAAATGCTAAACCTACGGCTTTTGTAATTTGGTTGAAA
AATAAGAAAAAAATTAATGAAGCTGTCTTTCCTCATATCAAGGTCATAGA
CCAATCTTCACTGATCATTGAAAACGTAACCGAAAGTGATATTGGGCAGT
ATTGTTGCGAGGCTTACAGTCTTGATATTGTCCGTAAATCTCCATGTGCG
GACATCAATGTTATTGAGTCACTAAAGTGGAGCAGTTGGTCATTTTGTGA
TAGTTCATGTAGTTCTTTTCGTACAAGAGGTTGTCAGATAAGCCTATGTC
AAATTTCTGATATTCAGTACAGGAATTGCTCTTCATATTCTTGTTGGAGT
ATGGGAAACGTTCTCGACCAATTTGAAAATGTGATTTATATATCTCTTTC
AATCTTGGTATTCCTTCTCTTCGCTATTTTCCTGGCAGTCGTGTTTACAT
TCCGCAGAAAACATTTATTGAAAAAATCTCGAGACCTCAATGTAAAATCA
AAAGCAATCAAAGCAGATCCAAATAACGAAAATTTGCATGCTTGCAGGTC
TATTAGTTCATCAACCGACTGCATGGTTGATGAATTCAGATCAATTCCAA
ATTCCAATCATTTGCAGGCTTCAAACCGGAACAAAACTCTGTCCATAGAC
AGTGAAAATCTGGTACCTTACTCTGCAATTAATTCTGACACTGTCGATGT
TGGCACATGTTACCATAGCTCATGCCTGTCGACAGAAGGAAGATCCTTCA
TTCCAAAAGACGTGGGATTGTCAATTTTCAATTCTTCATCATCAAGTTCA
GCACAAACTCCTATAAACAATCTTTTTGTATATGATGAATCCCTTTATAA
TGTACTTACAACAAAAACAAACAATTCTTTCGATGGAATGGCATGGGGAA
CATTCAGTTCTATTGGAGGGCATTTAGATATACCTGAATCTGGAGTGAGT
CTCTTTATCCCAAGAGACGCCATTCCAATCGGATTATCACAGCGAATATT
TCTAACAGTATCCAGATGTTCTGCCCATAAGCCAATTTTGAATGATAATG
AGGCATTACTAAGTCCCGTCATAATTTGTGGACCAGAAATCGTAGATTTC
GAAAAATCTGTTATTCTTATTGTTCCTCATAATGCCGCCGTAACCCATAG
TCAATGGCATTTCAGGTTACTGCGTTCAAAGTATGTGAACAGTTCCGAGA
AACCCGATTGGGAAATTTTATCTACTACCAACAATGATGATTTCGGACAG
CATATTTACATTCATGTAACAAGGGAAAAATCCTGTATAATGCTTAAATC
ATTGGACATGTATTGCGTCATTGGCCAACCCCTTTCAACTAATTCCAACA
AAGCCAGCATTTTTATACAGATTATTGTCTTTTCCGAAAACTTTTACCAA
GAATGCGATAATTATTCTATAAGGATTTATACAATACCCAACACAAAAGA
GGCATTTGAAAGTATATATTTTGTTGAAAATAAATCAGGAGGAAAACTTT
GGAGTTGCTCTAAAAATTTGAATTTTTTCGATGGAGGAGAAAATTTAATT
CTGAGAATAAATGAAATTGCCAAAGGTTGGAAAATTAATCAAACTCCTCA
GACTCAGTTAGTGAAATTTCAAACCGTTTGGAAAAGTCATGACTCTCTTG
GAATAATGAACAGCTTTCATTTTGACAGATCCAGTTCCAGTCTCAATAGC
TTCTCGTGCAGTTTGGTAGCTTATCAAAACGGAAACTATTCCAATCGTGT
TACTCTTGAGTTGAAATCGGGCAAATCTATTAATCATTCAAATTCCAGCT
TTTCTCGGTCATCGGAAAAAACTGTTAATAATGATTCCACAGCATATCCT
TTTATACATCCAATATTTGAAAATTTCAGTTTATCTAGTCAAACAAAAAA
GGAACTTTCTAAGCTGTTGAAGATCTATGATCCTTCAGGAAACGATTGGA
GAATTTTAGCTAGAGAAATGAATATTAAAAAGACAGAATACTTTTTAAAA
GAAGATCCAACTGACAGTTTGCTGAATCTCTGGCAAGCGCAGAATCCACA
GAAATTTTATATTAAAGATTTAATGAGTGTTTTTCAACGATACAAACGAT
TTGATTGTGTATCAGTTTTGGAACGAAATGAAGGATATAGATTGTAAAAT
TCGAAAACTTTTATTTAGTTGAATTTAGAAATATATTTATTTTTATGTGA
TTACTTTGACTATGGCCTGTGGCCCCAGTAGCGCGTTTACGCATTGGCGC
ACTAGGTACGACTCTAAGGCCCAAAATGAAGGAAATTTAACAAATTTTAA
AAAAGCATTTTTTGAAATTTGACTTTAATGACTTGTTTAAATGTAAACTA
TATGTATGCATTTCATATTTTAGCATTCTCAT
back to top

protein sequence of SMED30034642-orf-1

>SMED30034642-orf-1 ID=SMED30034642-orf-1|Name=SMED30034642-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=890bp
MERYFILYSFLVHFFSDALQTDLILPEEMDLEGVPKFLVQLREFYYVKSD
HSVTISCMADPVSHANIICANKQFSYMGRPVSDTGLIVTKFNRSNQIDPQ
GTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILE
SYFRSNFKKIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAV
FPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINVIESLK
WSSWSFCDSSCSSFRTRGCQISLCQISDIQYRNCSSYSCWSMGNVLDQFE
NVIYISLSILVFLLFAIFLAVVFTFRRKHLLKKSRDLNVKSKAIKADPNN
ENLHACRSISSSTDCMVDEFRSIPNSNHLQASNRNKTLSIDSENLVPYSA
INSDTVDVGTCYHSSCLSTEGRSFIPKDVGLSIFNSSSSSSAQTPINNLF
VYDESLYNVLTTKTNNSFDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIP
IGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVP
HNAAVTHSQWHFRLLRSKYVNSSEKPDWEILSTTNNDDFGQHIYIHVTRE
KSCIMLKSLDMYCVIGQPLSTNSNKASIFIQIIVFSENFYQECDNYSIRI
YTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKG
WKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQ
NGNYSNRVTLELKSGKSINHSNSSFSRSSEKTVNNDSTAYPFIHPIFENF
SLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKTEYFLKEDPTDSLLN
LWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLERNEGYRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005042netrin receptor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0038007netrin-activated signaling pathway
GO:0007165signal transduction
Vocabulary: INTERPRO
TermDefinition
IPR033772UPA
IPR037936UNC5
IPR036179Ig-like_dom_sf
IPR000906ZU5_dom
IPR003599Ig_sub
IPR000488Death_domain
IPR011029DEATH-like_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000906ZU5 domainSMARTSM00218zu_1coord: 468..571
e-value: 6.8E-20
score: 82.1
IPR000906ZU5 domainPFAMPF00791ZU5coord: 472..567
e-value: 2.1E-25
score: 88.9
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 470..609
score: 18.919
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 161..246
e-value: 4.4E-5
score: 32.9
IPR000488Death domainSMARTSM00005DEATH_4coord: 796..885
e-value: 9.0E-8
score: 41.8
IPR000488Death domainPFAMPF00531Deathcoord: 808..883
e-value: 3.1E-9
score: 36.9
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 809..885
score: 10.517
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 156..240
e-value: 2.0E-11
score: 45.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 31..155
e-value: 6.7E-19
score: 70.4
NoneNo IPR availablePFAMPF13927Ig_3coord: 162..229
e-value: 4.6E-8
score: 33.5
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 796..886
e-value: 7.5E-17
score: 63.0
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 455..623
e-value: 1.9E-25
score: 91.1
NoneNo IPR availablePANTHERPTHR12582:SF47NETRIN RECEPTOR UNC-5coord: 122..883
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
IPR033772UPA domainPFAMPF17217UPAcoord: 630..751
e-value: 8.3E-16
score: 58.1
IPR037936Netrin receptor UNC5PANTHERPTHR12582NETRIN RECEPTOR UNC5coord: 122..883
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 169..229
score: 9.101
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 800..882
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 158..231