SMED30034637

Overview
NameSMED30034637
Smed IDSMED30034637
Length (bp)1892
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034637 (SMED30034637) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034637 (SMED30034637) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034637 (SMED30034637) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034637 (SMED30034637) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034637

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034637SMESG000043348.1 SMESG000043344.1 dd_Smed_v4_6826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034637SMESG000043348.1 SMESG000043344.1 dd_Smed_v4_6826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034637SMESG000043348.1 SMESG000043344.1 dd_Smed_v4_6826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034637 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002859:30454..34429 +9157
Homology
BLAST of SMED30034637 vs. Ensembl Zebrafish
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 52.373 bits (124), Expect = 1.451e-6
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 3
Query:  507 RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            R + E  K  I I    G+ +W+  GSL+G+ RH+D++PWD+D+D+ I
Sbjct:  357 RALRETTKYVINILESSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGI 404          
BLAST of SMED30034637 vs. Ensembl Zebrafish
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 52.373 bits (124), Expect = 1.451e-6
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 3
Query:  507 RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            R + E  K  I I    G+ +W+  GSL+G+ RH+D++PWD+D+D+ I
Sbjct:  357 RALRETTKYVINILESSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGI 404          
BLAST of SMED30034637 vs. Ensembl Mouse
Match: Fkrp (fukutin related protein [Source:MGI Symbol;Acc:MGI:2447586])

HSP 1 Score: 50.8322 bits (120), Expect = 3.963e-6
Identity = 19/59 (32.20%), Postives = 36/59 (61.02%), Query Frame = 3
Query:  474 HDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            ++G+   P   R + E  +  + +    G+ +W+  GSL+G+ RH D++PWD+D+D+ I
Sbjct:  309 YEGRWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGSLLGAARHGDIIPWDYDVDLGI 367          
BLAST of SMED30034637 vs. UniProt/SwissProt
Match: sp|Q68W49|Y683_RICTY (Uncharacterized protein RT0683 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0683 PE=3 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.625e-6
Identity = 27/83 (32.53%), Postives = 47/83 (56.63%), Query Frame = 3
Query:  513 MFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI----PFQFEQIIRNISTPRKEISSNKVNVISRPGPHC 749
            +++L+K   ++  K+ I +WI  G+L+G++RH+ ++P+D D+DI I       F+QI+         I  NK+ VI   G  C
Sbjct:  107 LYQLMKDTHELLTKNNIKYWIESGTLLGAVRHQGIIPFDDDLDIGIMHEDEIHFQQILPQFKQLGYRIKHNKIYVIC--GERC 187          
BLAST of SMED30034637 vs. TrEMBL
Match: A0A4S2L6M5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009663 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 7.613e-37
Identity = 92/268 (34.33%), Postives = 143/268 (53.36%), Query Frame = 3
Query:  348 FNGGKSFMMSGNLSSVLVSETS---PSEIERLNWNVSY------QGYMDRNHDGK-CAIPNQHR--IMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYN-GQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFY--EYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYG-TFEMTK-KCVD--GKW 1094
            F     FM  G++   +V+ T+   P  +    +N+S       +G+ ++N   K C I    R   +++ L+ WIK+A +  I+WWI  G+L+GS R  +M+P+D D+DI I   +E+ +R ++T RK I   K N+++RPG HC  + G R DC G +V    D C+FCGP++R+F    +++DI+     +H +      E  Y  E   +  + P    FPLR C +MGL V CP D E+ L   YG  F + K +C    GKW
Sbjct:  151 FRSVSQFMTLGSIPDRVVNPTNIEVPFNVRNPTYNLSRVYLLPPKGFSNKNSLSKPCPIVRASRRESLYQTLQEWIKMANQSKILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRELATDRKAIQKGKFNLVTRPGEHCVTSPGLRLDCNGRNVTSLQDTCSFCGPLARMFHQYGEYVDIYPVHLEVHVDVANNPIEFGYLDEGMDRDRVDPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYGKEFALPKSRCSQETGKW 418          
BLAST of SMED30034637 vs. TrEMBL
Match: G7Y5A1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_101206 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.734e-36
Identity = 73/194 (37.63%), Postives = 120/194 (61.86%), Query Frame = 3
Query:  498 NQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYN-GQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIF-------LSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYG 1055
             + + +++LL+ WI +A +HGI+WW++ GSL+GS+RH+D +P+DHDIDI +   +E ++R++S   +E++ N+  +I+R G +C  + G R +C+G  V  QLD CAFC P  R+      FLDIF       + L +  +  +    E+    ++K   YP+ + FPL  C++MGL + CPR  + IL+ FYG
Sbjct:  186 TKRKNVYKLLRHWITLAERHGIVWWLSFGSLLGSIRHKDFIPYDHDIDIAVLGSYEDVLRSLSITWREVNYNETFLITRQGTYCINDHGPRLNCQGVPVRYQLDPCAFCTPFGRLISSYFTFLDIFVVHARAIVDLTNASNTGVGLLDESVDMDSNKAFSYPLDYVFPLSTCTYMGLSLPCPRKPDLILSYFYG 379          
BLAST of SMED30034637 vs. TrEMBL
Match: G7YSX8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_109802 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.612e-36
Identity = 84/251 (33.47%), Postives = 133/251 (52.99%), Query Frame = 3
Query:  348 FNGGKSFMMSGNLSSVLVSETS---PSEIERLNWNVSYQGYMDRNH-------DGKCAIPNQHR--IMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYN-GQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFY--EYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYG 1055
            F     FM  G++   +V+ T+   P ++    +N+S    +  N           C +  + R   ++  L+ WI+IA + GI+WWI  G+L+GS R  +M+P+D D+DI I   +E+ +R ++T RK I   K N+++RPG HC  + G R DC G++V    D C+FCGP++R+F    +++DI+L    +  +      E  Y  E   +  + P    FPLR C +MGL V CP D E+ L   YG
Sbjct:  151 FRSVSQFMTLGSIPHGVVNPTNREVPFKVRNPTYNLSRVYLLPPNDFFNKTSLSRPCPVVRESRRESLYRTLQEWIRIANQSGILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRQLATDRKSIQKGKFNLVTRPGEHCVTSPGLRLDCDGHNVTSLQDTCSFCGPLARMFHQYGEYVDIYLVHLEVRVDVANNPIEFGYFDEGMDRDRVEPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYG 401          
BLAST of SMED30034637 vs. TrEMBL
Match: A0A419Q1H5 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_8277s PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.780e-36
Identity = 84/251 (33.47%), Postives = 133/251 (52.99%), Query Frame = 3
Query:  348 FNGGKSFMMSGNLSSVLVSETS---PSEIERLNWNVSYQGYMDRNH-------DGKCAIPNQHR--IMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYN-GQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFY--EYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYG 1055
            F     FM  G++   +V+ T+   P ++    +N+S    +  N           C +  + R   ++  L+ WI+IA + GI+WWI  G+L+GS R  +M+P+D D+DI I   +E+ +R ++T RK I   K N+++RPG HC  + G R DC G++V    D C+FCGP++R+F    +++DI+L    +  +      E  Y  E   +  + P    FPLR C +MGL V CP D E+ L   YG
Sbjct:  151 FRSVSQFMTLGSIPHGVVNPTNREVPFKVRNPTYNLSRVYLLPPNDFFNKTSLSRPCPVVRESRRESLYRTLQEWIRIANQSGILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRQLATDRKSIQKGKFNLVTRPGEHCVTSPGLRLDCDGHNVTSLQDTCSFCGPLARMFHQYGEYVDIYLVHLEVRVDVANNPIEFGYFDEGMDRDRVEPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYG 401          
BLAST of SMED30034637 vs. TrEMBL
Match: A0A5J4NGR6 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005546 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 7.480e-36
Identity = 79/205 (38.54%), Postives = 118/205 (57.56%), Query Frame = 3
Query:  513 MFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYN-GQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQT------SEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGT-FEMTK-KC--VDGKW 1094
            +   LK WI+ A  + IIWWI  GSL+GS+R+  M+P+D D+DI I    E  +R ++T R+ I+  + N+++RPG HC Y+ G R DC G  V    D CAFCGP++R+F++  +++DI+     +  N   +        E  +EYT  + L+     FPL  C  MGL V CP + +KIL + YG  F + K KC   +G+W
Sbjct:  240 LLRTLKHWIRFANDNMIIWWITYGSLLGSVRNGTMIPYDTDMDIAILGSHEAQLRRLATDRQNITPGQFNLVTRPGDHCVYSTGSRVDCTGKQVTSLTDTCAFCGPLARIFYEFGQYIDIYQVHLELRLNSANKPLSFGFYDEGTHEYTPTENLHDASSLFPLSSCRMMGLDVPCPSEPDKILEEVYGAEFIIPKYKCNLTNGEW 444          
BLAST of SMED30034637 vs. Ensembl Cavefish
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:103033897])

HSP 1 Score: 51.6026 bits (122), Expect = 2.146e-6
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 3
Query:  507 RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            R + E  K  I I    G+ +W+  GSL+G+ RH+D++PWD+D+D+ I
Sbjct:  363 RALRETTKYVINILDSSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGI 410          
BLAST of SMED30034637 vs. Ensembl Cavefish
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:103033897])

HSP 1 Score: 51.2174 bits (121), Expect = 2.245e-6
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 3
Query:  507 RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            R + E  K  I I    G+ +W+  GSL+G+ RH+D++PWD+D+D+ I
Sbjct:  327 RALRETTKYVINILDSSGVRYWLEGGSLLGAARHQDIIPWDYDVDLGI 374          
BLAST of SMED30034637 vs. Ensembl Sea Lamprey
Match: fkrp (fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-070412-4])

HSP 1 Score: 51.6026 bits (122), Expect = 3.853e-7
Identity = 41/194 (21.13%), Postives = 82/194 (42.27%), Query Frame = 3
Query:  474 HDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYG 1055
            H G+   P   R +   +   ++   + G+ +W+  GSL+G+ RH D++PWD+D D+ +              R +I+  K +++ R     P      D  G+     +   A  G   RV + ++  L +   L+  H +    T   + +   +   +P ++  PL +  F G++   P +  + L   +G
Sbjct:  233 HRGRWTPPCCLRALRTTVARVVRELERAGVRYWLEGGSLLGAARHGDIIPWDYDADLGL-------------YRDDIT--KCDLLKRAAALGPVE----DEEGF-----VWERAREGDFYRVHYSRTNRLHV--DLWPFHSSSGTMTKLTWMKGHPQDREFPEHFLQPLERMQFAGILAYAPNNHRRFLELKFG 400          
BLAST of SMED30034637 vs. Ensembl Nematostella
Match: EDO45603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB6])

HSP 1 Score: 105.916 bits (263), Expect = 4.310e-25
Identity = 65/220 (29.55%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  477 DGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPR-----KEISSNKVNVISRPGPHCPYNGQ-----RSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGT--FEMTKKCVDGKWIN 1100
            D  C    + + +  +L+ W +I AKH I + +  GSLIG++R  D++PWDHD+D+ +P++   ++  +  PR     K      +N I    P   +N       R DC G   P  +D+C+   PI R  ++   FLD+F   Y      +    E       +   YPI      R+C F+G+   CP +   +L+K+YG    +  K C DG W+N
Sbjct:  108 DTNCPDNGRRKPLTAILQYWTEITAKHNITYALMWGSLIGAIRTNDVIPWDHDMDLVVPYKDILVLEKLGWPRSSDPYKSDGRTYINAI----PSSEHNKSMDDRLRWDCSGKLTPSHVDLCSIQEPIVR-LYNNGAFLDVF--HYYDQGETVVTIPEGHKLEMKRNDFYPI------RECLFLGIKSKCPNNPASLLSKWYGLNFIKSPKTCKDGHWVN 314          
BLAST of SMED30034637 vs. Ensembl Nematostella
Match: EDO31192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN3])

HSP 1 Score: 90.8929 bits (224), Expect = 3.984e-20
Identity = 67/242 (27.69%), Postives = 109/242 (45.04%), Query Frame = 3
Query:  408 TSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNV--ISRPGPHCPYNGQ-----RSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTK---KCVDGKWINK 1103
            +S  E+ +  W   Y       +D  C        + ELL  W K    + I + I  GSL+G LR  D++ WD+DID+ +  +    +R ++        N  N+       P   +N       R  CRG +V   +D C+F  P++R+   K  F+DI+          ++   + F     K+ +      FPL++C +MGL  LCPR+ E++L  +YG   +     KC DG+W N+
Sbjct:   60 SSRGEVLKSRWRRFY-------NDTGCFDNEMRAQLTELLNYWNKFTKNNNISYAIMWGSLLGLLRTNDIMAWDYDIDVIVSLKDLVKLRKLAKAEGSFDYNDGNIHLAVMAEPEKSFNTSADKRARLSCRGEAVDKVMDPCSFVDPLARLLL-KWFFIDIY--------TYVEVGDKLFALPEGKRFVMNKADMFPLQRCHYMGLECLCPRNPERLLEDWYGPGCVDANEFKCRDGEWQNQ 285          
BLAST of SMED30034637 vs. Ensembl Nematostella
Match: EDO45540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB7])

HSP 1 Score: 89.3521 bits (220), Expect = 6.865e-20
Identity = 62/212 (29.25%), Postives = 104/212 (49.06%), Query Frame = 3
Query:  498 NQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPF----QFEQIIRNISTPRK--EISSNKVNVISRP-GPHCPY--NGQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMT--KKCVDGKWIN 1100
             + +++  LL++W  IA+ H I + +  GSL+G  R  D++PWDHD+DI + +    + E+I  NI  PR   +I+    +++  P   H  +  + +R DC G  V   +D C+   P++R+    S F+D F       DN I         Y   +        FPL++C  MG+   CP+D  ++L  +YG   +   K C  G+W+ 
Sbjct:   51 QKRKLLVTLLRTWNLIASHHNITYSLMYGSLLGVERTADILPWDHDLDIMVSYDGILKLERIA-NICDPRGHFDINDGLPHLVVLPNSEHNVFMDDRRRFDCAGKEVAKLVDACSIQEPLARLIAG-SVFMD-FYHYTEKEDNLISVPEGKTVTYAKGE-------VFPLKECFLMGVKSWCPKDPIRVLETWYGKGRLGSHKSCQSGEWVE 252          
BLAST of SMED30034637 vs. Ensembl Nematostella
Match: EDO38600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCH0])

HSP 1 Score: 90.8929 bits (224), Expect = 2.045e-19
Identity = 67/212 (31.60%), Postives = 116/212 (54.72%), Query Frame = 3
Query:  498 NQHR-IMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPR----KEISSNKVNVISRPGPHCPYNGQ-RSDCRGYSVPI-QLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQT-SEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMT--KKCVDGKWINK 1103
            N HR  + +LL SW  +AAKH I ++I  GSL+G  R+RD++P+D D+D+ +       +R+I++PR    K   S    V+       P + + R+ C G +V    +D C+F  P++R+   + +++DIF   Y   +  +  T +  +Y+ T+K+   P   +FP++ C+F+G    CPR++E +L   YG    T  K C +G W+ +
Sbjct:  264 NPHRNTLRDLLASWHLLAAKHKIRYFITSGSLLGYYRNRDIIPYDSDVDVYVDVDSYSTLRSIASPRDFKFKTADSKTRLVVQMDYWGTPMDSRIRTSCDGRTVDRGSVDPCSFQDPMARL-IRRGRYVDIF--AYFTTNGVVNTTPTPMYYDPTTKKYFKP-EDFFPIKPCTFIGTPTYCPRNAETMLKTMYGEHFATPYKICKNGLWVKR 471          
BLAST of SMED30034637 vs. Ensembl Nematostella
Match: EDO35576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL37])

HSP 1 Score: 58.9214 bits (141), Expect = 3.428e-9
Identity = 23/75 (30.67%), Postives = 46/75 (61.33%), Query Frame = 3
Query:  441 NVSYQGY--MDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQ 659
            N+  +G+   D  H G  ++     ++  +L+ + +IA  +G+ +W+  G+L+G++RHR  +PWD D DI++P +
Sbjct:  101 NLGKEGFDCPDIRHTGSSSVRCSQLVLTRMLRIFDQIARSNGLKYWLTSGTLLGAVRHRGFIPWDGDADIEMPLE 175          
BLAST of SMED30034637 vs. Ensembl Medaka
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:101164830])

HSP 1 Score: 52.7582 bits (125), Expect = 9.803e-7
Identity = 20/48 (41.67%), Postives = 33/48 (68.75%), Query Frame = 3
Query:  507 RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDI 650
            R + E  K  I I    G+ +W+  GSL+G++RH+D++PWD+D+D+ I
Sbjct:  356 RALRETTKYVINILESSGVRYWLEGGSLLGAVRHQDIIPWDYDVDLGI 403          
BLAST of SMED30034637 vs. Planmine SMEST
Match: SMESG000043344.1 (SMESG000043344.1)

HSP 1 Score: 325.479 bits (833), Expect = 4.356e-109
Identity = 155/156 (99.36%), Postives = 155/156 (99.36%), Query Frame = 3
Query:  369 MMSGNLSSVLVSETSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR 836
            MMSGNLSSVLVSETS SEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR
Sbjct:    1 MMSGNLSSVLVSETSSSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR 156          
BLAST of SMED30034637 vs. Planmine SMEST
Match: SMESG000043344.1 (SMESG000043344.1)

HSP 1 Score: 322.783 bits (826), Expect = 4.059e-108
Identity = 154/155 (99.35%), Postives = 154/155 (99.35%), Query Frame = 3
Query:  372 MSGNLSSVLVSETSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR 836
            MSGNLSSVLVSETS SEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR
Sbjct:    1 MSGNLSSVLVSETSSSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISR 155          
BLAST of SMED30034637 vs. Planmine SMEST
Match: SMESG000043345.1 (SMESG000043345.1)

HSP 1 Score: 287.73 bits (735), Expect = 4.759e-93
Identity = 127/232 (54.74%), Postives = 170/232 (73.28%), Query Frame = 3
Query:  399 VSETSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTKKCVDGKW 1094
            +S+    +I+ +N N+SYQGYMD ++D +C IPN+H+ +F ++KSWI+I A++ I WW+  GSLIGSLRH+DM+PWD DIDI IP Q+E ++R ISTPR EIS++K+N+I+RPGPHCPYNG R +C+G  V    D C+FCGP +R+FF     +DI+L    IH+NQ++   E  YEY      +P+ WYFPLR CSFMGLIV CP  SE ILN +YG F+M  KCV+GKW
Sbjct:   17 ISQLESDKIKIMNENISYQGYMDSSYDRECGIPNEHKTLFRIMKSWIEITARNNITWWMIYGSLIGSLRHQDMIPWDSDIDIGIPSQYENVLRQISTPRSEISNDKINIITRPGPHCPYNGMRINCQGKPVTSHEDGCSFCGPFARLFFKPDIRIDIYLFYIQIHENQLQILDEGIYEYMPNPLYFPLNWYFPLRNCSFMGLIVQCPSKSEIILNDYYGDFKMRSKCVNGKW 248          
BLAST of SMED30034637 vs. Planmine SMEST
Match: SMESG000043345.1 (SMESG000043345.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.104e-92
Identity = 127/232 (54.74%), Postives = 170/232 (73.28%), Query Frame = 3
Query:  399 VSETSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQHRIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPFQFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTKKCVDGKW 1094
            +S+    +I+ +N N+SYQGYMD ++D +C IPN+H+ +F ++KSWI+I A++ I WW+  GSLIGSLRH+DM+PWD DIDI IP Q+E ++R ISTPR EIS++K+N+I+RPGPHCPYNG R +C+G  V    D C+FCGP +R+FF     +DI+L    IH+NQ++   E  YEY      +P+ WYFPLR CSFMGLIV CP  SE ILN +YG F+M  KCV+GKW
Sbjct:   75 ISQLESDKIKIMNENISYQGYMDSSYDRECGIPNEHKTLFRIMKSWIEITARNNITWWMIYGSLIGSLRHQDMIPWDSDIDIGIPSQYENVLRQISTPRSEISNDKINIITRPGPHCPYNGMRINCQGKPVTSHEDGCSFCGPFARLFFKPDIRIDIYLFYIQIHENQLQILDEGIYEYMPNPLYFPLNWYFPLRNCSFMGLIVQCPSKSEIILNDYYGDFKMRSKCVNGKW 306          
BLAST of SMED30034637 vs. Planmine SMEST
Match: SMESG000043348.1 (SMESG000043348.1)

HSP 1 Score: 267.314 bits (682), Expect = 2.015e-85
Identity = 128/135 (94.81%), Postives = 130/135 (96.30%), Query Frame = 3
Query:  699 EISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTKKCVDGKWINK 1103
            ++ S  VNVISRPGPHCPYNGQRSDCRGYSVPIQ DVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIV CPRDSEKILNKFYGTFEMTKKCVDGKWINK
Sbjct:  101 KMRSKCVNVISRPGPHCPYNGQRSDCRGYSVPIQWDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVPCPRDSEKILNKFYGTFEMTKKCVDGKWINK 235          

HSP 2 Score: 113.235 bits (282), Expect = 3.890e-28
Identity = 53/107 (49.53%), Postives = 68/107 (63.55%), Query Frame = 3
Query:  765 RSDCRGYSVPIQLDVCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLYPIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTKKCVD 1085
            R +C+G  V    D C+FCGP +R+FF     +DI+L    IH+NQ++   E  YEY      +P+ WYFPLR CSFMGLIV CP  SE ILN +YG F+M  KCV+
Sbjct:    2 RINCQGKPVTSHEDSCSFCGPFARLFFKPDIRIDIYLFYIQIHENQLQILDEGIYEYMPNPLYFPLNWYFPLRNCSFMGLIVQCPSKSETILNDYYGDFKMRSKCVN 108          
The following BLAST results are available for this feature:
BLAST of SMED30034637 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034637 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034637 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034637 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkrp1.451e-641.67fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
fkrp1.451e-641.67fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of SMED30034637 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034637 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fkrp3.963e-632.20fukutin related protein [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of SMED30034637 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q68W49|Y683_RICTY2.625e-632.53Uncharacterized protein RT0683 OS=Rickettsia typhi... [more]
back to top
BLAST of SMED30034637 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L6M57.613e-3734.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y5A13.734e-3637.63Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
G7YSX85.612e-3633.47Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A419Q1H55.780e-3633.47Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A5J4NGR67.480e-3638.54Uncharacterized protein OS=Paragonimus westermani ... [more]
back to top
BLAST of SMED30034637 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fkrp2.146e-641.67fukutin related protein [Source:NCBI gene;Acc:1030... [more]
fkrp2.245e-641.67fukutin related protein [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of SMED30034637 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fkrp3.853e-721.13fukutin related protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of SMED30034637 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034637 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456034.310e-2529.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311923.984e-2027.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455406.865e-2029.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386002.045e-1931.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355763.428e-930.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30034637 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fkrp9.803e-741.67fukutin related protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of SMED30034637 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043344.14.356e-10999.36SMESG000043344.1[more]
SMESG000043344.14.059e-10899.35SMESG000043344.1[more]
SMESG000043345.14.759e-9354.74SMESG000043345.1[more]
SMESG000043345.12.104e-9254.74SMESG000043345.1[more]
SMESG000043348.12.015e-8594.81SMESG000043348.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034637 ID=SMED30034637|Name=SMED30034637|organism=Schmidtea mediterranea sexual|type=transcript|length=1892bp
ATGGATGTGATTATTAAATTAAAGAATTAATTCAGAATTTCATTTTAATA
AATACTTGACAAAATCCGTTCGACAATTCGATGACGCCATGAATTCCAGC
CAATCAGAATTCGCTAACTATTCCGGCATCATCCAATCAGAATCAAGCAG
AATCGATCGATTTTCTACAGCATCAATAATAAGCTATATTAGAAAAATTA
CAAATCATGGATAAGTTTGCAAAATTGGTTAAATTAATTTGTTTCTTTTG
TATAATTTTGTTGATTTTATTTTTTTACCAAAATGGTGGATTTATTTTCA
ATTCAACAGTGAATGAATTTCTTGCTAGGAAACACTTTTCAATTTACTTT
AATGGTGGCAAATCGTTTATGATGTCCGGAAATCTTTCTTCGGTTTTGGT
CTCTGAGACAAGTCCATCGGAAATTGAACGCCTCAATTGGAATGTATCCT
ATCAAGGCTATATGGATAGAAATCACGATGGAAAATGCGCAATTCCAAAT
CAACATCGAATCATGTTTGAACTGTTGAAAAGTTGGATTAAAATCGCAGC
AAAACATGGCATCATTTGGTGGATAAATTGCGGATCTCTCATTGGTTCGT
TAAGACATCGAGATATGGTGCCATGGGATCATGATATAGATATAGATATT
CCTTTCCAATTTGAACAAATAATTAGAAACATAAGTACTCCACGTAAAGA
GATTAGCTCCAACAAGGTGAATGTCATTTCCCGGCCTGGACCTCATTGCC
CATATAATGGTCAGAGATCAGATTGCAGGGGATATTCAGTTCCAATACAA
TTGGACGTTTGTGCTTTCTGTGGACCCATTTCGAGGGTATTCTTTGACAA
ATCGAAATTTCTGGATATATTCTTATCTCTATACAGTATTCATGACAATC
AAATAAAACAGACTTCAGAAGCGTTCTATGAATACACTTCTAAGCAGCCT
TTGTATCCTATTTATTGGTATTTCCCATTGAGAAAGTGCTCATTTATGGG
ATTAATCGTCCTTTGTCCAAGGGACTCGGAAAAAATATTGAATAAATTCT
ATGGAACATTTGAAATGACTAAGAAATGTGTCGACGGTAAATGGATAAAT
AAATAATCTTATTCAAATATTTAATTAAAAATGTTTCATTATTTTTGTGC
GACTTTTATCTCGTATCATTGAATGTGATAGCTCGTAAACAAATGTCTAA
ATGCGACAATCTGATTGGATAGCAAAATGTGCTGCGTTAGAAAACTATTT
TGATTTATCAAAAAATCAATAAAATAGTTAATAAAATTATAACGAGTAAT
ATTCACCGATGGTCTTTTAAGTGTACAATAAATAATAAGAAATAAATAAT
AAATTTTTCAATTTAATAACGAAAAATATGTGAGTAGTGAAAAATGAATA
TTTTTAAAATAATTACGTTTTTGAATTTATGTAAAATTAATGTAGAGAAC
CAGAATTGTGTACAGAGCATTTAAAAAATAAAATTTAACACAAACTAAAA
ATAAAATTGAAGCTCAAAATTAAATAAAATTTTAGTGCTTATGGGAGAGC
CCAAAACCTATGTGTTTTAAAAAATTAAATAAAAATCACATTTAAATAAA
ATTTTAAACTCCCCCTAGAAATGTTTTATAGGGGGTTTAACAAGAAATTT
TTCAAACCAAATATTCACTGAGGCACACTGCTTACTTGGCATTACTTTTA
GATTTTCTTATTCTGATAGAGAACACGAGGAGTTGGATTAAAAGCTCTTT
CCTGACGAGTAGTGATAATAACTCAACATAGCAGATTTCCTAAATTCCAA
GAATGCGAGGCTGCTGTTGTATTCTAAATAAAATGTCAAGTTTTACTTTT
CTAGATTATTTTCAATTTTTCTTGTGGAAATTTTCCAGCACG
back to top

protein sequence of SMED30034637-orf-1

>SMED30034637-orf-1 ID=SMED30034637-orf-1|Name=SMED30034637-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
MDKFAKLVKLICFFCIILLILFFYQNGGFIFNSTVNEFLARKHFSIYFNG
GKSFMMSGNLSSVLVSETSPSEIERLNWNVSYQGYMDRNHDGKCAIPNQH
RIMFELLKSWIKIAAKHGIIWWINCGSLIGSLRHRDMVPWDHDIDIDIPF
QFEQIIRNISTPRKEISSNKVNVISRPGPHCPYNGQRSDCRGYSVPIQLD
VCAFCGPISRVFFDKSKFLDIFLSLYSIHDNQIKQTSEAFYEYTSKQPLY
PIYWYFPLRKCSFMGLIVLCPRDSEKILNKFYGTFEMTKKCVDGKWINK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007074LicD_fam
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007074LicD familyPFAMPF04991LicDcoord: 235..283
e-value: 3.9E-5
score: 23.9
coord: 115..150
e-value: 6.1E-11
score: 42.9
NoneNo IPR availablePANTHERPTHR43404FAMILY NOT NAMEDcoord: 91..290
NoneNo IPR availableTMHMMTMhelixcoord: 7..29