Tyrosine-protein phosphatase non-receptor type 9

Overview
NameTyrosine-protein phosphatase non-receptor type 9
Smed IDSMED30034636
Length (bp)2852
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein phosphatase non-receptor type 9 (SMED30034636) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type 9 (SMED30034636) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase non-receptor type 9 (SMED30034636) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type 9 (SMED30034636) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034636

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034636h1SMcG0006754 dd_Smed_v4_2827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034636h1SMcG0006754 dd_Smed_v4_2827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034636h1SMcG0006754 dd_Smed_v4_2827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034636h1SMcG0006754 dd_Smed_v4_2827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Match: PTPN9 (protein tyrosine phosphatase non-receptor type 9 [Source:HGNC Symbol;Acc:HGNC:9661])

HSP 1 Score: 214.542 bits (545), Expect = 5.497e-59
Identity = 121/331 (36.56%), Postives = 178/331 (53.78%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    L ++ +G  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V++
Sbjct:  292 VDYVNARQKQGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIRFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSS 583          

HSP 2 Score: 179.874 bits (455), Expect = 4.297e-47
Identity = 87/194 (44.85%), Postives = 132/194 (68.04%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K+    VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   46 VAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 237          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Match: PTPN9 (protein tyrosine phosphatase non-receptor type 9 [Source:HGNC Symbol;Acc:HGNC:9661])

HSP 1 Score: 214.157 bits (544), Expect = 5.660e-59
Identity = 121/331 (36.56%), Postives = 178/331 (53.78%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    L ++ +G  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V++
Sbjct:  282 VDYVNARQKQGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIRFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSS 573          

HSP 2 Score: 179.489 bits (454), Expect = 4.788e-47
Identity = 87/194 (44.85%), Postives = 132/194 (68.04%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K+    VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   36 VAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 227          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 159.458 bits (402), Expect = 6.019e-39
Identity = 103/295 (34.92%), Postives = 145/295 (49.15%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ +    I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   +Y +C    ++Y
Sbjct: 1696 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1939          

HSP 2 Score: 148.673 bits (374), Expect = 1.678e-35
Identity = 105/294 (35.71%), Postives = 144/294 (48.98%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +N PKNRY+++   + SRV +++ I       EG    +  +DYI+AN+VDGYR  NAY+ TQGPL  T  DFW M+ + R   IVM TR +E++R KC QYWP    ET         Y   QVT L + E    C              R   LH KN  + ++  V  F F +WPD G+P     FL F   +R+    N    G            PIVVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY +    +++    VG  NT
Sbjct: 1415 VNKPKNRYANVIAYDHSRV-ILQPI-------EG----IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTET---------YGFIQVTLLDTIELATFC-------------VRTFSLH-KN-GSSEKREVRQFQFTAWPDHGVPEYPTPFLAF---LRRVKTCNPPDAG------------PIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLE---AVGCGNT 1654          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 159.458 bits (402), Expect = 7.329e-39
Identity = 103/295 (34.92%), Postives = 145/295 (49.15%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ +    I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   +Y +C    ++Y
Sbjct: 1658 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1901          

HSP 2 Score: 148.288 bits (373), Expect = 2.009e-35
Identity = 105/294 (35.71%), Postives = 144/294 (48.98%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +N PKNRY+++   + SRV +++ I       EG    +  +DYI+AN+VDGYR  NAY+ TQGPL  T  DFW M+ + R   IVM TR +E++R KC QYWP    ET         Y   QVT L + E    C              R   LH KN  + ++  V  F F +WPD G+P     FL F   +R+    N    G            PIVVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY +    +++    VG  NT
Sbjct: 1377 VNKPKNRYANVIAYDHSRV-ILQPI-------EG----IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTET---------YGFIQVTLLDTIELATFC-------------VRTFSLH-KN-GSSEKREVRQFQFTAWPDHGVPEYPTPFLAF---LRRVKTCNPPDAG------------PIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLE---AVGCGNT 1616          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 158.688 bits (400), Expect = 1.102e-38
Identity = 103/295 (34.92%), Postives = 145/295 (49.15%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ +    I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   +Y +C    ++Y
Sbjct: 1253 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEY 1496          

HSP 2 Score: 147.902 bits (372), Expect = 2.202e-35
Identity = 105/294 (35.71%), Postives = 144/294 (48.98%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +N PKNRY+++   + SRV +++ I       EG    +  +DYI+AN+VDGYR  NAY+ TQGPL  T  DFW M+ + R   IVM TR +E++R KC QYWP    ET         Y   QVT L + E    C              R   LH KN  + ++  V  F F +WPD G+P     FL F   +R+    N    G            PIVVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY +    +++    VG  NT
Sbjct:  972 VNKPKNRYANVIAYDHSRV-ILQPI-------EG----IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTET---------YGFIQVTLLDTIELATFC-------------VRTFSLH-KN-GSSEKREVRQFQFTAWPDHGVPEYPTPFLAF---LRRVKTCNPPDAG------------PIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLE---AVGCGNT 1211          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Match: Y48G9A.9 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:H2KZ95])

HSP 1 Score: 142.895 bits (359), Expect = 6.219e-37
Identity = 101/326 (30.98%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 1633 DFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSL--RSKEFG-PNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAK 2601
            +F I +E         ++R      D    T  +   N+ KNRYSD+ C +++RVKL  D +             +  DYIHAN+V      N ++CTQGPL  T+ DFW MI Q R   I+M  +  E+ R KC  YWP          G+   Y   +VT++   S EF   N     V DN         L         +E RVN   + +WPD+G+P   D   H + Q                 +  ++   P VVHCSAGIGRTG  +  E     L    K +  + + ++R QR +C+Q   QYLY    +I +A+
Sbjct:   50 NFIIATEKLGIEGLAKQYRKLDAQQD-SSLTFEAFKQNMHKNRYSDVVCRDTTRVKLTIDKS-------------RYEDYIHANYVKTNYLRNTFICTQGPLQHTIIDFWRMIFQERAESILMLCKTMEEGRPKCVGYWPSL--------GVTETYGCIRVTNMGESSDEFEICNLAVTFVPDNVPVDEQPANL---------KELRVNLIKWPNWPDRGVP---DEKCHTVPQ----------------RLLAQVRHGPCVVHCSAGIGRTGCVVALEFAYNKLDRGLKVDFEEIITELRKQRAQCIQTEIQYLYIHRVMIAFAR 325          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Match: Y48G9A.9 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:H2KZ95])

HSP 1 Score: 142.51 bits (358), Expect = 1.136e-36
Identity = 101/326 (30.98%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 1633 DFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSL--RSKEFG-PNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAK 2601
            +F I +E         ++R      D    T  +   N+ KNRYSD+ C +++RVKL  D +             +  DYIHAN+V      N ++CTQGPL  T+ DFW MI Q R   I+M  +  E+ R KC  YWP          G+   Y   +VT++   S EF   N     V DN         L         +E RVN   + +WPD+G+P   D   H + Q                 +  ++   P VVHCSAGIGRTG  +  E     L    K +  + + ++R QR +C+Q   QYLY    +I +A+
Sbjct:   59 NFIIATEKLGIEGLAKQYRKLDAQQD-SSLTFEAFKQNMHKNRYSDVVCRDTTRVKLTIDKS-------------RYEDYIHANYVKTNYLRNTFICTQGPLQHTIIDFWRMIFQERAESILMLCKTMEEGRPKCVGYWPSL--------GVTETYGCIRVTNMGESSDEFEICNLAVTFVPDNVPVDEQPANL---------KELRVNLIKWPNWPDRGVP---DEKCHTVPQ----------------RLLAQVRHGPCVVHCSAGIGRTGCVVALEFAYNKLDRGLKVDFEEIITELRKQRAQCIQTEIQYLYIHRVMIAFAR 334          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Match: T22C1.8 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q22668])

HSP 1 Score: 144.05 bits (362), Expect = 1.248e-35
Identity = 95/291 (32.65%), Postives = 134/291 (46.05%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINA-YVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGY 2613
            N  KNRY D+ C + +RV L          + GD       DYIHAN+V+G   +NA ++ TQG    TV DFW M++  +   IVM     E  + KC QY+PE   E   +     L                 C  E   D+  ++  + T L V+N+  G+EH + H +  SWPD+ +PNST   L  +  +R                       P+ VHCSAGIGRTGTF+  E C + LTD  + +L  T   +R+ R   +Q   QY+     +I+Y K  GY
Sbjct:  151 NPTKNRYKDVVCNDITRVILS---------DGGD------GDYIHANYVNG---LNAPFILTQGATAATVIDFWRMVVHTKTAYIVMLCEVMEDGKAKCAQYYPEKAGEAMTFGAWTIL-----------------CSLE---DDKDANIIKRT-LSVRNVDNGKEHILKHLHTKSWPDRCVPNSTMALLRMLYIVRTASG-------------------PVTVHCSAGIGRTGTFVAIEACLQILTDGKELDLLGTCRALRNSRAGSIQVDIQYMALVQILINYGKDNGY 383          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Match: T22C1.8 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q22668])

HSP 1 Score: 144.05 bits (362), Expect = 1.248e-35
Identity = 95/291 (32.65%), Postives = 134/291 (46.05%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINA-YVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGY 2613
            N  KNRY D+ C + +RV L          + GD       DYIHAN+V+G   +NA ++ TQG    TV DFW M++  +   IVM     E  + KC QY+PE   E   +     L                 C  E   D+  ++  + T L V+N+  G+EH + H +  SWPD+ +PNST   L  +  +R                       P+ VHCSAGIGRTGTF+  E C + LTD  + +L  T   +R+ R   +Q   QY+     +I+Y K  GY
Sbjct:  151 NPTKNRYKDVVCNDITRVILS---------DGGD------GDYIHANYVNG---LNAPFILTQGATAATVIDFWRMVVHTKTAYIVMLCEVMEDGKAKCAQYYPEKAGEAMTFGAWTIL-----------------CSLE---DDKDANIIKRT-LSVRNVDNGKEHILKHLHTKSWPDRCVPNSTMALLRMLYIVRTASG-------------------PVTVHCSAGIGRTGTFVAIEACLQILTDGKELDLLGTCRALRNSRAGSIQVDIQYMALVQILINYGKDNGY 383          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Match: T27A3.5 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:P91498])

HSP 1 Score: 137.117 bits (344), Expect = 7.572e-35
Identity = 92/297 (30.98%), Postives = 131/297 (44.11%), Query Frame = 1
Query: 1714 PQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKH 2604
            P+     HP    KNRY D+ CI+ +RV L               P   P+DYIHANWV      N ++CTQGP   TV DF+ +I Q + P +VM     E  + KC QYWPET     I      L D      +         P++ V  N      ++T++  K    G  H   H+ + +WPD+G+P         +I+++                       PIVVHCSAGIGRTG+ +  EI         K  L   + +IR+QR+  VQ   QYL+    ++  A++
Sbjct:   91 PKTGHEGHP---EKNRYKDVYCIDDTRVVL-------------KWPEDSPSDYIHANWVK-INGANKFICTQGPTEKTVDDFYRLIWQEKAPCVVMLCNIMECGKKKCEQYWPETADGQMI------LMDGKLTVKIAE-------PAKEVEQNIL--LMKITVIDDK----GTSHNFEHWQWKAWPDRGVPELPMAVFRLLIRLKTA--------------------SPIVVHCSAGIGRTGSIVGLEIALVKFCAGEKVVLKDIVKEIRNQRHGSVQTDAQYLFMHRVLLALAEN 331          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0071407)

HSP 1 Score: 199.519 bits (506), Expect = 6.167e-55
Identity = 120/322 (37.27%), Postives = 167/322 (51.86%), Query Frame = 1
Query: 1657 HSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            H       + RN +  G    F       NL KNRY+D+ C + SRV L  +        +GD    +P+DYI+AN+VDGY+Q NAY+ TQGPL  T  DFW MI +    +IVM TR  E+ R KC QYW E T+E+           S +      +     C  +          Y V  L ++N++T +   V+H+ F SWPD G+P+S    L+F+ ++R+     +  LG       +   PPIVVHCSAGIGRTGTFI  +IC   L D G  ++  T+ KIRSQR   +Q   QY++C   +I+YA   G + T
Sbjct:  202 HGLIKEYADIRNRAPEG---TFLHARMRANLTKNRYTDVLCYDHSRVVLAHE--------DGD----EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-EPTEES-----------SLEFGDYHVRTISVECNED----------YMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR--GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQT 484          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0333427)

HSP 1 Score: 199.519 bits (506), Expect = 6.167e-55
Identity = 120/322 (37.27%), Postives = 167/322 (51.86%), Query Frame = 1
Query: 1657 HSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            H       + RN +  G    F       NL KNRY+D+ C + SRV L  +        +GD    +P+DYI+AN+VDGY+Q NAY+ TQGPL  T  DFW MI +    +IVM TR  E+ R KC QYW E T+E+           S +      +     C  +          Y V  L ++N++T +   V+H+ F SWPD G+P+S    L+F+ ++R+     +  LG       +   PPIVVHCSAGIGRTGTFI  +IC   L D G  ++  T+ KIRSQR   +Q   QY++C   +I+YA   G + T
Sbjct:  202 HGLIKEYADIRNRAPEG---TFLHARMRANLTKNRYTDVLCYDHSRVVLAHE--------DGD----EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-EPTEES-----------SLEFGDYHVRTISVECNED----------YMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR--GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQT 484          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0100192)

HSP 1 Score: 199.519 bits (506), Expect = 6.167e-55
Identity = 120/322 (37.27%), Postives = 167/322 (51.86%), Query Frame = 1
Query: 1657 HSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            H       + RN +  G    F       NL KNRY+D+ C + SRV L  +        +GD    +P+DYI+AN+VDGY+Q NAY+ TQGPL  T  DFW MI +    +IVM TR  E+ R KC QYW E T+E+           S +      +     C  +          Y V  L ++N++T +   V+H+ F SWPD G+P+S    L+F+ ++R+     +  LG       +   PPIVVHCSAGIGRTGTFI  +IC   L D G  ++  T+ KIRSQR   +Q   QY++C   +I+YA   G + T
Sbjct:  202 HGLIKEYADIRNRAPEG---TFLHARMRANLTKNRYTDVLCYDHSRVVLAHE--------DGD----EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-EPTEES-----------SLEFGDYHVRTISVECNED----------YMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR--GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQT 484          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0303559)

HSP 1 Score: 199.519 bits (506), Expect = 6.167e-55
Identity = 120/322 (37.27%), Postives = 167/322 (51.86%), Query Frame = 1
Query: 1657 HSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            H       + RN +  G    F       NL KNRY+D+ C + SRV L  +        +GD    +P+DYI+AN+VDGY+Q NAY+ TQGPL  T  DFW MI +    +IVM TR  E+ R KC QYW E T+E+           S +      +     C  +          Y V  L ++N++T +   V+H+ F SWPD G+P+S    L+F+ ++R+     +  LG       +   PPIVVHCSAGIGRTGTFI  +IC   L D G  ++  T+ KIRSQR   +Q   QY++C   +I+YA   G + T
Sbjct:  202 HGLIKEYADIRNRAPEG---TFLHARMRANLTKNRYTDVLCYDHSRVVLAHE--------DGD----EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-EPTEES-----------SLEFGDYHVRTISVECNED----------YMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR--GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQT 484          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Match: Ptpmeg2 (gene:FBgn0028341 transcript:FBtr0100193)

HSP 1 Score: 200.675 bits (509), Expect = 1.966e-54
Identity = 120/322 (37.27%), Postives = 167/322 (51.86%), Query Frame = 1
Query: 1657 HSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            H       + RN +  G    F       NL KNRY+D+ C + SRV L  +        +GD    +P+DYI+AN+VDGY+Q NAY+ TQGPL  T  DFW MI +    +IVM TR  E+ R KC QYW E T+E+           S +      +     C  +          Y V  L ++N++T +   V+H+ F SWPD G+P+S    L+F+ ++R+     +  LG       +   PPIVVHCSAGIGRTGTFI  +IC   L D G  ++  T+ KIRSQR   +Q   QY++C   +I+YA   G + T
Sbjct:  301 HGLIKEYADIRNRAPEG---TFLHARMRANLTKNRYTDVLCYDHSRVVLAHE--------DGD----EPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQYW-EPTEES-----------SLEFGDYHVRTISVECNED----------YMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHPR--GPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQT 583          

HSP 2 Score: 105.145 bits (261), Expect = 6.126e-23
Identity = 50/101 (49.50%), Postives = 68/101 (67.33%), Query Frame = 1
Query:  523 MTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSL 825
            M+GS YSNFD  LS KIL LLKG YPARL KV+I T PLWF+A F  LR+FV++KL++RV+ ++   +L  H+ +  LP+  GG    +H  WL +   S+
Sbjct:    1 MSGSKYSNFDYDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRLFVREKLRERVFTVSV-PQLALHVPRKALPIHLGGTLEVDHATWLLSCRQSM 100          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Match: ptpn9b (protein tyrosine phosphatase non-receptor type 9b [Source:ZFIN;Acc:ZDB-GENE-090313-52])

HSP 1 Score: 201.83 bits (512), Expect = 9.671e-54
Identity = 102/221 (46.15%), Postives = 147/221 (66.52%), Query Frame = 1
Query:  160 QSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            QS   ++  +  A+KFL A+KF++  A+DL+  ++  R KE +  I+P E  +  EL S KFT L   D K GA++ +FTA+LH P + +H+ VL+A+I+QLD  +    TQ++GLIFIY+MT S Y+NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+    LP   GG+  ++H+ W+++  NS
Sbjct:   24 QSQNADLVSQMTAVKFLMARKFDVSRAIDLFQAYKNTRIKEGIYNINPNEEPLRSELLSGKFTVLPGRDAK-GAALALFTARLHQPDRTTHKAVLQAIIYQLDKAIESVQTQRDGLIFIYDMTNSTYANFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVCTV-KAHELVNHIPVSSLPEHLGGSSQYSHIAWIQSCVNS 242          

HSP 2 Score: 170.629 bits (431), Expect = 2.202e-43
Identity = 104/292 (35.62%), Postives = 153/292 (52.40%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN 2619
            N  KNRYSD+ C++ SRV L         LN+ D    + +DYI+A+++DGY+  NAY+ TQGPL  T  DFW M+ +  V IIVM TR  E+ R KC QYWP       +  G    Y  F V ++  + F                 ++++ L + N +TG+   V+H+ + SWPD G+P S    L F   ++     ++  L    +       PP+VVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   +I+Y +  G + 
Sbjct:  483 NQIKNRYSDVLCLDQSRVHLC-------PLNDEDD---ETSDYINASFMDGYKWSNAYIATQGPLPKTFGDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWP-------LEAGRTEEYGYFLVRNVHIEVFQD---------------FKLSHLELFNTQTGECREVSHYLYMSWPDFGVPKSASAMLDFRAHVKHRQESSLRTL--YPDWTGPPGGPPVVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDIKQTVRRMRTQRAFSIQTWDQYYFCYKAVIEYGQQSGLLQ 740          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9a [Source:ZFIN;Acc:ZDB-GENE-101027-1])

HSP 1 Score: 191.815 bits (486), Expect = 1.938e-51
Identity = 106/301 (35.22%), Postives = 155/301 (51.50%), Query Frame = 1
Query: 1720 FTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            FT      N  +NRY D+ C++ +RV+L    N             + +DYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ +  V +IVM TR  E  R KC QYWP+         G   +Y    V + R              DN +   Y  T L + N  T ++ +V HF F SWPD G+P+S    + F+  ++   +  +   G  ++       PP+VVHCSAGIGRTGTF   +IC   L D G  N+ QT+ ++RSQR   +Q   QY +C   I+++A+  G ++ 
Sbjct:  306 FTCALAAHNQERNRYGDVLCLDQTRVRLKARRN-------------ERSDYINASFMDGYKQKNAYIGTQGPLEKTYGDFWRMVWEQNVLVIVMTTRTDEGGRRKCGQYWPQEE-------GGQEVYGYIAVVNHR-------------VDNHAH--YNQTTLELHNTETFEQRQVTHFQFLSWPDYGVPSSAVSLIDFLGAVKHQQQWAVQAFG--TQWRGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQDVGTLNICQTVRRMRSQRAFSIQTPEQYYFCHAAILEHAQRQGLLSA 569          

HSP 2 Score: 171.4 bits (433), Expect = 1.283e-44
Identity = 92/195 (47.18%), Postives = 134/195 (68.72%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            ++A+KFL A+KF++  A++L+  +   R +E ++++ P +  +  EL S KFT L    D SGASI ++TAKLHHPSK  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV+I   P+WFR  +N L + +K+KL++RV ++ K  +L  HL +D LP   GG
Sbjct:   36 DVAVKFLMARKFDVLRAIELFHSYRETRLREGIVKLQPHKEPLRSELLSGKFTVL-GVRDPSGASIALYTAKLHHPSKTGNHVVLQALFYLLDRAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVLIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMADLRQHLPRDCLPEHLGG 228          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9a [Source:ZFIN;Acc:ZDB-GENE-101027-1])

HSP 1 Score: 191.045 bits (484), Expect = 2.310e-51
Identity = 106/301 (35.22%), Postives = 155/301 (51.50%), Query Frame = 1
Query: 1720 FTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            FT      N  +NRY D+ C++ +RV+L    N             + +DYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ +  V +IVM TR  E  R KC QYWP+         G   +Y    V + R              DN +   Y  T L + N  T ++ +V HF F SWPD G+P+S    + F+  ++   +  +   G  ++       PP+VVHCSAGIGRTGTF   +IC   L D G  N+ QT+ ++RSQR   +Q   QY +C   I+++A+  G ++ 
Sbjct:  295 FTCALAAHNQERNRYGDVLCLDQTRVRLKARRN-------------ERSDYINASFMDGYKQKNAYIGTQGPLEKTYGDFWRMVWEQNVLVIVMTTRTDEGGRRKCGQYWPQEE-------GGQEVYGYIAVVNHR-------------VDNHAH--YNQTTLELHNTETFEQRQVTHFQFLSWPDYGVPSSAVSLIDFLGAVKHQQQWAVQAFG--TQWRGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQDVGTLNICQTVRRMRSQRAFSIQTPEQYYFCHAAILEHAQRQGLLSA 558          

HSP 2 Score: 171.4 bits (433), Expect = 1.224e-44
Identity = 92/195 (47.18%), Postives = 134/195 (68.72%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            ++A+KFL A+KF++  A++L+  +   R +E ++++ P +  +  EL S KFT L    D SGASI ++TAKLHHPSK  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV+I   P+WFR  +N L + +K+KL++RV ++ K  +L  HL +D LP   GG
Sbjct:   25 DVAVKFLMARKFDVLRAIELFHSYRETRLREGIVKLQPHKEPLRSELLSGKFTVL-GVRDPSGASIALYTAKLHHPSKTGNHVVLQALFYLLDRAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVLIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMADLRQHLPRDCLPEHLGG 217          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 164.081 bits (414), Expect = 1.543e-40
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S S P N  KNR  +I   ESSRV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL+ T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   +  F F  WP+QG+P + +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY  C    ++Y
Sbjct: 1539 RFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGV-------EG-------SDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKE----QFGQDG---------PITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEY 1782          

HSP 2 Score: 148.673 bits (374), Expect = 9.635e-36
Identity = 94/286 (32.87%), Postives = 137/286 (47.90%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYA 2598
            +N PKNRY+++   + SRV L           +G P     +DYI+ N++DGYR+ NAY+ TQGPL  T+SDFW M+ + R   IVM TR +E++R KC QYWP    ET         Y   QV+ L + E                  Y V    +    + ++  V  F F +WPD G+P      L F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY++    +++ A
Sbjct: 1258 VNKPKNRYANVIAYDHSRVVL--------TPVDGVPG----SDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTET---------YGMIQVSMLDTVELAT---------------YSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAF---LRRVKACNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAA 1492          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 164.081 bits (414), Expect = 1.543e-40
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S S P N  KNR  +I   ESSRV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL+ T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   +  F F  WP+QG+P + +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY  C    ++Y
Sbjct: 1539 RFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGV-------EG-------SDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKE----QFGQDG---------PITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEY 1782          

HSP 2 Score: 148.673 bits (374), Expect = 9.635e-36
Identity = 94/286 (32.87%), Postives = 137/286 (47.90%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYA 2598
            +N PKNRY+++   + SRV L           +G P     +DYI+ N++DGYR+ NAY+ TQGPL  T+SDFW M+ + R   IVM TR +E++R KC QYWP    ET         Y   QV+ L + E                  Y V    +    + ++  V  F F +WPD G+P      L F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY++    +++ A
Sbjct: 1258 VNKPKNRYANVIAYDHSRVVL--------TPVDGVPG----SDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTET---------YGMIQVSMLDTVELAT---------------YSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAF---LRRVKACNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAA 1492          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:Xenbase;Acc:XB-GENE-1003080])

HSP 1 Score: 195.667 bits (496), Expect = 1.689e-52
Identity = 101/209 (48.33%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF++  A+DL+  +   R KE +  I+P E  +  EL S KFT L    D +GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ+NGLIFIY+M  S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+ K+ LP   GG    +HV W+++  NS
Sbjct:   37 ALKFLMARKFDVTRAIDLFQAYRNTRLKEGIYNINPDEEPLRAELLSGKFTVL-PGRDANGAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIERVETQRNGLIFIYDMINSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVRTV-KAHELVNHIPKESLPDHLGGTSKISHVAWIQSCVNS 243          

HSP 2 Score: 190.66 bits (483), Expect = 1.048e-50
Identity = 116/312 (37.18%), Postives = 159/312 (50.96%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            E R D   G     +  SH  N  KNRYSD+ C++ SRVKL            G     + TDYI+A+++D Y++ NAY+ TQGPL  T  DFW M+ + RV IIVM TR  E+ R KC QYWP       +  G       F + ++    F                 +++T L V N +T +   V H+ + SWPD G+P S    L F  Q++Q   + +  LG E         PPIVVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   II+YA+  G +
Sbjct:  310 EIRKDPPVGSF-DISKKSH--NQAKNRYSDVLCLDLSRVKL------------GLVGTDETTDYINASFMDDYKRKNAYIATQGPLPKTFDDFWRMVWEQRVLIIVMTTRVIERGRIKCGQYWP-------LEAGRGEDTGHFIIRNIHIDLFQD---------------FKLTHLEVYNKQTDESRSVAHYQYMSWPDFGVPKSASAMLDFRSQVKQHQAVAVQALGLE--WTGHPAGPPIVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDVLQTVKRMRTQRAFSIQTWDQYYFCYMAIIEYAQRKGII 582          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:Xenbase;Acc:XB-GENE-1003080])

HSP 1 Score: 194.897 bits (494), Expect = 2.018e-52
Identity = 101/209 (48.33%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF++  A+DL+  +   R KE +  I+P E  +  EL S KFT L    D +GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ+NGLIFIY+M  S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+ K+ LP   GG    +HV W+++  NS
Sbjct:   37 ALKFLMARKFDVTRAIDLFQAYRNTRLKEGIYNINPDEEPLRAELLSGKFTVL-PGRDANGAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIERVETQRNGLIFIYDMINSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVRTV-KAHELVNHIPKESLPDHLGGTSKISHVAWIQSCVNS 243          

HSP 2 Score: 183.726 bits (465), Expect = 1.314e-48
Identity = 114/305 (37.38%), Postives = 154/305 (50.49%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            E R D   G     +  SH  N  KNRYSD+ C++ SRVKL      T             TDYI+A+++D Y++ NAY+ TQGPL  T  DFW M+ + RV IIVM TR  E+ R KC QYWP       +  G       F + ++    F                 +++T L V N +T +   V H+ + SWPD G+P S    L F  Q++Q   + +  LG E         PPIVVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   II+Y
Sbjct:  300 EIRKDPPVGSF-DISKKSH--NQAKNRYSDVLCLDLSRVKL----GLT-------------TDYINASFMDDYKRKNAYIATQGPLPKTFDDFWRMVWEQRVLIIVMTTRVIERGRIKCGQYWP-------LEAGRGEDTGHFIIRNIHIDLFQD---------------FKLTHLEVYNKQTDESRSVAHYQYMSWPDFGVPKSASAMLDFRSQVKQHQAVAVQALGLE--WTGHPAGPPIVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDVLQTVKRMRTQRAFSIQTWDQYYFCYMAIIEY 560          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:Xenbase;Acc:XB-GENE-1003080])

HSP 1 Score: 197.208 bits (500), Expect = 2.436e-52
Identity = 101/209 (48.33%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF++  A+DL+  +   R KE +  I+P E  +  EL S KFT L   D  +GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ+NGLIFIY+M  S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+ K+ LP   GG    +HV W+++  NS
Sbjct:   37 ALKFLMARKFDVTRAIDLFQAYRNTRLKEGIYNINPDEEPLRAELLSGKFTVLPGRD-ANGAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIERVETQRNGLIFIYDMINSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVRTV-KAHELVNHIPKESLPDHLGGTSKISHVAWIQSCVNS 243          

HSP 2 Score: 188.734 bits (478), Expect = 1.480e-49
Identity = 116/312 (37.18%), Postives = 159/312 (50.96%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            E R D   G     +  SH  N  KNRYSD+ C++ SRVKL            G     + TDYI+A+++D Y++ NAY+ TQGPL  T  DFW M+ + RV IIVM TR  E+ R KC QYWP       +  G       F + ++    F                 +++T L V N +T +   V H+ + SWPD G+P S    L F  Q++Q   + +  LG E         PPIVVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   II+YA+  G +
Sbjct:  407 EIRKDPPVGSF-DISKKSH--NQAKNRYSDVLCLDLSRVKL------------GLVGTDETTDYINASFMDDYKRKNAYIATQGPLPKTFDDFWRMVWEQRVLIIVMTTRVIERGRIKCGQYWP-------LEAGRGEDTGHFIIRNIHIDLFQD---------------FKLTHLEVYNKQTDESRSVAHYQYMSWPDFGVPKSASAMLDFRSQVKQHQAVAVQALGLE--WTGHPAGPPIVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDVLQTVKRMRTQRAFSIQTWDQYYFCYMAIIEYAQRKGII 679          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:Xenbase;Acc:XB-GENE-1003080])

HSP 1 Score: 196.438 bits (498), Expect = 5.902e-52
Identity = 101/209 (48.33%), Postives = 138/209 (66.03%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF++  A+DL+  +   R KE +  I+P E  +  EL S KFT L    D +GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ+NGLIFIY+M  S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+ K+ LP   GG    +HV W+++  NS
Sbjct:   69 ALKFLMARKFDVTRAIDLFQAYRNTRLKEGIYNINPDEEPLRAELLSGKFTVL-PGRDANGAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIERVETQRNGLIFIYDMINSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVRTV-KAHELVNHIPKESLPDHLGGTSKISHVAWIQSCVNS 275          

HSP 2 Score: 187.963 bits (476), Expect = 4.553e-49
Identity = 116/312 (37.18%), Postives = 159/312 (50.96%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            E R D   G     +  SH  N  KNRYSD+ C++ SRVKL            G     + TDYI+A+++D Y++ NAY+ TQGPL  T  DFW M+ + RV IIVM TR  E+ R KC QYWP       +  G       F + ++    F                 +++T L V N +T +   V H+ + SWPD G+P S    L F  Q++Q   + +  LG E         PPIVVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   II+YA+  G +
Sbjct:  439 EIRKDPPVGSF-DISKKSH--NQAKNRYSDVLCLDLSRVKL------------GLVGTDETTDYINASFMDDYKRKNAYIATQGPLPKTFDDFWRMVWEQRVLIIVMTTRVIERGRIKCGQYWP-------LEAGRGEDTGHFIIRNIHIDLFQD---------------FKLTHLEVYNKQTDESRSVAHYQYMSWPDFGVPKSASAMLDFRSQVKQHQAVAVQALGLE--WTGHPAGPPIVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDVLQTVKRMRTQRAFSIQTWDQYYFCYMAIIEYAQRKGII 711          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Match: ptpn9 (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:100158581])

HSP 1 Score: 191.045 bits (484), Expect = 4.414e-51
Identity = 119/362 (32.87%), Postives = 181/362 (50.00%), Query Frame = 1
Query: 1543 RPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQ------FTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHW--YRVTLLHVKNLRTGQEHR-VNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP--PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +P+P   L   L      S      RG+T+     ++L  +   +G       Y ++ +      FT    P+N  +NRY D+ C++ +RVKL R +N+              +DYI+A+++DGY Q N Y+ TQGPL  T SDFW MI +  V +IVM TR +E    KC QYWP +T     Y  +                         V + A+ ++  YR T L +   R G++ R ++H  F SWPD G+P+S    ++F   +++  R  + +LG +     + PP  PP+VVHCSAGIGRTGTF   +IC   L D G  ++ +T+ K+R QR   +Q   QY +C  +I++Y
Sbjct:  251 KPDPLDELVMVLGGGPSGSVHRPGARGMTL-----AQLKEYVGRVGRRGTYEEYEEMRKKQPEGTFTVSLAPVNRDRNRYGDVLCLDQTRVKLKR-LNWHER-----------SDYINASFMDGYLQKNMYIGTQGPLEKTFSDFWQMIWEQNVLVIVMTTRVEEGGHRKCGQYWPLSTGSLSTYGAVT------------------------VTNKATENYQHYRKTTLELST-RQGKDKRLISHLQFLSWPDFGVPSSASALINFRGAVKKEQRRLVEELGTQ----WRGPPGGPPLVVHCSAGIGRTGTFCTLDICLSQLDDVGTVSIQETVQKMRQQRAFSIQTPEQYYFCYTSILEY 566          

HSP 2 Score: 179.104 bits (453), Expect = 4.826e-47
Identity = 89/199 (44.72%), Postives = 135/199 (67.84%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHP----SKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +IA+KFL A+KF++  A++L+  +   R +E ++ ++P +  +L EL S KFT L      +GASI IFTAKLHHP    S+ +   VL+AL + LD  +    TQ+NGL FIY+M GS Y+NF++ LS KIL+LL+GA+PARL KV+I +PP+WFR  ++ + + +K+KL++RV+++  + EL  HL    LP + GG
Sbjct:   35 DIAVKFLMARKFDVVRAVELFHSYRETRHREGIVRLNPLQEPLLSELLSGKFTVL-SVRAPTGASIAIFTAKLHHPARRNSRQAQHTVLQALFYLLDRAVESVDTQRNGLFFIYDMGGSQYNNFELELSKKILSLLRGAFPARLKKVLIVSPPVWFRVPYSVISLLLKEKLRERVHMVNAS-ELLEHLPPQCLPESLGG 231          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Match: Ptpn9 (protein tyrosine phosphatase, non-receptor type 9 [Source:MGI Symbol;Acc:MGI:1928376])

HSP 1 Score: 213.001 bits (541), Expect = 1.118e-58
Identity = 121/329 (36.78%), Postives = 175/329 (53.19%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    + +  LG  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V
Sbjct:  292 VDYVNTRQKRGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIRFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSMAVGNLGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMV 581          

HSP 2 Score: 179.874 bits (455), Expect = 2.841e-47
Identity = 87/194 (44.85%), Postives = 133/194 (68.56%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K++   VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   46 VAVKFLMARKFDVLRAVELFHCYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSAQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 237          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 160.999 bits (406), Expect = 1.126e-39
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1002 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEY 1245          

HSP 2 Score: 144.05 bits (362), Expect = 2.120e-34
Identity = 93/285 (32.63%), Postives = 138/285 (48.42%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSE-GVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + SRV L        +  EG P     +DY++AN++DGYR+ NAY+ TQG L  T  DFW MI + R   +VM T+ +E++R KC QYWP    ET         +   QVT L + E    C     +  N SS                ++  V  F F +WPD G+P     FL F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +R+QR   VQ   QY++  + +++
Sbjct:  721 VNKPKNRYANVIAYDHSRVLL--------SAIEGIPG----SDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTET---------HGLVQVTLLDTVELATYCVRTFALYKNGSS----------------EKREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKTCNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLE 953          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 160.999 bits (406), Expect = 1.212e-39
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1243 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEY 1486          

HSP 2 Score: 143.665 bits (361), Expect = 2.828e-34
Identity = 91/284 (32.04%), Postives = 137/284 (48.24%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + SRV L        +  EG P     +DY++AN++DGYR+ NAY+ TQG L  T  DFW MI + R   +VM T+ +E++R KC QYWP    ET         +   QVT L + E    C               V    +    + ++  V  F F +WPD G+P     FL F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +R+QR   VQ   QY++  + +++
Sbjct:  962 VNKPKNRYANVIAYDHSRVLL--------SAIEGIPG----SDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTET---------HGLVQVTLLDTVELATYC---------------VRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKTCNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLE 1194          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 160.999 bits (406), Expect = 1.238e-39
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1250 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEY 1493          

HSP 2 Score: 143.665 bits (361), Expect = 3.013e-34
Identity = 91/284 (32.04%), Postives = 137/284 (48.24%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + SRV L        +  EG P     +DY++AN++DGYR+ NAY+ TQG L  T  DFW MI + R   +VM T+ +E++R KC QYWP    ET         +   QVT L + E    C               V    +    + ++  V  F F +WPD G+P     FL F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +R+QR   VQ   QY++  + +++
Sbjct:  969 VNKPKNRYANVIAYDHSRVLL--------SAIEGIPG----SDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTET---------HGLVQVTLLDTVELATYC---------------VRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKTCNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLE 1201          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 160.999 bits (406), Expect = 1.252e-39
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1254 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEY 1497          

HSP 2 Score: 143.665 bits (361), Expect = 2.892e-34
Identity = 91/284 (32.04%), Postives = 137/284 (48.24%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + SRV L        +  EG P     +DY++AN++DGYR+ NAY+ TQG L  T  DFW MI + R   +VM T+ +E++R KC QYWP    ET         +   QVT L + E    C               V    +    + ++  V  F F +WPD G+P     FL F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +R+QR   VQ   QY++  + +++
Sbjct:  973 VNKPKNRYANVIAYDHSRVLL--------SAIEGIPG----SDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTET---------HGLVQVTLLDTVELATYC---------------VRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKTCNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLE 1205          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Match: sp|P43378|PTN9_HUMAN (Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens OX=9606 GN=PTPN9 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.640e-58
Identity = 121/331 (36.56%), Postives = 178/331 (53.78%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    L ++ +G  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V++
Sbjct:  292 VDYVNARQKQGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIRFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSS 583          

HSP 2 Score: 179.874 bits (455), Expect = 2.063e-46
Identity = 87/194 (44.85%), Postives = 132/194 (68.04%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K+    VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   46 VAVKFLMARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 237          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Match: sp|Q641Z2|PTN9_RAT (Tyrosine-protein phosphatase non-receptor type 9 OS=Rattus norvegicus OX=10116 GN=Ptpn9 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 7.099e-58
Identity = 121/329 (36.78%), Postives = 175/329 (53.19%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    + +  LG  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V
Sbjct:  292 VDYVNTRQKQGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIQFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRSQQSMAVGSLGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMV 581          

HSP 2 Score: 178.718 bits (452), Expect = 5.941e-46
Identity = 87/194 (44.85%), Postives = 132/194 (68.04%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K+    VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   46 VAVKFLMARKFDVLRAVELFHCYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 237          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Match: sp|O35239|PTN9_MOUSE (Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus OX=10090 GN=Ptpn9 PE=1 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 7.821e-58
Identity = 121/329 (36.78%), Postives = 175/329 (53.19%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            +D+    +    Y    + R ++  G    F     P NL KNRY D+PC++ +RVKL +    T             TDYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ + +V +IVM TR +E  R KC QYWP   K+++I  G         VT+L            GV    + + Y+ T L + N    Q+ +V HF F SWPD G+P+S    + F+  +R    + +  LG  S+   + P PPIVVHCSAGIGRTGTF   +IC   L + G  N+ QT+ ++R+QR   +Q   QY +C   I+++A+  G V
Sbjct:  292 VDYVNTRQKRGIYEEYEDIRRENPVGT---FHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQ------------TDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWP-LEKDSRIRFGF------LTVTNL------------GV---ENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSMAVGNLGARSK--GQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMV 581          

HSP 2 Score: 179.874 bits (455), Expect = 1.987e-46
Identity = 87/194 (44.85%), Postives = 133/194 (68.56%), Query Frame = 1
Query:  193 IAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +A+KFL A+KF++  A++L+  +   R KE ++++ P E  +  E+ S KFT L +  D +GASI +FTA+LHHP K++   VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ L  K+LNLLKGA+PARL KV+I   P+WFR  ++ + + +KDK+++R+ IL K  E+  HL ++ LP   GG
Sbjct:   46 VAVKFLMARKFDVLRAVELFHCYRETRRKEGIVKLKPHEEPLRSEILSGKFTIL-NVRDPTGASIALFTARLHHPHKSAQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQIL-KTSEVTQHLPRECLPENLGG 237          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Match: sp|Q5I146|PTPH2_MDBVW (Tyrosine phosphatase H2 OS=Microplitis demolitor bracovirus (isolate Webb) OX=654919 GN=H2 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 7.692e-39
Identity = 91/285 (31.93%), Postives = 131/285 (45.96%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYA 2598
            N   NRY D+ C + +RV L              P      DYI+AN+VDGY     ++CTQ PL  T  DFW  +  +   IIVM  + KE NR +CF YW +         G + ++  F++T+ + +                  +   TLL        QE  V HF F  WPD G+PN     L+FI+ ++   +  I +L  E        PPPIVVHCSAG+GRTG + + +        C   ++  T++ IR+QRY C+    QY +C   +  Y 
Sbjct:   51 NRKLNRYLDMLCFDHTRVTL--------------PAEKNRGDYINANYVDGYEYKKKFICTQAPLQQTAYDFWRTVWMHHTRIIVMMCKKKE-NRKQCFAYWNDI-------EGGDIVFGKFKITTTQIE--------------THLSYIETTLLVTDGTSAIQE--VTHFVFTQWPDYGVPNDVMNLLNFILTVKSAQKDVIRQLAQE-RFKIGDNPPPIVVHCSAGVGRTGAYCLLDSAISEFDACATISIPSTLINIRNQRYYCIFILPQYFFCYRVMERYV 296          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Match: sp|Q64487|PTPRD_MOUSE (Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3)

HSP 1 Score: 160.999 bits (406), Expect = 9.231e-39
Identity = 104/295 (35.25%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   ES+RV L  IR +       EG       +DYI+A+++DGYRQ  AY+ TQGPL  T  DFW M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1660 RFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGV-------EG-------SDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEY 1903          

HSP 2 Score: 144.05 bits (362), Expect = 2.180e-33
Identity = 91/284 (32.04%), Postives = 137/284 (48.24%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + SRV L        +  EG P     +DY++AN++DGYR+ NAY+ TQG L  T  DFW MI + R   +VM T+ +E++R KC QYWP    ET         +   QVT L + E    C               V    +    + ++  V  F F +WPD G+P     FL F   +R+    N    G            P+VVHCSAG+GRTG FIV +   + +      +++  +  +R+QR   VQ   QY++  + +++
Sbjct: 1379 VNKPKNRYANVIAYDHSRVLL--------SAIEGIPG----SDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTET---------HGLVQVTLLDTVELATYC---------------VRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKTCNPPDAG------------PMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLE 1611          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Match: A0A5J4NGE0 (Tyrosine-protein phosphatase non-receptor type 9 (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0003631 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.475e-63
Identity = 132/337 (39.17%), Postives = 189/337 (56.08%), Query Frame = 1
Query: 1723 TSYSHPLNLPKNRYSDIPCIESSRVKL-------------IRDINFTNNLNEGDPPLLKPT-------DYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIY----PGI--------NNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCG-----KFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            +++ H  N  KNRY D+ C E SRV L             I     + +       L  PT       +YIHANWVDGYRQ NA++CTQGPL  TV DFW M+  Y VPI+VM T+  E +R KCF YWPE+ ++   +    PG         ++L+D+  V         PN   E +      H +  + L + NL+  Q   V H+ + SWPD G+P++T+G    ++  R +Y + I KLGY + MDQ++PPPPIVVHCSAGIGRTGT++  +IC+K LTD       + N+  T+ ++RSQRY CVQ A QY++C   ++D++  +G + +
Sbjct:  662 SAFKHVQNREKNRYCDVFCFEDSRVHLRPLSPQITCSSKKIPKATTSPSAGTLHRTLSAPTAAKDLVQNYIHANWVDGYRQKNAFICTQGPLPETVGDFWQMMWDYCVPIVVMITKIFEADRVKCFPYWPESAQKKLRFAYGHPGAIPCQSDANDSLFDTVVVI--------PNFEVENLECQVEEH-FTCSTLRLTNLQNKQHRLVKHYAYSSWPDHGVPHTTEGLQKLLMTARTSYMIAIKKLGYTTYMDQEVPPPPIVVHCSAGIGRTGTYVTADICTKWLTDPDRSEDRRINVPLTVSRVRSQRYGCVQVAAQYVFCYRVLLDFSVSIGLLAS 989          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Match: A0A094ZMI2 (Tyrosine-protein phosphatase non-receptor type 9 OS=Schistosoma haematobium OX=6185 GN=MS3_04139 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.643e-63
Identity = 146/374 (39.04%), Postives = 205/374 (54.81%), Query Frame = 1
Query: 1654 LHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKL-----IRDIN-FTNNLNEGDPPLL----------------KPT-------DYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIY-----------PG----INNLYDSFQVTSLRSKEF---GPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCG----KFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            L+S Y+ L + +N+  Y  I    ++ H LN  KNRY D+ C +++RV L       DI+  + + ++ DP +L                 P        +YIHANWVDGYRQ NA++CTQGPL+ TV DFW MI  Y  PIIVM TR  E  R KC+ YWP+   + K+Y           P      NN +  F   +  + +F      C S G   N +    R+T L +  +RT     V HF F SWPD G P +T+G L  +  ++ TY   I KLGY++  +QKIPPPP+VVHCSAGIGRTGT++  +IC+K L D      K N+  T+ ++RSQR+ CVQ + QY++C   IID+A + G +++
Sbjct:  806 LNSEYSALVQLKNE--YTHI----AFKHILNRSKNRYCDVICHDATRVYLQPLLLSSDISRISTSRSDEDPTVLCNAQKSLTARLHRTHSAPISAHTLVKNYIHANWVDGYRQKNAFICTQGPLSETVGDFWQMIWDYHCPIIVMITRILEAQRSKCYLYWPDVENQ-KLYFSSGHTGCLYAPAPSDRSNNSFSKFTSNNNVTPDFLIENIKCESNG---NFAQTTLRITHLQLHEVRT-----VEHFAFFSWPDHGTPQTTEGLLDLLTSVQSTYLNEIEKLGYKTYENQKIPPPPVVVHCSAGIGRTGTYVTVDICTKWLADSRNTEHKINIPLTVARVRSQRFGCVQVSSQYVFCYRAIIDFAVNSGLLDS 1164          

HSP 2 Score: 159.458 bits (402), Expect = 7.654e-36
Identity = 80/214 (37.38%), Postives = 123/214 (57.48%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGY 831
            ++A   L A+KF++  A++LY  ++   + E +  +DPFE ++  EL S KF  L D +D  G  +  F  +LH  S  +H+ +L ++IFQLDA L   T  +NGL+FI++MT S YSNFD   S K+  +L+ +YP RL +V+I T PLWFRA F  +R+F+++  QD VY+L  +            P+        +H  WL+TA    G+
Sbjct:   32 QLAFNILAARKFSVPQAMELYHNYQTFLASEQITRVDPFEEDVRRELLSGKFVILND-NDIPGVRVAQFFVRLHRKS-GNHRALLHSIIFQLDAALRRETAARNGLVFIFDMTDSKYSNFDYTFSCKLFKMLRSSYPVRLRRVLILTAPLWFRAPFLLMRVFIRELFQDCVYVLRPSPGTKLEALSHPDPIILK----RDHYAWLQTALLRTGW 239          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Match: A0A564ZDD2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14383 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 9.667e-63
Identity = 141/366 (38.52%), Postives = 188/366 (51.37%), Query Frame = 1
Query: 1666 YATLGEFR-NDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKL-IRDINFTNNLNEGD-----PPLLKPTD-----YIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP----ETTKETKIYPGINNLYD------SFQVTSLRSKEFGPNCPSE-----GVCDNASSHW--------------------YRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAK-LGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN 2619
            YA +G  + ND         T++  P N  KNRY D+ C+E SRV L +   +  N  N G        +    D     YIHANWVD YRQ NA++CTQGPL  T  DFW MI  Y VP IVM TR  E  R KCFQYWP    ++ + T I P  ++ Y          V +      G   PS+     G+   ++S                      Y  T L +K++++GQ   V H+ FHSWPD G+P+ +   L  +  ++  Y   I + LGY S  D  IPPPPIVVHCSAGIGRTGTFI  ++ +K L + GK N+  T+ +IRSQR  CVQ + QYL+    +ID+A   G ++
Sbjct:  725 YAAIGSIKTNDPC-------TAFRRPCNSSKNRYVDVTCLEHSRVLLRVYQQSTANTFNTGSNSAASGKVAARADKQVPIYIHANWVDSYRQRNAFICTQGPLQDTAGDFWFMIWTYNVPAIVMITRCYESQRCKCFQYWPAIEGQSLRFTTISPSASSGYPPGYSGWGGIVATGGPGNSGTMAPSKKKALHGLARRSASEVSNSNKFVFEVTHLSSQPGEDYTCTKLQIKDVKSGQSRIVEHYAFHSWPDHGVPSDSSALLELLSTVQNEYASTIKRDLGYTSSYDNSIPPPPIVVHCSAGIGRTGTFIALDVSTKQLVELGKVNVPLTVTRIRSQRSGCVQVSAQYLFVYRALIDFALARGLIS 1083          

HSP 2 Score: 180.259 bits (456), Expect = 2.211e-42
Identity = 82/172 (47.67%), Postives = 117/172 (68.02%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYIL 711
            A +FL A+KFN+  A+DL+  +EA    E +  +DPFE  +  EL S KFT L D +D +GA +     +LH P+K++H+  L+++IFQL A L   T  +NG+I IY+MT S YSNFD  LS K+ N+LK  YP RL ++I+ T PLWFRA F  LR+F+K++L+DRV++L
Sbjct:   49 AFRFLAARKFNVQEAVDLFHSYEAFLKSEGITLVDPFEESVRRELLSGKFTILND-NDPAGARVAQLFVRLHRPTKSTHKAFLQSVIFQLSAALRRETAARNGIILIYDMTNSKYSNFDADLSKKLFNMLKSCYPIRLRRIIVLTAPLWFRAPFQLLRVFIKEELRDRVHVL 219          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Match: A0A3Q0KSA3 (Protein-tyrosine phosphatase n9, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 8.799e-62
Identity = 145/375 (38.67%), Postives = 203/375 (54.13%), Query Frame = 1
Query: 1654 LHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKL-----IRDIN-FTNNLNEGDPPLL----------------KPT-------DYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTS------------LRSKEFGPN-------CPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCG----KFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            L+S Y+ L + +N+  Y  I    ++ H LN  KNRY D+ C +++RV L       DI+  + + ++ DP +L                 P        +YIHANWVDGYRQ NA++CTQGPL+ TV DFW MI  Y  PIIVM TR  E  R KC+ YWP+   + K+Y   ++    +  TS              +    P+       C S G   N +    R+T L +  +RT     V HF F SWPD G P +T+G L  +  ++ TY   I KLGY+S  DQK PPPP+VVHCSAGIGRTGT++  +IC+K L D      K N+  T+ ++RSQR+ CVQ + QY++C   IID+A + G +++
Sbjct:  809 LNSEYSALVQLKNE--YTHI----AFKHILNRSKNRYCDVICHDATRVYLQPLLLSSDISRISTSRSDEDPTVLCNAQKSLTARLHRTHSAPISAHTLVKNYIHANWVDGYRQKNAFICTQGPLSETVGDFWQMIWDYHCPIIVMITRILEAQRSKCYLYWPDVENQ-KLYFSSSHTGCLYAPTSSDRSNNSFSKFSSSNNNVTPDFLIENVKCESNG---NFAQTTLRITHLQLHEVRT-----VEHFAFFSWPDHGTPQTTEGLLDLLTSVQLTYLNEIEKLGYKSYEDQKTPPPPVVVHCSAGIGRTGTYVTVDICTKWLADSRNTEHKINIPLTVARVRSQRFGCVQVSSQYVFCYRAIIDFAVNSGLLDS 1168          

HSP 2 Score: 159.073 bits (401), Expect = 1.156e-35
Identity = 86/219 (39.27%), Postives = 127/219 (57.99%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYIL-----TKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGY 831
            ++A   L A+KF++  A++LY  ++   + E +  +DPFE ++  EL S KF  L D +D  G  +  F  +LH  S  +H+ +L ++IFQLDA L   T  +NGL+FI++MT S YSNFD   S K+  +L+ +YP RL +V+I T PLWFRA F  +R+F+++  QD VY+L     TK E L  H    IL          +H  WL+TA    G+
Sbjct:   36 QLAFNILAARKFSVPQAMELYHNYQTFLASEQITRVDPFEEDVRRELLSGKFVILND-NDIPGVRVAQFFVRLHRKS-GNHRALLHSIIFQLDAALRRETAARNGLVFIFDMTDSKYSNFDYTFSCKLFKMLRSSYPVRLRRVLILTAPLWFRAPFLLMRVFIRELFQDCVYVLRPSPGTKLEALS-HPDPVILK--------RDHYAWLQTALLRTGW 243          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Match: G4LXK9 (Protein-tyrosine phosphatase n9, putative OS=Schistosoma mansoni OX=6183 GN=Smp_167520 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 9.450e-62
Identity = 145/375 (38.67%), Postives = 203/375 (54.13%), Query Frame = 1
Query: 1654 LHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKL-----IRDIN-FTNNLNEGDPPLL----------------KPT-------DYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTS------------LRSKEFGPN-------CPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCG----KFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            L+S Y+ L + +N+  Y  I    ++ H LN  KNRY D+ C +++RV L       DI+  + + ++ DP +L                 P        +YIHANWVDGYRQ NA++CTQGPL+ TV DFW MI  Y  PIIVM TR  E  R KC+ YWP+   + K+Y   ++    +  TS              +    P+       C S G   N +    R+T L +  +RT     V HF F SWPD G P +T+G L  +  ++ TY   I KLGY+S  DQK PPPP+VVHCSAGIGRTGT++  +IC+K L D      K N+  T+ ++RSQR+ CVQ + QY++C   IID+A + G +++
Sbjct:  816 LNSEYSALVQLKNE--YTHI----AFKHILNRSKNRYCDVICHDATRVYLQPLLLSSDISRISTSRSDEDPTVLCNAQKSLTARLHRTHSAPISAHTLVKNYIHANWVDGYRQKNAFICTQGPLSETVGDFWQMIWDYHCPIIVMITRILEAQRSKCYLYWPDVENQ-KLYFSSSHTGCLYAPTSSDRSNNSFSKFSSSNNNVTPDFLIENVKCESNG---NFAQTTLRITHLQLHEVRT-----VEHFAFFSWPDHGTPQTTEGLLDLLTSVQLTYLNEIEKLGYKSYEDQKTPPPPVVVHCSAGIGRTGTYVTVDICTKWLADSRNTEHKINIPLTVARVRSQRFGCVQVSSQYVFCYRAIIDFAVNSGLLDS 1175          

HSP 2 Score: 159.073 bits (401), Expect = 1.013e-35
Identity = 86/219 (39.27%), Postives = 127/219 (57.99%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYIL-----TKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGY 831
            ++A   L A+KF++  A++LY  ++   + E +  +DPFE ++  EL S KF  L D +D  G  +  F  +LH  S  +H+ +L ++IFQLDA L   T  +NGL+FI++MT S YSNFD   S K+  +L+ +YP RL +V+I T PLWFRA F  +R+F+++  QD VY+L     TK E L  H    IL          +H  WL+TA    G+
Sbjct:   34 QLAFNILAARKFSVPQAMELYHNYQTFLASEQITRVDPFEEDVRRELLSGKFVILND-NDIPGVRVAQFFVRLHRKS-GNHRALLHSIIFQLDAALRRETAARNGLVFIFDMTDSKYSNFDYTFSCKLFKMLRSSYPVRLRRVLILTAPLWFRAPFLLMRVFIRELFQDCVYVLRPSPGTKLEALS-HPDPVILK--------RDHYAWLQTALLRTGW 241          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Match: ptpn9b (protein tyrosine phosphatase non-receptor type 9b [Source:ZFIN;Acc:ZDB-GENE-090313-52])

HSP 1 Score: 196.052 bits (497), Expect = 5.292e-52
Identity = 99/209 (47.37%), Postives = 141/209 (67.46%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF++  A+DL+  ++  R KE +  I+P E  +  EL + KFT L   D K GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ++GLIFIY+MT S Y+NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+    LP   GG+  ++H+ W+++  NS
Sbjct:    3 AVKFLMARKFDVPRAIDLFQAYKNTRIKEGIYNINPNEEPLRTELLNGKFTVLPGRDAK-GAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIESIQTQRDGLIFIYDMTNSTYANFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVCTV-KAHELPNHIPVSSLPEHLGGSSQYSHIAWIQSCVNS 209          

HSP 2 Score: 179.104 bits (453), Expect = 2.574e-46
Identity = 112/317 (35.33%), Postives = 162/317 (51.10%), Query Frame = 1
Query: 1660 SFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVG 2610
              Y    E R +   G    F     P N  KNRYSD+ C++ SRV+L         L++ D    + +DYI+A+++DGY+  N Y+ TQGPL  T  DFW M+ +  V IIVM TR  E+ R KC QYWP       +  G    Y  F V ++  + F                 ++++ L + N +TG+   V+H+ + SWPD G+P S    L F  Q++Q   L +  L    +       PP+VVHCSAGIGRTGTF   +IC   L D G  ++ QT+ ++R+QR   +Q   QY +C   +I+YA+  G
Sbjct:  430 GIYQEYEEIRKEPPAG---TFDYSKKPANQIKNRYSDVLCLDESRVRLC-------PLDDEDD---ETSDYINASFMDGYKMTNTYIATQGPLPKTFGDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWP-------LEAGRTEEYGYFLVRNVHIEMF---------------QDFKLSHLELYNSQTGECREVSHYLYVSWPDFGVPKSASAMLDFRAQVKQRQELALRTL--YPDWTGPPGGPPVVVHCSAGIGRTGTFCTLDICLSRLEDIGTVDIKQTVRRMRTQRAFSIQTWDQYYFCYKAVIEYAQQTG 709          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:103036268])

HSP 1 Score: 191.43 bits (485), Expect = 9.058e-52
Identity = 105/293 (35.84%), Postives = 155/293 (52.90%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            N  +NRY D+ C++ +RV L    N             + +DYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ +  V +IVM TR  E  R KC QYWP       +  G   +Y    V + R              DN S   Y  T L + N  T ++ +V HF F SWPD G+P+S    L F+  +++  +  +  +G  S+       PP+VVHCSAGIGRTGTF   +IC   L + G  ++ QT+ ++R+QR   +Q   QY +C   I+++A+  G ++T
Sbjct:  265 NQERNRYGDVLCLDQTRVHLKGRRN-------------ERSDYINASFMDGYKQKNAYIGTQGPLEKTYGDFWRMVWEQSVLVIVMTTRTDEGGRRKCGQYWP-------LQEGGQEVYGHIAVVNQR-------------VDNHSH--YNQTTLELHNTETCEQRQVTHFQFLSWPDYGVPSSALSLLDFLGAVKRQQKRAVKAMG--SQWRGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQEVGTLHVCQTVRRMRTQRAFSIQTPEQYYFCHTAILEHAQRQGLLST 520          

HSP 2 Score: 150.599 bits (379), Expect = 6.194e-38
Identity = 82/173 (47.40%), Postives = 116/173 (67.05%), Query Frame = 1
Query:  256 KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            + +  R +E ++++ P E  +  EL S KFT L    D +GASI ++TAKLHHP+K  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV I   P+WFR  +N L + +K+KL++RV ++ K  +L  HL +D LP   GG
Sbjct:    9 EEQETRLREGIVKLQPQEEPLRSELLSGKFTIL-GVRDPTGASIALYTAKLHHPNKTGNHVVLQALFYLLDKAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVFIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMTDLRLHLPRDCLPEHLGG 179          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:103036268])

HSP 1 Score: 191.815 bits (486), Expect = 1.496e-51
Identity = 105/293 (35.84%), Postives = 155/293 (52.90%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            N  +NRY D+ C++ +RV L    N             + +DYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ +  V +IVM TR  E  R KC QYWP       +  G   +Y    V + R              DN S   Y  T L + N  T ++ +V HF F SWPD G+P+S    L F+  +++  +  +  +G  S+       PP+VVHCSAGIGRTGTF   +IC   L + G  ++ QT+ ++R+QR   +Q   QY +C   I+++A+  G ++T
Sbjct:  313 NQERNRYGDVLCLDQTRVHLKGRRN-------------ERSDYINASFMDGYKQKNAYIGTQGPLEKTYGDFWRMVWEQSVLVIVMTTRTDEGGRRKCGQYWP-------LQEGGQEVYGHIAVVNQR-------------VDNHSH--YNQTTLELHNTETCEQRQVTHFQFLSWPDYGVPSSALSLLDFLGAVKRQQKRAVKAMG--SQWRGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQEVGTLHVCQTVRRMRTQRAFSIQTPEQYYFCHTAILEHAQRQGLLST 568          

HSP 2 Score: 171.014 bits (432), Expect = 1.706e-44
Identity = 91/195 (46.67%), Postives = 133/195 (68.21%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            ++A+KFL A+KF++  A++L+  +   R +E ++++ P E  +  EL S KFT L    D +GASI ++TAKLHHP+K  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV I   P+WFR  +N L + +K+KL++RV ++ K  +L  HL +D LP   GG
Sbjct:   35 DVAVKFLMARKFDVLRAIELFHSYRETRLREGIVKLQPQEEPLRSELLSGKFTIL-GVRDPTGASIALYTAKLHHPNKTGNHVVLQALFYLLDKAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVFIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMTDLRLHLPRDCLPEHLGG 227          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:103036268])

HSP 1 Score: 184.496 bits (467), Expect = 3.607e-49
Identity = 103/293 (35.15%), Postives = 152/293 (51.88%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNT 2622
            N  +NRY D+ C++ +RV L                     DYI+A+++DGY+Q NAY+ TQGPL  T  DFW M+ +  V +IVM TR  E  R KC QYWP       +  G   +Y    V + R              DN  SH+ + TL     L   ++ +V HF F SWPD G+P+S    L F+  +++  +  +  +G  S+       PP+VVHCSAGIGRTGTF   +IC   L + G  ++ QT+ ++R+QR   +Q   QY +C   I+++A+  G ++T
Sbjct:  315 NQERNRYGDVLCLDQTRVHL--------------------KDYINASFMDGYKQKNAYIGTQGPLEKTYGDFWRMVWEQSVLVIVMTTRTDEGGRRKCGQYWP-------LQEGGQEVYGHIAVVNQR-------------VDN-HSHYNQTTL----ELHNTEQRQVTHFQFLSWPDYGVPSSALSLLDFLGAVKRQQKRAVKAMG--SQWRGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQEVGTLHVCQTVRRMRTQRAFSIQTPEQYYFCHTAILEHAQRQGLLST 560          

HSP 2 Score: 170.244 bits (430), Expect = 2.431e-44
Identity = 91/195 (46.67%), Postives = 133/195 (68.21%), Query Frame = 1
Query:  190 EIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            ++A+KFL A+KF++  A++L+  +   R +E ++++ P E  +  EL S KFT L    D +GASI ++TAKLHHP+K  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV I   P+WFR  +N L + +K+KL++RV ++ K  +L  HL +D LP   GG
Sbjct:   37 DVAVKFLMARKFDVLRAIELFHSYRETRLREGIVKLQPQEEPLRSELLSGKFTIL-GVRDPTGASIALYTAKLHHPNKTGNHVVLQALFYLLDKAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVFIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMTDLRLHLPRDCLPEHLGG 229          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Match: ENSAMXT00000022449.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:17434140:17476836:-1 gene:ENSAMXG00000021796.2 transcript:ENSAMXT00000022449.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 8.887e-40
Identity = 101/295 (34.24%), Postives = 146/295 (49.49%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            +F S + P N  KNR  +I   E++RV L  IR +       EG       +DY++A+++DGYRQ  AY+ TQGPL  T  D+W M+ ++   I+VM T+ +E  R+KC QYWP            +  Y  F V  +   E+  N P            Y +    V + R GQ   V  F F  WP+QG+P S +GF+ FI Q+ +T      + G +          PI VHCSAG+GRTG FI   I  + +   G  ++ QT+  +R+QR   VQ   QY +C    ++Y
Sbjct: 1260 RFVSANLPCNKFKNRLVNIMPYETTRVSLQPIRGV-------EG-------SDYVNASFIDGYRQQRAYIATQGPLAETAEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWPSER---------SARYQYFVVDPM--AEY--NMPQ-----------YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKE----QFGQDG---------PITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEEQYQFCYRAALEY 1503          

HSP 2 Score: 147.132 bits (370), Expect = 2.351e-35
Identity = 91/284 (32.04%), Postives = 138/284 (48.59%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY+++   + +RV L        + N+G P     +DYI+AN++DGYR+  AY+ TQGP+  T+SDFW M+ +     I+M T+ +E++R+KC QYWP    ET         Y   QV+ L + E    C               V    +      +   V  F F +WPD G+P     FL F   +R+    N    G            PIVVHCSAG+GRTG FIV +   + +      +++  +  +RSQR   VQ   QY++  + +++
Sbjct:  979 INKPKNRYANVIAYDHTRVVL--------SNNDGQPG----SDYINANFIDGYRRQGAYIATQGPMPETISDFWRMVWEQHTANIIMITKLEEKSRNKCDQYWPSRGTET---------YGLMQVSVLDTVELATYC---------------VRTFALFKSGCSERREVRQFQFTAWPDHGVPEHPTPFLAF---LRRVKACNPPDAG------------PIVVHCSAGVGRTGCFIVIDGMLERVKQEKTIDVYGHVTLMRSQRNYMVQTEEQYVFIYDALME 1211          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Match: ptpn9b (protein tyrosine phosphatase non-receptor type 9b [Source:ZFIN;Acc:ZDB-GENE-090313-52])

HSP 1 Score: 174.096 bits (440), Expect = 3.132e-46
Identity = 91/210 (43.33%), Postives = 134/210 (63.81%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLD-AILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNS 822
            A+KFL A+KF+   A++L+  +   R +E +  + P E  +  EL S KFT L    D  GA++ +FTA+LH P++A+H  VL+A+++QLD A+        NGL+F+Y+MT S Y NFD  L VK+LNLLKGA+PARL +V+I + P+WFRA F  LR+FV++KL+DRV  + +  EL   +    LP   GG+   +H  WL+   +S
Sbjct:   37 AVKFLAARKFHTQRAIELFHAYRLTRIREGIYGLRPDEEPLRSELSSGKFTIL-SGRDPGGAALALFTARLHEPARAAHTVVLQAVLYQLDRAVERRYQYAHNGLVFVYDMTDSTYRNFDYELCVKMLNLLKGAFPARLKRVLIVSSPIWFRAPFTVLRLFVREKLRDRVCTV-RLSELQAFVPCASLPSQLGGSLPLDHTGWLQACASS 244          

HSP 2 Score: 135.961 bits (341), Expect = 1.545e-33
Identity = 78/210 (37.14%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 1738 PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP-ETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLG 2364
            P N  KNRY+D+ C++ SRVKL            G     +  DYI+A+++DGY+Q NAY+ TQGP+  T  DFW M+ + RV +IVM TR  E+ R KC QYWP + T      P        F VTSL  ++F                 Y +T L V N++TG+   V H+ + SWPD G+P S  G L F+  + +        LG
Sbjct:  400 PYNFGKNRYTDVLCLDQSRVKL------------GSSGNDEKMDYINASFMDGYKQHNAYIATQGPIPQTFVDFWRMVWEQRVQVIVMTTRVVERGRVKCGQYWPLDATSSCTFGP--------FTVTSLHLEKFQD---------------YNLTTLEVHNMQTGETREVAHYQYMSWPDFGVPRSALGMLDFLAHVSRHQAAATQALG 574          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006037.1 (pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:ENSPMAG00000005380.1 transcript:ENSPMAT00000006037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 1.359e-34
Identity = 93/301 (30.90%), Postives = 139/301 (46.18%), Query Frame = 1
Query: 1714 PQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVD---GYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP----PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            P +++   P N  +NR+ D+   E +RV+L+             P    PT YI+A+ V    G  Q + Y+ TQGPL  T  DFW MI +  V +I M T  +E  R KC +YWP+   +       +  Y  ++VT+    + G                Y  T L VK+L +GQE    H ++  WPD G P     FL F+ +++   R            +  +PP    PP+VVHCSAG+GR+G  I+TEI    L    + ++ Q +  +R QR   VQ   QY +    +I +
Sbjct:  885 PVYSTAELPDNQERNRFGDVLPYEQTRVELL-------------PSKDNPTGYINASHVRVRVGGEQWH-YIATQGPLPNTCQDFWQMIWEQGVSVIAMVTPEQESGRQKCHRYWPKLGSKRN-----SANYGDYRVTTKFRTDSGS---------------YATTGLKVKHLPSGQERTAWHLHYPDWPDHGCPEDVQRFLAFLEEVQSVRR----------HTNSMLPPHTASPPVVVHCSAGVGRSGVLILTEITIAGLEHNVQLDVPQALGVLRGQRMLMVQTLAQYQFVYQALIQF 1141          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 135.576 bits (340), Expect = 6.691e-33
Identity = 88/286 (30.77%), Postives = 133/286 (46.50%), Query Frame = 1
Query: 1738 PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            P N+ KNR   I   + +RV +         +  G+    + TDYI+ +++DGYRQ +A++  QGPL  TV DFW M+ ++R   IVM T  +E+ ++KC +YWP  T+ T  Y  I        +  L+ +               S   Y V    V N R  +  ++  F+FH WP+ GIP    G +  I  +++                Q     PI VHCSAG GRTGTF       + +   G  ++ QT+  +R+QR   VQ   QY +C   + +Y
Sbjct:  504 PANMKKNRVLQIIPYDFNRVII--------PMKRGE----EFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWP--TEGTITYGDI--------IIELKQEN--------------SHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQK--------------QQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEY 739          

HSP 2 Score: 115.161 bits (287), Expect = 1.528e-26
Identity = 86/289 (29.76%), Postives = 135/289 (46.71%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQG--PLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHR-VNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP--PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            N  KNRY +I   ++ RV L           EG P     +DYI+A++V+GY++ N ++  QG  P   T++D+W MI +     IVM T  KE+   KC QYWP+    T         Y + +V+             E V         +  +  V ++   +  R +  F+F SWPD G+P +  G L F+ +++                    PP   PIVVHCSAG+GRTGTFIV +     +    K ++   + +IR+QR + VQ   QY++    ++++
Sbjct:  211 NKEKNRYVNILPYDNFRVHLTS--------LEGVPD----SDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWT---------YGNLRVSV------------EDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCN-----------------PPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEF 449          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 136.346 bits (342), Expect = 8.681e-33
Identity = 92/288 (31.94%), Postives = 135/288 (46.88%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQE--HRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPP---PIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            N  KNRY +I   + SRV L       N L+E      + +DYI+AN+VDGY + + Y+ TQGPL  TV  FW MI Q R   I+M T   E  R KC +YWP+ +          ++Y   +VT               + D      Y +    V+  R GQE    V  F+F  WPD G+P    G L FI +I+                   + PP   P+VVHCSAG GRTG ++V +I        G  +++  + ++R++R   VQ   QY++  + +++
Sbjct:  941 NRAKNRYGNIIAYDHSRVML-------NVLDEE-----QNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGS----------DVYGDIKVT---------------LADTEMLSEYIIRTFRVE--RAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIK------------------ALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLE 1171          

HSP 2 Score: 58.9214 bits (141), Expect = 5.541e-9
Identity = 41/107 (38.32%), Postives = 56/107 (52.34%), Query Frame = 1
Query: 1738 PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDK-CFQYWPE 2055
            P N  KNRY D+       +   R + F   +N GD      ++YI+A  +D YRQ +A++ TQ PL  TV DFW ++  Y    IVM     E + +K C QYWPE
Sbjct: 1229 PRNHEKNRYHDV-------LPPDRCLPFLITIN-GDS-----SNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVML---NELDSNKYCPQYWPE 1319          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 132.494 bits (332), Expect = 5.136e-32
Identity = 101/320 (31.56%), Postives = 146/320 (45.62%), Query Frame = 1
Query: 1645 ESELHSFYATLGEFRNDSIYGDIPQFTSYS-HPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHR-VNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHC--SAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            E  LHSF     E +  +   D+     +S HP N  KNRY +I   + SRV+L R +   ++         K +DYI+AN+VDGY +  AY+  QGPL  T +DFW M+ +    IIVM T   E+ R KC QYWP  + E          Y +  VT   ++             N      R       + R  Q  R V  F++  WPD G P+     L F   +R++       +G            P+VVHC  SAG+GRTGT+IV +   + + D G  N+   +  IR+QR   VQ   QY +   ++++
Sbjct:   85 EGALHSFSQEFEEVQRCT--ADLGITAEHSNHPENKHKNRYVNIVAYDHSRVRL-RPLPGKDS---------KHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEE---------YGNILVTLKSTRTLACYTVRHFTIRNTK---LRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTF---VRKSSATRTDLMG------------PVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLE 365          

HSP 2 Score: 60.8474 bits (146), Expect = 1.281e-9
Identity = 41/112 (36.61%), Postives = 58/112 (51.79%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP 2052
            +F S +   N  KNR S I  +E SRV L       ++L+      L+ TDYI+A+++ GY + N ++ TQ PL  T  DFW MI  +   IIVM    +    D+   YWP
Sbjct:  423 EFFSATKHCNKEKNRNSSIVPVERSRVGL-------SSLSG-----LEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDESV-YWP 521          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 89.7373 bits (221), Expect = 8.983e-20
Identity = 91/319 (28.53%), Postives = 133/319 (41.69%), Query Frame = 1
Query: 1738 PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVD----------GYRQINAYVCTQGPLNTTVSDFWHMIIQYRVP----IIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPN----CPSEGVCDNASSH----WYRVTLLHVK--NLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTE------ICSKSLTDCGKFN-----------LHQTMLKIRSQRYKCVQNAYQYLY 2571
            P N  +NRY +I   E +RV L                 L   DYI+A++V           GY     Y+ TQGP   T   FW M   +  P    +IVM T   E NR+KC+QYWP          G++   D+ ++ S      G N     PS+   +  + H    +Y VT + +   +   G    V+HFYF  W D   P      +        ++ LN                 PI+VHCSAG+GRTGTFI  +      +  K++T+  + +           + Q +L++RSQR K VQ   Q+L+
Sbjct:   50 PRNDARNRYVNIMPYERNRVHL---------------KTLSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRG--------GVD---DTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAH---SHSLNSRG-------------NPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLF 320          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 69.3218 bits (168), Expect = 1.957e-12
Identity = 93/333 (27.93%), Postives = 137/333 (41.14%), Query Frame = 1
Query: 1753 KNRYSDIPCIESSRVKL--------IRDINFTNNLNEGDPPLL---------KPTDYIHANWVDGYRQIN---AYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPE------TTKETKIYPGINNL----YDSFQV--TSLRSKEFGPNC--PSEGVCDN---ASSHWYRVTLLHVKNLRTGQEHRVNHFY-FHSWPDQGIPNSTDGFLHFIIQIRQTYRLN--IAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTE----ICSKSLTDCGK---FNLHQTML-----KIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            KNRYS+I   E SRVKL        + + + T    +   P+          KP DYI+AN++    QIN    Y+ TQ PL +T+ DFW +I   +V +I+      E N  K   YW        T K    +  I N+       FQV  T+ ++     +C  P  G   +   A S  + V  L  KN        +N     H   +  + N       FI  + +       I     E  +D     P +V HCSAG GRTG F+  +    I S +     K   +N+ Q ++     ++R QR   VQN  QY+ C   +++Y
Sbjct:  411 KNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYL-KLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQS----FITSLEKDVCKPDLIDDNNSELHLDTANSSPLLV-HCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNY 737          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 60.8474 bits (146), Expect = 8.772e-10
Identity = 90/364 (24.73%), Postives = 140/364 (38.46%), Query Frame = 1
Query: 1753 KNRYSDIPCIESSRVKLIRDINFTNNL----NEGDPPLLKPTDYIHANWVDGYR---QINA-------------YVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGIN------NLYDSFQVTSLRSKEFG---PNCPSEGVCDNASSH--------------------------------WYRVTLLHVKNLRT--GQE--HRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQ------------------TMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            KNRY DI   E SRV L + +  +  +    +  D  +L   +YI+AN++   R   + N+             Y+ TQ P+ +TV DF+  I+   VP+++  T   E   +KC++YW E       Y GI+       +      TS+R    G    +  S GV  N+S++                                     +L  K L T   QE  + +      +WPD G   +    L  I           A+  Y++  DQ    P I+VHCSAG GRTGT    +     L++   F + Q                  T+   R QR   VQN  Q+++  + ++ Y
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILD--NYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGN-----YNGIHVKLLEKKILKMPSTTSMRKNTMGTQNSSLYSAGVQGNSSNYSTDNDNDNDNNNNNNNNSNIAVTAAACDDDDDDDDDAILIRKILLTYHDQEKPYELLQIQVKNWPDLGTLLNPISILQAINVKNHIIDTLFARNYYQN--DQL---PTILVHCSAGCGRTGTLCTIDSI---LSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLLFY 878          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Match: CSR1 (Phosphatidylinositol transfer protein; has a potential role in regulating lipid and fatty acid metabolism under heme-depleted conditions; interacts specifically with thioredoxin peroxidase; may have a role in oxidative stress resistance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004372])

HSP 1 Score: 51.9878 bits (123), Expect = 2.526e-7
Identity = 47/202 (23.27%), Postives = 89/202 (44.06%), Query Frame = 1
Query:  199 IKFLRAKKFNIDSAL-----DLYLKHEAIRSKENLIEIDPFENE---ILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLK-ALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKN-EELYFHLSKDILPLTFGG 774
            +KF+RA+K+N D  +     DLY + + I    N  E   +EN    ++  L  +K T  +   D     + +   +LHH S  + Q + K +L+    + L            ++++ G   SN D A    ++   +  YP  L  ++I   P  F   +N ++ ++   +  ++ + TKN +EL+  +    +P   GG
Sbjct:  113 LKFIRARKWNADKTIAMLGHDLYWRKDTINKIINGGERAVYENNETGVIKNLELQKAT--IQGYDNDMRPVILVRPRLHHSSDQTEQELEKFSLLVIEQSKLFFKENYPASTTILFDLNGFSMSNMDYAPVKFLITCFEAHYPESLGHLLIHKAPWIFNPIWNIIKNWLDPVVASKI-VFTKNIDELHKFIQPQYIPRYLGG 311          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Match: SEC14 (Phosphatidylinositol/phosphatidylcholine transfer protein; involved in regulating PtdIns, PtdCho, and ceramide metabolism, products of which regulate intracellular transport and UPR; has a role in localization of lipid raft proteins; functionally homologous to mammalian PITPs; SEC14 has a paralog, YKL091C, that arose from the whole genome duplication [Source:SGD;Acc:S000004684])

HSP 1 Score: 48.521 bits (114), Expect = 2.628e-6
Identity = 47/214 (21.96%), Postives = 98/214 (45.79%), Query Frame = 1
Query:  184 DEEIAIKFLRAKKFNIDSALDLYLKHEAIR---SKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSK-ASHQHVLKALIFQLDAIL--LLPTTQKNG------LIFIYNMTG-SLYSNFDMALSVKILNLL-KGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYIL--TKNEELYFHLSKDILPLTFGGN 777
            D+   ++FLRA+KF++  A +++   E  R     + +++   ++ + L   F  ++    D D +      +    LH  +K  S + +LK L+++ ++++   LP   +           I ++ G S+ S + +   V+  + + +  YP R+ K  I   P  F  AF   + F+      +++IL  +  +EL   +  + LP+ FGG 
Sbjct:   54 DDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGK 267          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Match: EDO45692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS70])

HSP 1 Score: 176.407 bits (446), Expect = 2.156e-46
Identity = 110/314 (35.03%), Postives = 158/314 (50.32%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRV-TLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN 2619
            E RN  + G    F       NL KNRY+D+ C+E +RV L       + ++E D      +DYIHAN+ DGYRQ  A++ TQGPL  T SDFW M+ +    +IVM TR  E+ R KC +YWPE         G  + +   +V  + ++E+               H  R+ T+ HV+   TGQ   + HF   SWPD G+P+S +  LH +  +RQ     +  +G           PPIVVHCSAGIGRTGTF   +I    L   G   +  T+  +R+QR   +Q   QY +C   ++++A  +  +N
Sbjct:  333 ELRNMPVEG---TFLRTKLRANLRKNRYTDVLCVEETRVPL-------SPVDEDDC-----SDYIHANFTDGYRQHKAFIATQGPLPNTTSDFWRMVWEQGAMVIVMITRCMERGRVKCRRYWPED--------GDCDDHVDLRVQHVETQEY-------------EDHVERIFTIDHVQ---TGQSRTIIHFQMTSWPDFGVPSSAESCLHILGLVRQAQASAVLAMG--PSWKGHPSGPPIVVHCSAGIGRTGTFCTLDINVSRLQHEGVCEIVNTVKYLRTQRAHMIQTPEQYEFCHLAVLEFALSLPSIN 605          

HSP 2 Score: 140.584 bits (353), Expect = 1.248e-34
Identity = 80/207 (38.65%), Postives = 118/207 (57.00%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGA----SICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWL 804
            A+KFL A+KF+ID AL LY  +        + ++ P+E+ +  EL S KFT L        A    ++   + K+  PS      VL  ++FQL+  +  P TQ++GL+ +Y+M+ S Y NFD  LS KIL LLKG YPARL  V I +PPLWF+A    L  F+++K+++R+ IL+  E+L   L    +P + GG    +H  WL
Sbjct:   46 AVKFLTARKFDIDRALLLYKSYLEKCRVYCINDMSPYEDPLRQELLSGKFTILGRKRTTGDAINPLAVTTPSDKVSRPSN----KVLTGMVFQLEQAIKSPLTQRSGLVLLYDMSNSSYKNFDFDLSQKILELLKGGYPARLKSVFIISPPLWFKAVLLILSSFLREKIRERIEILSI-EQLQDRLPIGTIPKSLGGKLNVDHFSWL 247          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Match: EDO33995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN6])

HSP 1 Score: 149.058 bits (375), Expect = 9.146e-38
Identity = 92/285 (32.28%), Postives = 138/285 (48.42%), Query Frame = 1
Query: 1741 LNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHR-VNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +N PKNRY +I   + SRV L        +  +GD    + TDYI+ANW+DG++Q   Y+ T GP   T SDFW M+ +++  I+VM T+  E+ + KC +YWPE           N  Y    VT    +E                  + +    ++ L    E R V HFYF SWPD  +P    G L F  ++R ++       G +S         PI VHCSAG+GRTGTFIV +   + + +    +++  + +IR+QR   VQ   QY +    +++
Sbjct:   51 INKPKNRYGNIKAYDHSRVIL--------SSVQGDS---ESTDYINANWIDGFKQEKKYIATIGPKAETTSDFWRMMWEHKSSIVVMLTKLVEKGKVKCHKYWPEE----------NEQYGEIIVTLEEKEELAD---------------FEIRKFFLRKLSNQMETRMVKHFYFTSWPDHDVPEYATGLLEFWKRVRNSWE------GPQS--------GPITVHCSAGVGRTGTFIVIDAMMEQIKEENLLDVYSYVSRIRAQRNFMVQRPSQYSFIHYALLE 285          

HSP 2 Score: 58.9214 bits (141), Expect = 6.131e-9
Identity = 32/125 (25.60%), Postives = 56/125 (44.80%), Query Frame = 1
Query: 2221 LRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            L TG+  +++HF +  W +  +P      +  I  +++  R ++ +              P+VVHCS G+GRTG F       + +   G  ++  T   +R+QR   V +  QY  C   I+ Y
Sbjct:  425 LETGEVRQISHFMYLEWTEHAVPTKLLTIIDLIGDLQKARRKHLDR--------------PVVVHCSDGVGRTGAFCTLFATLERVKLEGVLDVFITARMLRTQRPGMVSHLDQYRLCYEAILAY 535          

HSP 3 Score: 58.9214 bits (141), Expect = 6.625e-9
Identity = 34/107 (31.78%), Postives = 55/107 (51.40%), Query Frame = 1
Query: 1681 EFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVM 2001
            +  N ++  ++  F + + P N  KNRY +I   E  RV L               P  + T YI+A++++GY++  A++ TQ PL+ T+ DFW M+    V  IVM
Sbjct:  323 QLLNGAVPDELSDFYTATQPKNSKKNRYPNILPCERCRVVL------------PAIPDKEDTTYINASYLEGYQEKVAFIATQAPLDNTIEDFWRMVWHEEVFCIVM 417          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 148.673 bits (374), Expect = 2.801e-36
Identity = 91/298 (30.54%), Postives = 147/298 (49.33%), Query Frame = 1
Query: 1717 QFTSYSHPLNLPKNRYSDIPCIESSRVKL--IRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLH---VKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            ++ + +  +N PKNR ++I   E++RV +  +R +       EG       +DYI+A+++DGYRQ   ++ TQGPL  TV DFW M+++    IIVM T+  E   +KC++YWP                      S R + +        + D  + H Y   ++    VK+ R+     +  F+F  WP+ G+P S +G +  I Q+++ Y             +Q+    PI VHCS G+GRTG F    I  + +   G  +L QT+  +R+QR   VQ+  QYL+C  T ++Y
Sbjct: 1622 KYGAATLAINRPKNRLANILPYETTRVHISPVRGV-------EG-------SDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDR-------------------SARHQYY--------IVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAY-------------EQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEY 1865          

HSP 2 Score: 147.902 bits (372), Expect = 4.814e-36
Identity = 100/294 (34.01%), Postives = 144/294 (48.98%), Query Frame = 1
Query: 1720 FTSYSHPL--NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGIN-NLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            FT+ S  +  N  KNRY +I   + SRV+L    ++ N + EG       +DYI+AN+ DGYR+  AY+ TQGP+  T +DFW M+ + R   IVM TR +E+ R KC QYWP  T  T +Y GI  +L D  ++ +                       Y ++ L +      Q   V HF F  WPD G+P     FL F   +R+    N    G            PIVVHCSAG+GRTG FIV +   + L      +++  +  +R+QR   VQ   QY++  + I++
Sbjct: 1333 FTADSSQMECNKGKNRYPNIHAYDHSRVRL----SYINGI-EG-------SDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWP--TDGTDVYEGIEVSLVDWVELAN-----------------------YTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAF---LRRVKFYNPPDAG------------PIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILE 1574          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 143.28 bits (360), Expect = 1.104e-35
Identity = 97/297 (32.66%), Postives = 141/297 (47.47%), Query Frame = 1
Query: 1711 IPQFTSYSH---PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIID 2592
            +P+  + +H   P+N  KNRY +I   + SRVKL +D        E +P     +DYI+AN++ GYR+ NAY+  QGPL  T  DFW M+ +     I+M T  KE+ RDKC QYWP     +         Y+   VT     E  P               Y V  L V+        +V  F+F SWPD G+P S    L F   +R + R +    G            P+VVHCSAG+GRTGTFIV ++  + + +    ++   +  +R  R   VQ   QY++  + ++D
Sbjct:   30 VPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKL-QDF-------EDEPG----SDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLS---------YEDITVTLDSVTELTP---------------YIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAF---VRDSTRADPPGAG------------PMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLD 275          

HSP 2 Score: 109.383 bits (272), Expect = 1.029e-24
Identity = 75/292 (25.68%), Postives = 123/292 (42.12%), Query Frame = 1
Query: 1720 FTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
              + +HP+N  KNRY+++   + +RV+L   +             ++ +DYI+AN++DGY     ++ TQ P+  T+ DFW M+ +     IV   +  EQ + K  +YWP     T       +L    Q                   D   S    V +  + N        V  F++ SW ++            I  I Q          +++E  +     PI+VHCSAG+GRTG F    I  + L      ++ QT+ ++R QR   VQ   QY +C   +++Y
Sbjct:  325 LNAATHPVNKRKNRYANVLPYDVTRVRLSMQVG------------VEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPIT-----FGSLVVEMQ-------------------DKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQY-------WQAESGRH----PIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEY 569          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Match: EDO31805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW8])

HSP 1 Score: 139.813 bits (351), Expect = 1.611e-34
Identity = 91/289 (31.49%), Postives = 137/289 (47.40%), Query Frame = 1
Query: 1738 PLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLY---DSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDY 2595
            P N  KNR++++   + SRV L        +L E D    + + YI+AN+VD Y  +NAY+ TQGPL  T+SDFW MI +    +IVM T   E+ R KC  YWP   ++T+ +  +   +   ++F   S+R+ E  PN           +H+              Q   V  F+F  WPD G P                +   +  L  +S         P+VVHCSAG+GR+G FIV +   K + D G  ++   +  IR+QR   VQ   QY++  +T+ +Y
Sbjct:   47 PENQMKNRFANVVAYDHSRVVL--------SLTEND----QSSHYINANYVDTYNAMNAYIATQGPLAKTISDFWRMIWEQNCRVIVMITNIIEKGRHKCAMYWPTKNRKTENHGPLTITFVQEETFAYYSIRTFEIKPN--------KDGTHY-------------TQPMMVKQFHFTGWPDHGAPEP-------------GFEFPVLDLIMKSTACVVPGTGPLVVHCSAGVGRSGAFIVIDSMIKRIHDNGDLDIFNFLAHIRNQRNHLVQEECQYIFIHDTLAEY 289          

HSP 2 Score: 77.411 bits (189), Expect = 1.248e-14
Identity = 61/233 (26.18%), Postives = 101/233 (43.35%), Query Frame = 1
Query: 1849 PLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMD----QKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQR 2535
            P  + +DYI+A+++DG+ +  A++ TQ PL +T  D+W MI Q     IVM    KE ++D    Y P               +  ++VT       G     +            + L+  K+    ++  + HF+F  WP+ G P S    L  + ++ +          +ESE++    Q     PIVVHC+ GIGRTG +       + +T     +++QT      QR
Sbjct:  372 PGEEGSDYINASYIDGFTRREAFIATQHPLQSTTMDYWRMIWQENCRSIVMLLSEKEWDKDVFPSYLPAVHDTAH--------FGDYEVTMESETARGDFIIRD------------LKLISTKDPSVIRQ--IRHFHFLHWPEHGQPWSGQTVLQLVSKVEE----------WESEVEKNSHQFDIIGPIVVHCNNGIGRTGVYCALHALWQQITQEKLVSVYQTAWLQGHQR 572          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Match: ptpn9b (tyrosine-protein phosphatase non-receptor type 9 [Source:NCBI gene;Acc:101164280])

HSP 1 Score: 199.904 bits (507), Expect = 2.481e-53
Identity = 101/208 (48.56%), Postives = 139/208 (66.83%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFN 819
            A+KFL A+KF++  A+DL+  ++  R KE +I I+P E  +  EL S KFT L   D K GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ++GLIFIY+MT S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+    LP   GG   ++HV W+++  N
Sbjct:   37 ALKFLMARKFDVPRAIDLFQAYKNTRIKEGIININPDEEPLRSELLSGKFTVLPGRDAK-GAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIESVQTQRDGLIFIYDMTNSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVCTV-KAHELISHIPVSSLPEHLGGTSQYSHVAWIQSCVN 242          

HSP 2 Score: 190.274 bits (482), Expect = 5.036e-50
Identity = 117/336 (34.82%), Postives = 167/336 (49.70%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPL-NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP--ETTKETKIYPGINN----LYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP--PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVG 2610
            +D+    +    Y      R +   G       YS  L N  KNRYSD+ C++ SRV L +     ++ +E        +DYI+A+++DGY+  NAY+ TQGPL  T  DFW M+ +  V IIVM TR  E+ R KC QYWP  E   E   Y  I N    L+  FQ+T L                             + N ++G++  V+H+ + SWPD G+P S    L F   + +  +  +  LG       + PP  PP+VVHCSAGIGRTGTF   +IC   L D G  ++HQT+ ++R+QR   +Q   QY +C   +I+YA+  G
Sbjct:  424 VDYVKRKKKRGIYQEYENIRKEPPAGSF----DYSKKLSNQIKNRYSDVLCLDQSRVHLCQ---LCDDEDE-------TSDYINASFMDGYKSRNAYIATQGPLPKTFGDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWPLEEGKAEQHGYFLIRNTHIQLFQDFQLTHL----------------------------ELYNTQSGEKREVSHYLYVSWPDFGVPKSASAMLDFREHVLERRKAAVQNLG----SSWRGPPWGPPVVVHCSAGIGRTGTFCTLDICLSQLEDVGTVDVHQTVRRMRTQRAFSIQTWDQYYFCYTAVIEYAQRHG 713          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Match: ptpn9b (tyrosine-protein phosphatase non-receptor type 9 [Source:NCBI gene;Acc:101164280])

HSP 1 Score: 199.134 bits (505), Expect = 3.649e-53
Identity = 101/208 (48.56%), Postives = 139/208 (66.83%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFN 819
            A+KFL A+KF++  A+DL+  ++  R KE +I I+P E  +  EL S KFT L   D K GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ++GLIFIY+MT S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+    LP   GG   ++HV W+++  N
Sbjct:   30 ALKFLMARKFDVPRAIDLFQAYKNTRIKEGIININPDEEPLRSELLSGKFTVLPGRDAK-GAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIESVQTQRDGLIFIYDMTNSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVCTV-KAHELISHIPVSSLPEHLGGTSQYSHVAWIQSCVN 235          

HSP 2 Score: 189.119 bits (479), Expect = 9.270e-50
Identity = 117/336 (34.82%), Postives = 167/336 (49.70%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPL-NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP--ETTKETKIYPGINN----LYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP--PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVG 2610
            +D+    +    Y      R +   G       YS  L N  KNRYSD+ C++ SRV L +     ++ +E        +DYI+A+++DGY+  NAY+ TQGPL  T  DFW M+ +  V IIVM TR  E+ R KC QYWP  E   E   Y  I N    L+  FQ+T L                             + N ++G++  V+H+ + SWPD G+P S    L F   + +  +  +  LG       + PP  PP+VVHCSAGIGRTGTF   +IC   L D G  ++HQT+ ++R+QR   +Q   QY +C   +I+YA+  G
Sbjct:  410 VDYVKRKKKRGIYQEYENIRKEPPAGSF----DYSKKLSNQIKNRYSDVLCLDQSRVHLCQ---LCDDEDE-------TSDYINASFMDGYKSRNAYIATQGPLPKTFGDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWPLEEGKAEQHGYFLIRNTHIQLFQDFQLTHL----------------------------ELYNTQSGEKREVSHYLYVSWPDFGVPKSASAMLDFREHVLERRKAAVQNLG----SSWRGPPWGPPVVVHCSAGIGRTGTFCTLDICLSQLEDVGTVDVHQTVRRMRTQRAFSIQTWDQYYFCYTAVIEYAQRHG 699          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Match: ptpn9b (tyrosine-protein phosphatase non-receptor type 9 [Source:NCBI gene;Acc:101164280])

HSP 1 Score: 199.904 bits (507), Expect = 3.688e-53
Identity = 101/208 (48.56%), Postives = 139/208 (66.83%), Query Frame = 1
Query:  196 AIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFN 819
            A+KFL A+KF++  A+DL+  ++  R KE +I I+P E  +  EL S KFT L   D K GA++ +FTA+LH P   +H+ VL+A+I+QLD  +    TQ++GLIFIY+MT S Y NFD  L VKILNLLKGA+PARL  V I + PLWFRA F  LR+FV++KL++RV  + K  EL  H+    LP   GG   ++HV W+++  N
Sbjct:   37 ALKFLMARKFDVPRAIDLFQAYKNTRIKEGIININPDEEPLRSELLSGKFTVLPGRDAK-GAALALFTARLHRPDVTTHKAVLQAIIYQLDKAIESVQTQRDGLIFIYDMTNSTYGNFDYELCVKILNLLKGAFPARLKCVFIVSSPLWFRAPFAVLRLFVREKLRERVCTV-KAHELISHIPVSSLPEHLGGTSQYSHVAWIQSCVN 242          

HSP 2 Score: 189.889 bits (481), Expect = 8.968e-50
Identity = 117/336 (34.82%), Postives = 167/336 (49.70%), Query Frame = 1
Query: 1630 IDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPL-NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWP--ETTKETKIYPGINN----LYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPP--PPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVG 2610
            +D+    +    Y      R +   G       YS  L N  KNRYSD+ C++ SRV L +     ++ +E        +DYI+A+++DGY+  NAY+ TQGPL  T  DFW M+ +  V IIVM TR  E+ R KC QYWP  E   E   Y  I N    L+  FQ+T L                             + N ++G++  V+H+ + SWPD G+P S    L F   + +  +  +  LG       + PP  PP+VVHCSAGIGRTGTF   +IC   L D G  ++HQT+ ++R+QR   +Q   QY +C   +I+YA+  G
Sbjct:  456 VDYVKRKKKRGIYQEYENIRKEPPAGSF----DYSKKLSNQIKNRYSDVLCLDQSRVHLCQ---LCDDEDE-------TSDYINASFMDGYKSRNAYIATQGPLPKTFGDFWRMVWEQMVLIIVMTTRVVERGRVKCGQYWPLEEGKAEQHGYFLIRNTHIQLFQDFQLTHL----------------------------ELYNTQSGEKREVSHYLYVSWPDFGVPKSASAMLDFREHVLERRKAAVQNLG----SSWRGPPWGPPVVVHCSAGIGRTGTFCTLDICLSQLEDVGTVDVHQTVRRMRTQRAFSIQTWDQYYFCYTAVIEYAQRHG 745          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:101171408])

HSP 1 Score: 187.963 bits (476), Expect = 1.836e-50
Identity = 104/289 (35.99%), Postives = 156/289 (53.98%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVG 2610
            N  KNRY D+ C++ +RV+L              P   + +DYI+A+++DGY+Q NAY+ TQGPL  T +DFW M+ +  V +IVM TR +E +R KC QYWP       +  G   +Y    V + R               +  +H Y  T L + N  T ++ +V+HF + SWPD G+P S    + F+  +++  R  +  +   S+       PP+VVHCSAGIGRTGTF   +IC   L D G  N+ QT+ ++R+QR   +Q   QY +C N I+++A+  G
Sbjct:  283 NQEKNRYGDVLCLDQTRVRL-------------KPRRTERSDYINASFMDGYKQKNAYIGTQGPLEKTYNDFWRMVWEQSVLVIVMTTRTEEGSRRKCGQYWP-------LDEGGQEVYGHIAVVNQRV--------------DHHTH-YNHTTLELHNTETCEQRQVSHFQYLSWPDYGVPTSAVTLIDFLGAVKRQQRKMVRAV--SSQWMGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQDVGTLNVCQTVRRMRTQRAFSIQTPDQYYFCYNAILEHAQRQG 534          

HSP 2 Score: 146.362 bits (368), Expect = 1.892e-36
Identity = 85/196 (43.37%), Postives = 121/196 (61.73%), Query Frame = 1
Query:  187 EEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +E+AIKFL A+KF++  A++L+  + ++R                               D SGASI ++TAKLHHP+K  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV+I   P+WFR  +N L + +K+KL++RV ++ K  EL  HL +D LP   GG
Sbjct:   34 KELAIKFLMARKFDVLRAIELFHSYRSVR-------------------------------DPSGASIALYTAKLHHPNKTGNHVVLQALFYLLDRAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVLIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMAELCQHLPRDCLPQHLGG 197          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Match: ptpn9a (protein tyrosine phosphatase non-receptor type 9 [Source:NCBI gene;Acc:101171408])

HSP 1 Score: 188.348 bits (477), Expect = 2.123e-50
Identity = 104/291 (35.74%), Postives = 157/291 (53.95%), Query Frame = 1
Query: 1744 NLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYV 2616
            N  KNRY D+ C++ +RV+L              P   + +DYI+A+++DGY+Q NAY+ TQGPL  T +DFW M+ +  V +IVM TR +E +R KC QYWP       +  G   +Y    V + R               +  +H Y  T L + N  T ++ +V+HF + SWPD G+P S    + F+  +++  R  +  +   S+       PP+VVHCSAGIGRTGTF   +IC   L D G  N+ QT+ ++R+QR   +Q   QY +C N I+++A+  G +
Sbjct:  313 NQEKNRYGDVLCLDQTRVRL-------------KPRRTERSDYINASFMDGYKQKNAYIGTQGPLEKTYNDFWRMVWEQSVLVIVMTTRTEEGSRRKCGQYWP-------LDEGGQEVYGHIAVVNQRV--------------DHHTH-YNHTTLELHNTETCEQRQVSHFQYLSWPDYGVPTSAVTLIDFLGAVKRQQRKMVRAV--SSQWMGHPLGPPMVVHCSAGIGRTGTFCALDICLSQLQDVGTLNVCQTVRRMRTQRAFSIQTPDQYYFCYNAILEHAQRQGLL 566          

HSP 2 Score: 175.637 bits (444), Expect = 4.043e-46
Identity = 96/196 (48.98%), Postives = 134/196 (68.37%), Query Frame = 1
Query:  187 EEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGG 774
            +E+AIKFL A+KF++  A++L+  +   R KE ++ + P E  +  EL S KFT L    D SGASI ++TAKLHHP+K  +  VL+AL + LD  +    TQ+NGL+FIY+M GS Y+NF++ LS KILNLLKGA+PARL KV+I   P+WFR  +N L + +K+KL++RV ++ K  EL  HL +D LP   GG
Sbjct:   34 KELAIKFLMARKFDVLRAIELFHSYRETRLKEGIVRLQPQEEPLRSELLSGKFTVL-SVRDPSGASIALYTAKLHHPNKTGNHVVLQALFYLLDRAVESFETQRNGLVFIYDMAGSNYTNFELDLSKKILNLLKGAFPARLKKVLIVGAPVWFRVPYNLLSLLLKEKLRERVQMV-KMAELCQHLPRDCLPQHLGG 227          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 1595.48 bits (4130), Expect = 0.000e+0
Identity = 851/855 (99.53%), Postives = 853/855 (99.77%), Query Frame = 1
Query:   64 MESMNNSETQXXXXXXXXXXXXXXVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKMHKKFQSCNGFSQXXXXXXXXXXXXXXXXIHPKKFENGFSMECDELMSSDFXXXXXXXXXXXXXXXXXXVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCXXXXXXXXXXXXXXXXXXVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNTPP 2628
            MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLY+KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILK HKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFTTSNNNLCNELLSETNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDED+HERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN PP
Sbjct:    1 MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKTHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFTTSNNNLCNELLSETNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDSHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNIPP 855          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 1590.47 bits (4117), Expect = 0.000e+0
Identity = 848/852 (99.53%), Postives = 850/852 (99.77%), Query Frame = 1
Query:   73 MNNSETQXXXXXXXXXXXXXXVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKMHKKFQSCNGFSQXXXXXXXXXXXXXXXXIHPKKFENGFSMECDELMSSDFXXXXXXXXXXXXXXXXXXVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCXXXXXXXXXXXXXXXXXXVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNTPP 2628
            MNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLY+KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILK HKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFTTSNNNLCNELLSETNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDED+HERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN PP
Sbjct:    1 MNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKTHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFTTSNNNLCNELLSETNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDSHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNIPP 852          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 1583.54 bits (4099), Expect = 0.000e+0
Identity = 834/855 (97.54%), Postives = 836/855 (97.78%), Query Frame = 1
Query:   64 MESMNNSETQXXXXXXXXXXXXXXVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKMHKKFQSCNGFSQXXXXXXXXXXXXXXXXIHPKKFENGFSMECDELMSSDFXXXXXXXXXXXXXXXXXXVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCXXXXXXXXXXXXXXXXXXVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNTPP 2628
            MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLY+KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILK HKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMS                 TNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDED+HERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN PP
Sbjct:    1 MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKTHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSK----------------TNNSVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDSHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNIPP 839          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 1578.92 bits (4087), Expect = 0.000e+0
Identity = 828/855 (96.84%), Postives = 834/855 (97.54%), Query Frame = 1
Query:   64 MESMNNSETQXXXXXXXXXXXXXXVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKMHKKFQSCNGFSQXXXXXXXXXXXXXXXXIHPKKFENGFSMECDELMSSDFXXXXXXXXXXXXXXXXXXVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCXXXXXXXXXXXXXXXXXXVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNTPP 2628
            MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLY+KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILK HKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFT                  +++ L+MTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDED+HERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN PP
Sbjct:    1 MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKTHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFT-----------------TSNNNLSMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDSHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNIPP 838          
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 1573.14 bits (4072), Expect = 0.000e+0
Identity = 825/852 (96.83%), Postives = 831/852 (97.54%), Query Frame = 1
Query:   73 MNNSETQXXXXXXXXXXXXXXVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKMHKKFQSCNGFSQXXXXXXXXXXXXXXXXIHPKKFENGFSMECDELMSSDFXXXXXXXXXXXXXXXXXXVTSSLLAMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCXXXXXXXXXXXXXXXXXXVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTXXXXXXXXXXXXRGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNTPP 2628
            MNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLY+KHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILK HKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFT                  +++ L+MTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDED+HERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVN PP
Sbjct:    1 MNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIFIYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNFLRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTAFNSLGYSYDILKTHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENGFSMECDELMSSDFT-----------------TSNNNLSMTAESRTPDSIGVISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYDMLSISSWELNLITSGDEDAIEDEDSHERHLHQMEINNENRTIENSPNLECSSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRSLHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDIPQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKPTDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRPKEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEGVCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLHFIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEICSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGYVNIPP 835          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPN95.497e-5936.56protein tyrosine phosphatase non-receptor type 9 [... [more]
PTPN95.660e-5936.56protein tyrosine phosphatase non-receptor type 9 [... [more]
PTPRS6.019e-3934.92protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS7.329e-3934.92protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS1.102e-3834.92protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y48G9A.96.219e-3730.98Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
Y48G9A.91.136e-3630.98Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
T22C1.81.248e-3532.65Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
T22C1.81.248e-3532.65Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
T27A3.57.572e-3530.98Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpmeg26.167e-5537.27gene:FBgn0028341 transcript:FBtr0071407[more]
Ptpmeg26.167e-5537.27gene:FBgn0028341 transcript:FBtr0333427[more]
Ptpmeg26.167e-5537.27gene:FBgn0028341 transcript:FBtr0100192[more]
Ptpmeg26.167e-5537.27gene:FBgn0028341 transcript:FBtr0303559[more]
Ptpmeg21.966e-5437.27gene:FBgn0028341 transcript:FBtr0100193[more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn9b9.671e-5446.15protein tyrosine phosphatase non-receptor type 9b ... [more]
ptpn9a1.938e-5135.22protein tyrosine phosphatase non-receptor type 9a ... [more]
ptpn9a2.310e-5135.22protein tyrosine phosphatase non-receptor type 9a ... [more]
ptprfa1.543e-4035.25protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.543e-4035.25protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfhas11.689e-5248.33malignant fibrous histiocytoma amplified sequence ... [more]
mfhas12.018e-5248.33malignant fibrous histiocytoma amplified sequence ... [more]
mfhas12.436e-5248.33malignant fibrous histiocytoma amplified sequence ... [more]
mfhas15.902e-5248.33malignant fibrous histiocytoma amplified sequence ... [more]
ptpn94.414e-5132.87protein tyrosine phosphatase non-receptor type 9 [... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpn91.118e-5836.78protein tyrosine phosphatase, non-receptor type 9 ... [more]
Ptprd1.126e-3935.25protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd1.212e-3935.25protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd1.238e-3935.25protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd1.252e-3935.25protein tyrosine phosphatase, receptor type, D [So... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43378|PTN9_HUMAN2.640e-5836.56Tyrosine-protein phosphatase non-receptor type 9 O... [more]
sp|Q641Z2|PTN9_RAT7.099e-5836.78Tyrosine-protein phosphatase non-receptor type 9 O... [more]
sp|O35239|PTN9_MOUSE7.821e-5836.78Tyrosine-protein phosphatase non-receptor type 9 O... [more]
sp|Q5I146|PTPH2_MDBVW7.692e-3931.93Tyrosine phosphatase H2 OS=Microplitis demolitor b... [more]
sp|Q64487|PTPRD_MOUSE9.231e-3935.25Receptor-type tyrosine-protein phosphatase delta O... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NGE01.475e-6339.17Tyrosine-protein phosphatase non-receptor type 9 (... [more]
A0A094ZMI24.643e-6339.04Tyrosine-protein phosphatase non-receptor type 9 O... [more]
A0A564ZDD29.667e-6338.52Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3Q0KSA38.799e-6238.67Protein-tyrosine phosphatase n9, putative OS=Schis... [more]
G4LXK99.450e-6238.67Protein-tyrosine phosphatase n9, putative OS=Schis... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn9b5.292e-5247.37protein tyrosine phosphatase non-receptor type 9b ... [more]
ptpn9a9.058e-5235.84protein tyrosine phosphatase non-receptor type 9 [... [more]
ptpn9a1.496e-5135.84protein tyrosine phosphatase non-receptor type 9 [... [more]
ptpn9a3.607e-4935.15protein tyrosine phosphatase non-receptor type 9 [... [more]
ENSAMXT00000022449.28.887e-4034.24pep primary_assembly:Astyanax_mexicanus-2.0:21:174... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn9b3.132e-4643.33protein tyrosine phosphatase non-receptor type 9b ... [more]
ENSPMAT00000006037.11.359e-3430.90pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:... [more]
ptpra6.691e-3330.77protein tyrosine phosphatase receptor type A [Sour... [more]
ptprk8.681e-3331.94protein tyrosine phosphatase receptor type K [Sour... [more]
ca16b5.136e-3231.56carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PTP18.983e-2028.53Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP21.957e-1227.93Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP38.772e-1024.73Phosphotyrosine-specific protein phosphatase; invo... [more]
CSR12.526e-723.27Phosphatidylinositol transfer protein; has a poten... [more]
SEC142.628e-621.96Phosphatidylinositol/phosphatidylcholine transfer ... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO456922.156e-4635.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339959.146e-3832.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469612.801e-3630.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481871.104e-3532.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318051.611e-3431.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn9b2.481e-5348.56tyrosine-protein phosphatase non-receptor type 9 [... [more]
ptpn9b3.649e-5348.56tyrosine-protein phosphatase non-receptor type 9 [... [more]
ptpn9b3.688e-5348.56tyrosine-protein phosphatase non-receptor type 9 [... [more]
ptpn9a1.836e-5035.99protein tyrosine phosphatase non-receptor type 9 [... [more]
ptpn9a2.123e-5035.74protein tyrosine phosphatase non-receptor type 9 [... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type 9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027354.10.000e+099.53SMESG000027354.1[more]
SMESG000027354.10.000e+099.53SMESG000027354.1[more]
SMESG000027354.10.000e+097.54SMESG000027354.1[more]
SMESG000027354.10.000e+096.84SMESG000027354.1[more]
SMESG000027354.10.000e+096.83SMESG000027354.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034636 ID=SMED30034636|Name=Tyrosine-protein phosphatase non-receptor type 9|organism=Schmidtea mediterranea sexual|type=transcript|length=2852bp
ATTAAATCTAACACAATTTAAATACATGTTTTCTTGAAATAATGATACTT
AATTTTTACTAAAATGGAAAGTATGAATAATTCTGAAACTCAATTAAAAT
TAAAATTGGATTTATCTGATAAAGAATTAGAGGATGTGAAAGTTTTTATG
AAATCAGCACAGTCGTTGCCAATTAATGTCAAAGATGAAGAAATAGCAAT
TAAGTTTTTGCGAGCAAAAAAATTTAATATTGATTCAGCACTGGATTTAT
ATCTAAAGCATGAAGCTATTCGAAGTAAAGAGAATCTTATTGAAATCGAT
CCATTCGAGAATGAAATTCTCCATGAGTTATTTTCTGAGAAGTTTACGTT
TCTAATGGATACTGATGATAAATCTGGTGCCTCGATTTGTATATTTACAG
CCAAGCTTCATCATCCTTCAAAAGCTTCCCATCAGCATGTTTTAAAAGCG
TTGATTTTTCAGTTAGATGCAATTCTATTATTACCAACAACTCAGAAAAA
TGGATTGATTTTTATTTACAACATGACTGGTTCTTTATATTCAAATTTCG
ACATGGCTCTCAGTGTTAAAATTCTTAATTTATTGAAGGGAGCATATCCT
GCAAGACTCTGCAAGGTCATTATATTCACACCACCGTTATGGTTTCGAGC
CGCTTTCAATTTTTTGCGGATATTTGTCAAAGATAAATTACAAGATCGAG
TTTACATATTAACGAAGAATGAAGAGTTATACTTTCATTTGTCAAAAGAT
ATTTTGCCTCTGACTTTTGGAGGTAATAAAGTTCACAATCATGTTATGTG
GCTGAAAACGGCGTTTAATTCCCTTGGGTATTCATACGATATTCTCAAGA
TGCACAAGAAATTTCAAAGTTGTAATGGATTTTCCCAGACGAAAACATCG
TCATCGAACGAAACAAATTCAACAGAAAATAAATCGATACATCCAAAAAA
ATTCGAAAATGGATTTTCTATGGAATGTGATGAATTAATGTCGAGTGATT
TCACAACTTCTAATAATAATTTATGTAATGAACTGTTATCAGAAACCAAT
AATTCTGTTACAAGTTCTCTTTTAGCTATGACTGCTGAGTCTCGCACACC
CGATAGTATTGGAGTGATAAGCTTTGATATTACTGTCTCTCCGATTGTTG
AAACCTCTGATCAGAAAAACACTAATTGCACTCATCCAGGCCACAGTTCT
CCAACATCAACGTCTTCAGGAATCGGAAGTTCAGTGCTAGACAACAAAGA
AAGCGATTACGATATGCTATCTATTAGCAGTTGGGAATTAAATTTGATTA
CTAGTGGAGATGAAGATGCTATTGAGGACGAGGATAATCACGAAAGACAC
CTACATCAAATGGAAATCAATAATGAAAATAGAACTATAGAAAATTCTCC
GAACTTGGAATGTTCCAGTGCAAGAACACCATTTAAAATATTGGAAAAAC
CTTCTTTCTTTCACAAAGTCCAACTGAAACGACGAAATGCTGTAAGAGAA
GAATACAAAACCTCAGATAAAAAACCAAATTGGGCTCTTTACCGACCGGA
ACCGACTCGATCATTGCACAATGCTCTAACGAATGATTCGGATTCAAGTG
ATGAAAACGAATCGGAAAGAGGTGTTACTATTGATTTTTTCATTGAATCA
GAGCTGCATTCATTTTATGCCACTCTCGGTGAATTCCGCAATGATTCTAT
TTATGGAGATATTCCTCAGTTCACATCATACAGTCATCCCTTAAATCTTC
CCAAAAACCGATATTCTGATATTCCGTGTATTGAAAGCAGCCGTGTCAAA
TTAATCAGAGATATTAATTTTACAAATAATCTGAATGAAGGGGATCCTCC
TTTACTGAAACCAACAGATTATATACACGCAAATTGGGTTGATGGATACA
GACAGATAAATGCATATGTTTGCACCCAAGGACCTTTAAACACAACCGTA
TCAGACTTTTGGCACATGATCATTCAATACAGAGTACCAATAATCGTCAT
GGCCACTAGGCCTAAAGAACAAAATAGAGATAAATGCTTTCAATATTGGC
CGGAAACAACAAAAGAAACAAAAATTTATCCGGGAATAAATAACTTATAT
GACAGTTTCCAAGTTACATCACTCAGGTCTAAAGAATTCGGTCCAAATTG
TCCCTCTGAAGGTGTTTGTGATAATGCCAGTTCTCATTGGTACCGAGTTA
CATTGCTCCACGTTAAAAATCTACGAACTGGCCAAGAACACAGAGTCAAT
CACTTCTATTTTCATAGCTGGCCTGACCAAGGAATTCCAAATAGTACGGA
TGGATTTTTACACTTCATCATTCAAATCCGTCAGACCTATAGATTGAATA
TTGCGAAGCTCGGTTATGAATCAGAAATGGATCAGAAAATTCCGCCACCT
CCAATCGTTGTCCATTGTAGTGCAGGAATAGGTAGAACAGGCACCTTCAT
TGTCACAGAAATCTGTTCGAAAAGTCTCACCGATTGTGGAAAATTCAACC
TCCATCAAACCATGTTGAAAATCCGAAGTCAAAGATATAAATGTGTACAA
AATGCTTACCAATATTTATATTGCCGTAATACAATAATCGATTATGCAAA
ACATGTAGGATATGTGAATACTCCTCCTGAAACCAATGAAGAAGAGGAAG
AAGAGGTCGAAGAATCAGAAGAAGAAATGGAAGAAGAAATTGATCAGGAA
TTGTCAGAATCTGAATAATTTTTGATTTTCTCTTTTTCGATTTTAAATTT
ATTATCATTGTGATTATATATTTGACATTGTATAAATTTCGAATAATTCT
TTATCTGTTTATAAATAGAGATCAAATAAATCTATTATATTTTTAAAAAA
AA
back to top

protein sequence of SMED30034636-orf-1

>SMED30034636-orf-1 ID=SMED30034636-orf-1|Name=SMED30034636-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=885bp
MESMNNSETQLKLKLDLSDKELEDVKVFMKSAQSLPINVKDEEIAIKFLR
AKKFNIDSALDLYLKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDT
DDKSGASICIFTAKLHHPSKASHQHVLKALIFQLDAILLLPTTQKNGLIF
IYNMTGSLYSNFDMALSVKILNLLKGAYPARLCKVIIFTPPLWFRAAFNF
LRIFVKDKLQDRVYILTKNEELYFHLSKDILPLTFGGNKVHNHVMWLKTA
FNSLGYSYDILKMHKKFQSCNGFSQTKTSSSNETNSTENKSIHPKKFENG
FSMECDELMSSDFTTSNNNLCNELLSETNNSVTSSLLAMTAESRTPDSIG
VISFDITVSPIVETSDQKNTNCTHPGHSSPTSTSSGIGSSVLDNKESDYD
MLSISSWELNLITSGDEDAIEDEDNHERHLHQMEINNENRTIENSPNLEC
SSARTPFKILEKPSFFHKVQLKRRNAVREEYKTSDKKPNWALYRPEPTRS
LHNALTNDSDSSDENESERGVTIDFFIESELHSFYATLGEFRNDSIYGDI
PQFTSYSHPLNLPKNRYSDIPCIESSRVKLIRDINFTNNLNEGDPPLLKP
TDYIHANWVDGYRQINAYVCTQGPLNTTVSDFWHMIIQYRVPIIVMATRP
KEQNRDKCFQYWPETTKETKIYPGINNLYDSFQVTSLRSKEFGPNCPSEG
VCDNASSHWYRVTLLHVKNLRTGQEHRVNHFYFHSWPDQGIPNSTDGFLH
FIIQIRQTYRLNIAKLGYESEMDQKIPPPPIVVHCSAGIGRTGTFIVTEI
CSKSLTDCGKFNLHQTMLKIRSQRYKCVQNAYQYLYCRNTIIDYAKHVGY
VNTPPETNEEEEEEVEESEEEMEEEIDQELSESE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR036273CRAL/TRIO_N_dom_sf
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR011074CRAL/TRIO_N_dom
IPR001251CRAL-TRIO_dom
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 857..883
NoneNo IPR availableGENE3DG3DSA:1.10.8.20coord: 17..72
e-value: 2.4E-5
score: 26.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 854..883
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 856..883
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 367..387
NoneNo IPR availablePANTHERPTHR19134:SF285TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 9coord: 534..852
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 41..245
coord: 534..852
NoneNo IPR availablePANTHERPTHR19134:SF285TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE 9coord: 41..245
NoneNo IPR availableCDDcd14543PTPc-N9coord: 540..837
e-value: 1.85888E-80
score: 258.834
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 726..743
score: 39.97
coord: 602..609
score: 56.76
coord: 811..826
score: 23.64
coord: 618..638
score: 51.18
coord: 827..837
score: 35.94
coord: 780..798
score: 74.52
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 526..846
e-value: 1.1E-84
score: 297.3
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 561..842
e-value: 7.7E-65
score: 218.7
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 559..844
score: 41.793
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 41..66
e-value: 4.3E-4
score: 29.6
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 727..843
e-value: 4.0E-31
score: 119.4
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 88..240
e-value: 1.1E-21
score: 88.0
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 92..238
e-value: 9.2E-24
score: 84.0
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 82..243
score: 16.337
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 86..238
e-value: 9.82632E-28
score: 107.856
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 528..851
e-value: 3.5E-84
score: 284.6
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 539..847
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 78..245
e-value: 4.2E-30
score: 106.2
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 95..239
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 783..793
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 749..835
score: 16.522
IPR036273CRAL/TRIO, N-terminal domain superfamilySUPERFAMILYSSF46938CRAL/TRIO N-terminal domaincoord: 16..78