Tubulin tyrosine ligase-like family, member 7

Overview
NameTubulin tyrosine ligase-like family, member 7
Smed IDSMED30034635
Length (bp)1246
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin tyrosine ligase-like family, member 7 (SMED30034635) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin tyrosine ligase-like family, member 7 (SMED30034635) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin tyrosine ligase-like family, member 7 (SMED30034635) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin tyrosine ligase-like family, member 7 (SMED30034635) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034635

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034635SMESG000055128.1 SmedASXL_016251SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30034635SMESG000081654.1 SMESG000076991.1 SMESG000072322.1 SMESG000065118.1 SMESG000062986.1 SMESG000061717.1 SMESG000055128.1 SMESG000053897.1 SMESG000051051.1 SMESG000041215.1 SMESG000034628.1 SMESG000019218.1 SMESG000017667.1 SMESG000011728.1 SMESG000009672.1 SMESG000002766.1 SMESG000002063.1 SMESG000001508.1 Contig30966uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034635SMESG000081654.1 SMESG000076991.1 SMESG000072322.1 SMESG000065118.1 SMESG000062986.1 SMESG000061717.1 SMESG000055128.1 SMESG000053897.1 SMESG000051051.1 SMESG000041215.1 SMESG000034628.1 SMESG000019218.1 SMESG000017667.1 SMESG000011728.1 SMESG000009672.1 SMESG000002766.1 SMESG000002063.1 SMESG000001508.1 Contig30966newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30034635SMESG000055128.1 dd_Smed_v6_13600_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30034635SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 49.6766 bits (117), Expect = 5.235e-6
Identity = 23/62 (37.10%), Postives = 36/62 (58.06%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 924
             L++   G++ C     R      SW+ +F+ + +++   EL  C RVVQLC DC+LIVY+F
Sbjct:  804 LLWSHGQGLWNCLSTSGR-----SSWECVFNKTSEVVNAQELRCCQRVVQLCRDCLLIVYKF 860          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. TrEMBL
Match: A0A2G8KPI4 (Putative tubulin polyglutamylase TTLL7 OS=Stichopus japonicus OX=307972 GN=BSL78_13265 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.682e-6
Identity = 31/75 (41.33%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI-SLSQSSTPRS 960
             L++   G++ CF           SW+ +FS S + + P+E+  C RVVQLC DC+LIVYQF+  S S    PRS
Sbjct:  226 LLWSHGQGLWNCFSSA------GDSWETMFSKSSESVTPVEMSCCRRVVQLCRDCLLIVYQFAAESRSNPPIPRS 294          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 52.373 bits (124), Expect = 6.579e-7
Identity = 25/62 (40.32%), Postives = 37/62 (59.68%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 924
             L++   G++ CF    R      SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F
Sbjct:  811 LLWSHGQGLWNCFCSSGRS-----SWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF 867          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 52.373 bits (124), Expect = 7.849e-7
Identity = 25/62 (40.32%), Postives = 37/62 (59.68%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 924
             L++   G++ CF    R      SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F
Sbjct:  811 LLWSHGQGLWNCFCSSGRS-----SWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF 867          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 51.6026 bits (122), Expect = 1.361e-6
Identity = 25/62 (40.32%), Postives = 37/62 (59.68%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 924
             L++   G++ CF    R      SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F
Sbjct:  811 LLWSHGQGLWNCFCSSGRS-----SWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF 867          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Nematostella
Match: EDO45409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT70])

HSP 1 Score: 52.373 bits (124), Expect = 2.302e-8
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 927
             L++   G++ CF           SW+ IFS S +++   E+  C RVVQLC DC+LIVYQF+
Sbjct:   85 LLWSHGQGLWNCFSN------LGNSWETIFSKSTEVLSSTEMSCCRRVVQLCRDCLLIVYQFA 141          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 52.7582 bits (125), Expect = 5.753e-7
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSS 948
             L++   G++ CF           SW+ IFS S ++  P EL  C R+VQLC DC+L+VY+F +S S+ S
Sbjct:  812 LLWSHGQGLWNCFSNTGS------SWETIFSKSSEVASPQELQCCRRLVQLCRDCLLVVYKF-VSESRGS 874          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 52.7582 bits (125), Expect = 5.765e-7
Identity = 28/70 (40.00%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  739 FLYNDFTGIFYCFILCKRFILFHRSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSS 948
             L++   G++ CF           SW+ IFS S ++  P EL  C R+VQLC DC+L+VY+F +S S+ S
Sbjct:  812 LLWSHGQGLWNCFSNTGS------SWETIFSKSSEVASPQELQCCRRLVQLCRDCLLVVYKF-VSESRGS 874          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Match: SMESG000017667.1 (SMESG000017667.1)

HSP 1 Score: 202.986 bits (515), Expect = 2.482e-63
Identity = 99/108 (91.67%), Postives = 100/108 (92.59%), Query Frame = 1
Query:    1 GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASILNQNLLIGDLPWLRYLCILVGLINKLVKKMMEFT 324
            GKTLRLMD+LN TVPSRIKTALDNIPSNIQE AMDEYHNLLFDGLVSGYSMTALGS HSEQL G TCVNPNASILNQNLLIGDL  LRYLCI VGLINKLVKKMMEFT
Sbjct:   99 GKTLRLMDMLNATVPSRIKTALDNIPSNIQECAMDEYHNLLFDGLVSGYSMTALGSSHSEQLFGNTCVNPNASILNQNLLIGDLLRLRYLCIFVGLINKLVKKMMEFT 206          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Match: SMESG000053897.1 (SMESG000053897.1)

HSP 1 Score: 201.06 bits (510), Expect = 4.260e-63
Identity = 99/110 (90.00%), Postives = 102/110 (92.73%), Query Frame = 1
Query:    1 GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASIL--NQNLLIGDLPWLRYLCILVGLINKLVKKMMEFT 324
            GKTLR MD+LN TVPSRIKTALD IP+N+QE AMDEYHN LFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASIL  NQNLLIGDLP LRYLCILVGLINKLVKKMMEFT
Sbjct:   62 GKTLRWMDMLNATVPSRIKTALDKIPANVQECAMDEYHNFLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASILIPNQNLLIGDLPRLRYLCILVGLINKLVKKMMEFT 171          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Match: SMESG000002766.1 (SMESG000002766.1)

HSP 1 Score: 199.519 bits (506), Expect = 7.143e-62
Identity = 98/111 (88.29%), Postives = 101/111 (90.99%), Query Frame = 1
Query:    1 GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASIL--NQNLLIGDLPWLRYLCILVGLINKLVKKMMEFTK 327
            GKTLR MD+LN TVPSRIKTA D IP+N+QE AMDEYHN LFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASIL  NQNLLIGDLP LRYLCILVGLINKLVK MMEFTK
Sbjct:   99 GKTLRWMDMLNATVPSRIKTAFDKIPANVQECAMDEYHNFLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASILIPNQNLLIGDLPRLRYLCILVGLINKLVKMMMEFTK 209          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Match: SMESG000061717.1 (SMESG000061717.1)

HSP 1 Score: 198.364 bits (503), Expect = 2.168e-61
Identity = 100/116 (86.21%), Postives = 104/116 (89.66%), Query Frame = 1
Query:    1 GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNASIL--NQNLLIGDLPWLRYLCILVGLINKLVKKMMEFTKSNYIN 342
            GKTLR MD+LN TVPSRIKTALD IP+N+QE AMDEYHN LFDGLVSGYSMTALGSGHSEQLIGKT VNPNASIL  NQNLLIGDLP LRYLCILVGLINKLVKKMMEFT  + IN
Sbjct:   99 GKTLRWMDMLNATVPSRIKTALDKIPANVQECAMDEYHNFLFDGLVSGYSMTALGSGHSEQLIGKTYVNPNASILIPNQNLLIGDLPRLRYLCILVGLINKLVKKMMEFTMCSKIN 214          
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Match: SMESG000058570.1 (SMESG000058570.1)

HSP 1 Score: 197.208 bits (500), Expect = 6.079e-61
Identity = 97/110 (88.18%), Postives = 101/110 (91.82%), Query Frame = 1
Query:    1 GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYSMTALGSGHSEQLIGKTCVNPNAS--ILNQNLLIGDLPWLRYLCILVGLINKLVKKMMEFT 324
            GKTLRLMD+LN TVPSRIKTA D IP NIQE A+DEY+NLLFDGLVSGYSMT LGSGHSEQLIGKTCVNPNAS  ILNQN+LIGDLP LRYLCILVGLINKLVKKMMEFT
Sbjct:   94 GKTLRLMDMLNATVPSRIKTAFDKIPPNIQECALDEYNNLLFDGLVSGYSMTTLGSGHSEQLIGKTCVNPNASILILNQNMLIGDLPRLRYLCILVGLINKLVKKMMEFT 203          
The following BLAST results are available for this feature:
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ttll75.235e-637.10tubulin tyrosine ligase-like family, member 7 [Sou... [more]
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A2G8KPI42.682e-641.33Putative tubulin polyglutamylase TTLL7 OS=Stichopu... [more]
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttll76.579e-740.32tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll77.849e-740.32tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll71.361e-640.32tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO454092.302e-841.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttll75.753e-740.00tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll75.765e-740.00tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin tyrosine ligase-like family, member 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017667.12.482e-6391.67SMESG000017667.1[more]
SMESG000053897.14.260e-6390.00SMESG000053897.1[more]
SMESG000002766.17.143e-6288.29SMESG000002766.1[more]
SMESG000061717.12.168e-6186.21SMESG000061717.1[more]
SMESG000058570.16.079e-6188.18SMESG000058570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034635 ID=SMED30034635|Name=Tubulin tyrosine ligase-like family, member 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1246bp
GGAAAAACTCTTCGTTTGATGGATGTGTTAAATGTTACAGTTCCAAGTCG
TATTAAAACTGCTCTTGATAATATCCCATCAAATATTCAAGAATTTGCTA
TGGATGAATATCATAACCTTCTGTTTGATGGTCTAGTTTCGGGATATTCG
ATGACAGCGTTGGGTTCAGGTCATAGTGAACAGTTAATTGGAAAGACCTG
TGTAAACCCCAACGCAAGCATTCTCAATCAAAATCTGTTGATCGGGGATC
TTCCGTGGCTGCGATATCTCTGTATCCTCGTGGGTCTAATTAATAAATTA
GTTAAAAAGATGATGGAATTCACCAAAAGCAATTATATCAATTGTACCGA
GATATTGAGATTTGAAACAGCGATTAGGTTATCGCTAATTCTTAATTTTT
ATTGAAGACTTCACGAAATATTGCCATAAGCACTCAATGAAAACTATTAC
ATTATTTGTGAAGTTTTAATTATTAAAATGGTAATTAGGTCGTAATGGTA
CTGATCAATAAAAGTCTATTAGTTATTGTTATTATTCAATGAACACCTTA
GATTAGGATTAAAAGCTACTAATTTATTTCATCGGCAAACAAAATCGCTA
TTCTGAAATTTCATGAAATTTCAAAAAAATTTCACTATATTTTGGATAAT
TATTTTGCAGTTTATCAAAATAGTTTAATTTCCTCAACAAATAAAATTTT
CGCACTTTAGGGTTAATTTTGTATATCATTAAATATAATTCCTTTATAAT
GATTTTACGGGTATTTTTTATTGTTTTATATTATGTAAACGTTTCATTTT
ATTTCATAGATCGTGGCAGCTGATATTTTCACACAGTGGGGACCTCATCA
AACCGCTAGAATTGGACATATGTTCCAGAGTTGTTCAACTGTGTCTCGAC
TGTGTACTTATTGTCTATCAGTTCTCGATCTCGTTGTCCCAATCTAGCAC
TCCGAGATCAGACAAATCGTTTGCGTCTCAGTCAGTAATTAGTGACTACA
AGGAGTCAGATTTAACAAGTTCCTTCTCGGTCAATTCAGTGACGGCATAA
TTGAAACAAATTGAAAAGGCAGATTCAATATATATGCATATTTATATATT
GCGGCTGGATTTATACATAGACCACAATTATAATATTCAATATATCCTTA
TTAATCGAACATGATCAAATCTCAATCAATTTATAACACAATTATAATCG
ATCGTCTGAATGTGCATATTCCAAATTATTTTTAATTGGAAAAGCC
back to top

protein sequence of SMED30034635-orf-1

>SMED30034635-orf-1 ID=SMED30034635-orf-1|Name=SMED30034635-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
GKTLRLMDVLNVTVPSRIKTALDNIPSNIQEFAMDEYHNLLFDGLVSGYS
MTALGSGHSEQLIGKTCVNPNASILNQNLLIGDLPWLRYLCILVGLINKL
VKKMMEFTKSNYINCTEILRFETAIRLSLILNFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process