Golgi-associated plant pathogenesis-related protein 1

Overview
NameGolgi-associated plant pathogenesis-related protein 1
Smed IDSMED30034629
Length (bp)1192
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi-associated plant pathogenesis-related protein 1 (SMED30034629) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi-associated plant pathogenesis-related protein 1 (SMED30034629) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi-associated plant pathogenesis-related protein 1 (SMED30034629) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi-associated plant pathogenesis-related protein 1 (SMED30034629) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034629

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034629SMESG000063568.1 Contig42867uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034629SMESG000063568.1 Contig42867newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30034629SMESG000063568.1 dd_Smed_v6_762_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034629SMESG000063568.1 dd_Smed_v6_762_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30034629SMESG000063568.1 dd_Smed_v6_762_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30034629SMESG000035531.1 Contig539GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034629SMESG000063568.1 Contig4276GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034629SMESG000063568.1 Contig539GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gamma neoblastSMED30034629SMESG000063568.1 SMED30034629smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30034629SMESG000063568.1 dd_Smed_v4_762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 105.916 bits (263), Expect = 1.044e-26
Identity = 68/164 (41.46%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            K  SK  + E L+AHN  R  H  P L +   L + AQ Y+E LA T    HS   S GQ GENLA +SY+       TG      WY EIK+Y F ++    S  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENVL     PPK+
Sbjct:    3 KSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQ------TGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVL-----PPKK 154          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 81.6481 bits (200), Expect = 3.924e-18
Identity = 59/165 (35.76%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLASSYNSREGYVFTGAAATQNW--YDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            K  SK  + E L+AHN  R  H  P L +   L + AQ Y+E LA T    HS   S GQ GENLA                   W  YD+                GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENVL     PPK+
Sbjct:    3 KSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLA-------------------WASYDQT---------------GHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVL-----PPKK 128          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 63.1586 bits (152), Expect = 1.092e-10
Identity = 47/148 (31.76%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSP---KLTIDW--ELAKSAQAYAEKLAKTNTFSHSE-----SNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQN-NSKIGHFSQVVWKGTKTAGFGRA---QSSSGNFVIVGQYKPPGN 808
            +  E +  HN LR     P    L ++W  E+  +AQ +A K     T  HS+     ++ + GENL  S +       + ++A Q+WYDEI D+ +G   ++ N+ +GH++Q+VW  T   G G A      S  +  V QY P GN
Sbjct:   36 VQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKC----TLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 63.1586 bits (152), Expect = 1.092e-10
Identity = 47/148 (31.76%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSP---KLTIDW--ELAKSAQAYAEKLAKTNTFSHSE-----SNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQN-NSKIGHFSQVVWKGTKTAGFGRA---QSSSGNFVIVGQYKPPGN 808
            +  E +  HN LR     P    L ++W  E+  +AQ +A K     T  HS+     ++ + GENL  S +       + ++A Q+WYDEI D+ +G   ++ N+ +GH++Q+VW  T   G G A      S  +  V QY P GN
Sbjct:   36 VQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKC----TLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 58.9214 bits (141), Expect = 3.809e-9
Identity = 45/145 (31.03%), Postives = 71/145 (48.97%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSP---KLTIDW--ELAKSAQAYAEKLAKTNTFSHSE-----SNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQN-NSKIGHFSQVVWKGTKTAGFGRAQS---SSGNFVIVGQYKP 799
            +  E +  HN LR     P    L ++W  E+  +AQ +A K     T  HS+     ++ + GENL  S +       + ++A Q+WYDEI D+ +G   ++ N+ +GH++Q+VW  T   G G A      S  +  V QY P
Sbjct:   36 VQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKC----TLQHSDPEDRKTSTRCGENLYMSSDPT-----SWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCP 171          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: C07A4.3 (pep chromosome:WBcel235:X:10174985:10175896:1 gene:WBGene00007398.1 transcript:C07A4.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07A4.3)

HSP 1 Score: 68.1662 bits (165), Expect = 3.995e-13
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAA-TQNWYDEIKDYKFGEETQNN-SKIGHFSQVVWKGTKTAGFGRAQSSSGNF---VIVGQYKPPGN 808
            K L +  +  HN+ RA H SP +T+D  L   AQ +++++A        E   +YGENL S  +S+     T AAA    +Y E   + +      + SK+GHF+Q++WK ++  G G + +  G      +  +Y PPGN
Sbjct:   42 KDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKCLVHEQPSKYGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYTRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRGTMYHVYVCIKYDPPGN 182          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443484:-1 gene:WBGene00010192.1 transcript:F57B7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.901e-12
Identity = 50/144 (34.72%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  419 ALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPG--NYIGHYKENVLS 841
             L AHN  R  + +  L    ELA+ A A+A KLA      + E  G  GENL     + + ++ TG    Q W  E + + F ++ + N K   FSQVVWK T   G  R  +++ N V +V  Y+P G  N  G +  NV S
Sbjct:  117 CLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPG-IGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDF-DKPRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNVPS 258          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443603:-1 gene:WBGene00010192.1 transcript:F57B7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 66.2402 bits (160), Expect = 8.043e-12
Identity = 46/131 (35.11%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  419 ALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPGN 808
             L AHN  R  + +  L    ELA+ A A+A KLA      + E  G  GENL     + + ++ TG    Q W  E + + F ++ + N K   FSQVVWK T   G  R  +++ N V +V  Y+P GN
Sbjct:  158 CLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYPELPG-IGENLILKEANEQSHLPTGQEVIQEWEKEAQFFDF-DKPRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGN 286          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: F09B9.5 (pep chromosome:WBcel235:X:10154821:10156856:1 gene:WBGene00008604.1 transcript:F09B9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09B9.5)

HSP 1 Score: 59.3066 bits (142), Expect = 3.296e-10
Identity = 52/183 (28.42%), Postives = 78/183 (42.62%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKF---GEETQNNSKIGHFSQVVWKGTKTAGFGRA--------------------------------QSSSGNFVIVGQYKPPG--NYIGHYKENVL 838
            K   ++ L  HN  R +H +P L    EL++ AQ +A+KLAK    S SE +G  GEN+               +  ++WY E + Y++   G +T  N    +F+QV+W+ TK  G G A                                 ++ G+ VIV  Y+P G  N  G +  NVL
Sbjct:    8 KEFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSG-IGENITFFPPD-----IDAESVVEHWYQEHEKYEYETPGWQTGTN----YFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNGSVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVL 180          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Match: scl-1 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20608])

HSP 1 Score: 56.9954 bits (136), Expect = 2.921e-9
Identity = 54/167 (32.34%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  422 LQAHNRLR-ALHHSP---------------KLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSRE-GYVFT-GAAATQNWYDEIKDYKFG----EETQNNSKIGHFSQVVWKGTKTAGFG-------RAQSSSGNFVIVGQYKPPGNYIGH--YKE 829
            + AHN+LR A+  S                K+ +D  +A SAQ YA     T    HS+  G YGENL  S+ S + G + + G  A   W  E +D+ +     + T  NS IGH +Q+ W  T + G G        +  +     +V QY PPGN +G   YKE
Sbjct:   25 VDAHNKLRSAIAKSTYVAKGTKKEPATDMRKMVVDSTVAASAQNYAN----TCPTGHSKGTG-YGENLYWSWTSADVGSLDSYGEIAAAAWEKEFQDFGWKSNAMDTTLFNSGIGHATQMAWANTSSIGCGVKNCGRDASMRNMNKIAVVCQYSPPGNTMGRPIYKE 186          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG31482 (gene:FBgn0051482 transcript:FBtr0081679)

HSP 1 Score: 114.775 bits (286), Expect = 6.276e-30
Identity = 68/156 (43.59%), Postives = 83/156 (53.21%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQ-YGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKRE 868
             L E+ L  HNRLR  H SP LT+D EL K  + YA+ LA      HS S GQ YGENL            T     Q+WYDEI DY F E+ Q     GHF+ +VWK  K  G G+A+   G + +V +Y PP N  G ++ENVL    PP K E
Sbjct:   21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCMRSQ-------TPLQCVQDWYDEIADYDF-EKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVL----PPIKGE 164          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 91.6633 bits (226), Expect = 1.326e-21
Identity = 58/163 (35.58%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  377 GCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKR 865
            G  TK  ++   +E     N+ RA+H  P +TI+  L K AQ +A  L   NT +H   N +YGEN+  S     G   TG    + WY EI  Y F  + Q     GHF+Q++WK +   G G A+ +   +V+   Y PPGN +G +K+NV      PPK+
Sbjct:   21 GQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH-RPNPKYGENIFLS----GGMDVTGDLPVEMWYREINSYDF-NKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVC-NYNPPGNVVGLFKDNV------PPKQ 170          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG16995 (gene:FBgn0031412 transcript:FBtr0077758)

HSP 1 Score: 74.7146 bits (182), Expect = 8.000e-16
Identity = 47/129 (36.43%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  398 SKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEET-QNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVI 781
            ++   +E LQAHN  RA H +  LT+  +L + A  +A  L   N   H +++G YGEN+  +     G    GA A ++WY+EI+ Y +   + Q N+  GHF+QVVWK +   G G A+S S  +V+
Sbjct:    3 AQQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSG-YGENIYMA----SGGNLKGADAVRSWYEEIRQYNWNSPSFQGNT--GHFTQVVWKSSTELGVGFAKSGSTIYVV 124          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG34049 (gene:FBgn0054049 transcript:FBtr0302372)

HSP 1 Score: 77.411 bits (189), Expect = 1.458e-15
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  395 KSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVL 838
            + K + +  L+  N+ R LH++  L +D +L   AQ +A+ LA  N    +  N  YGEN+     S+    F+     + WY E  +Y + +    N   GHF+Q+VW+ ++  G G A   S  + IV  Y PPGN   H++ENVL
Sbjct:  141 RRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLE-TRPNPLYGENIMRVRRSK----FSVDQILKLWYQEKYNYDYLKPG-FNLYTGHFTQLVWRESEFLGVGVACDVSSIW-IVCNYHPPGNVSEHFRENVL 281          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077755)

HSP 1 Score: 70.4774 bits (171), Expect = 2.272e-14
Identity = 45/127 (35.43%), Postives = 63/127 (49.61%), Query Frame = 2
Query:  377 GCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQ 757
            G  TK  ++   +E     N+ RA+H  P +TI+  L K AQ +A  L   NT +H   N +YGEN+  S     G   TG    + WY EI  Y F  + Q     GHF+Q++WK +   G G A+
Sbjct:   21 GQDTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAH-RPNPKYGENIFLS----GGMDVTGDLPVEMWYREINSYDF-NKAQFVPTAGHFTQLIWKSSVEMGSGVAR 141          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: CR855258.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33040981:33045706:-1 gene:ENSDARG00000111579.1 transcript:ENSDART00000192095.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.2)

HSP 1 Score: 108.612 bits (270), Expect = 1.071e-27
Identity = 67/145 (46.21%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  410 NEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            + E LQ HN  R  H +P LTI+  L++SAQ +AE L    T  H  SNG +GEN+  +YNS    + TG  A ++WY+EIK+Y F      +SK GHF+QVVWK +K  G G A   S +FV VGQY P GN    G+++ NVL
Sbjct:    3 DAEFLQTHNAYRKHHGAPPLTININLSRSAQKWAEHLLSIRTLMH--SNGDHGENVYYAYNSANKKL-TGREAVESWYNEIKEYNF-SRPGFSSKTGHFTQVVWKDSKELGVGLATDGSTSFV-VGQYLPGGNITNAGYFERNVL 142          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: glipr2l (GLI pathogenesis-related 2, like [Source:ZFIN;Acc:ZDB-GENE-041010-53])

HSP 1 Score: 105.916 bits (263), Expect = 5.246e-27
Identity = 67/163 (41.10%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPK 862
            K  S+  +EEAL+ HN  R  H +P L +  +L   A  YAE LA T    HS   S G  GENLA +SY+       TG   T  WY+E+  Y F  +   +S  GHF+ VVWKG+K  G G+A +S G+  +V +Y P GN    GH++ NVL     PPK
Sbjct:    3 KSASRLFSEEALKTHNEYRRKHQAPPLKLSSKLCSEASRYAESLASTRILKHSVESSRGNCGENLAWASYDQ------TGKDVTDRWYNEVNQYNF-NQPGFSSGTGHFTAVVWKGSKKLGVGKAVASDGSTFVVARYFPAGNITNQGHFQANVL-----PPK 153          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33044681:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000180085.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 104.375 bits (259), Expect = 2.936e-26
Identity = 68/147 (46.26%), Postives = 85/147 (57.82%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNY--IGHYKENVL 838
            S   E LQ HN  R  H +P LT +  L +SAQ +AE L  T T +H  SN  YGENL  +++S    + TG  A  +WY EIKDY F      +SK GHF+QVVWK TK  G G A   +  FV VGQY P GN    G++++NVL
Sbjct:    4 SFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAH--SNKGYGENLYYAWSSANKKL-TGHEAVDSWYGEIKDYNF-SRPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFV-VGQYLPAGNIANAGYFEKNVL 145          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: AL929549.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:33037880:-1 gene:ENSDARG00000113959.1 transcript:ENSDART00000189171.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929549.2)

HSP 1 Score: 103.605 bits (257), Expect = 4.659e-26
Identity = 67/145 (46.21%), Postives = 85/145 (58.62%), Query Frame = 2
Query:  410 NEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNY--IGHYKENVL 838
            + E LQ HN  R  H +P LT +  L +SAQ +AE L  T T +H  SN  YGENL  +++S    + TG  A  +WY EIKDY F      +SK GHF+QVVWK TK  G G A   +  FV VGQY P GN    G++++NVL
Sbjct:    3 DAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAH--SNKGYGENLYYAWSSANKKL-TGNEAVDSWYGEIKDYNF-SRPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFV-VGQYLPAGNIANAGYFEKNVL 142          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Match: im:7150988 (im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169])

HSP 1 Score: 102.449 bits (254), Expect = 9.108e-26
Identity = 63/148 (42.57%), Postives = 88/148 (59.46%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPGNYI--GHYKENVL 838
            S  +E LQ HN+ R  H +P L    +L ++AQ +AE +    +  HSE+    GEN+  S++S +    TG  A  +WY EIKDY F  ++ +  K GHF+QVVWK +K  G G A  + GN V +VGQYKP GN    G+Y++NVL
Sbjct:    5 SFKQEFLQTHNQYRHQHQAPPLVYREDLCRAAQKWAEHMLSKKSLGHSETEN--GENVYYSFSSVKK-TPTGKEAVDSWYSEIKDYNFA-KSGHQPKTGHFTQVVWKSSKELGVGLA--TDGNTVFVVGQYKPAGNITNAGYYEQNVL 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: echdc1 (ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;Acc:XB-GENE-958554])

HSP 1 Score: 115.546 bits (288), Expect = 1.453e-30
Identity = 64/148 (43.24%), Postives = 86/148 (58.11%), Query Frame = 2
Query:  395 KSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVL 838
            K  +  +E L+AHN+ R  H+ P + ++ EL+KSAQ +A  L   N   HS   G  GENL  SY+SR      G  A   WY+E+KDY +  +    +  GHF+QVVWK +K  G G A    G F +VG+Y PPGN IG ++ENVL
Sbjct:    3 KRAAQEQEFLEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHS---GAGGENLYYSYSSR------GNVAVDAWYNEVKDYDY-NKPGFKAATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVIGQFQENVL 140          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 105.916 bits (263), Expect = 4.903e-24
Identity = 63/165 (38.18%), Postives = 89/165 (53.94%), Query Frame = 2
Query:  371 MGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNS--REGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
            + G + +  + S  +EAL AHN+ R  H +P+L +  EL  S+Q +A+ L   N   H  SN   GENL   +NS  R+    +GA   + WY+EIKDY FG      S  GHF+QVVWK ++  G  +A    G  + V QY P GN    G++++NVL    P
Sbjct:  194 VSGLTKQAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQH--SNTANGENLWYKWNSSMRDA---SGAEVVETWYNEIKDYSFGRPG-FQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNVLPKGTP 352          

HSP 2 Score: 102.834 bits (255), Expect = 3.979e-23
Identity = 66/161 (40.99%), Postives = 86/161 (53.42%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNS--REGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL---SATGPPPKRE 868
              ++ L AHN  R  H +P L +  +L +SAQ +A+ L    T  HS   G  GENL   Y+S  RE     G      WYDEIK+Y FG      S  GHF+QVVWK +K  G G A   +G + +VGQY P GN    G++++NVL   S+ GP   RE
Sbjct:   18 FEQDFLAAHNTYRRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHS--GGNTGENLYYKYSSVARE---LPGQEPVDAWYDEIKNYDFGRPG-FRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNVLPAGSSPGPDSYRE 172          

HSP 3 Score: 83.1889 bits (204), Expect = 1.356e-16
Identity = 52/159 (32.70%), Postives = 81/159 (50.94%), Query Frame = 2
Query:  368 TMGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            T    S    S+    E L+A+N  R+ H +  L ++ ++++ AQ +AE L    T  HS+++  +GEN+ +  +       TG     +WY E K+Y F +     +  GHF+Q+VWK +K  G G A S  G  ++V QY P GN    G Y  N+L
Sbjct:  373 TDSASSPTADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTS--HGENIWAK-SGGPSITVTGQEVADSWYKEEKNYNFSKPGYQ-ADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNIL 527          

HSP 4 Score: 75.8702 bits (185), Expect = 3.559e-14
Identity = 46/148 (31.08%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            KS  ++ L  HN+ R LH +  L +   L++ AQ +A+ L       +S+++  +GENL   + +    + TG    ++WY+E   Y F       S  G+F+Q++WK +   GFG +  + G ++ VG Y P GN    G++++NVL
Sbjct:  561 KSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTH--HGENLWYRWGTNTS-LPTGKEVAESWYNENAKYSFATPG-FQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVL 704          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 105.531 bits (262), Expect = 5.988e-24
Identity = 63/165 (38.18%), Postives = 89/165 (53.94%), Query Frame = 2
Query:  371 MGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNS--REGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
            + G + +  + S  +EAL AHN+ R  H +P+L +  EL  S+Q +A+ L   N   H  SN   GENL   +NS  R+    +GA   + WY+EIKDY FG      S  GHF+QVVWK ++  G  +A    G  + V QY P GN    G++++NVL    P
Sbjct:  183 VSGLTKQAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQH--SNTANGENLWYKWNSSMRDA---SGAEVVETWYNEIKDYSFGRPG-FQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNVLPKGTP 341          

HSP 2 Score: 93.9745 bits (232), Expect = 3.663e-20
Identity = 59/142 (41.55%), Postives = 76/142 (53.52%), Query Frame = 2
Query:  443 RALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNS--REGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPP 856
            R  H +P L +  +L +SAQ +A+ L    T  HS   G  GENL   Y+S  RE     G      WYDEIK+Y FG      S  GHF+QVVWK +K  G G A   +G + +VGQY P GN    G++++NVL A   P
Sbjct:    2 RRKHGAPPLQLSRDLCRSAQQWADHLLSIRTLEHS--GGNTGENLYYKYSSVARE---LPGQEPVDAWYDEIKNYDFGRPG-FRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNVLPAGSSP 137          

HSP 3 Score: 83.1889 bits (204), Expect = 1.444e-16
Identity = 52/159 (32.70%), Postives = 81/159 (50.94%), Query Frame = 2
Query:  368 TMGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            T    S    S+    E L+A+N  R+ H +  L ++ ++++ AQ +AE L    T  HS+++  +GEN+ +  +       TG     +WY E K+Y F +     +  GHF+Q+VWK +K  G G A S  G  ++V QY P GN    G Y  N+L
Sbjct:  362 TDSASSPTADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTS--HGENIWAK-SGGPSITVTGQEVADSWYKEEKNYNFSKPGYQ-ADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNIL 516          

HSP 4 Score: 75.485 bits (184), Expect = 3.722e-14
Identity = 46/148 (31.08%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            KS  ++ L  HN+ R LH +  L +   L++ AQ +A+ L       +S+++  +GENL   + +    + TG    ++WY+E   Y F       S  G+F+Q++WK +   GFG +  + G ++ VG Y P GN    G++++NVL
Sbjct:  550 KSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTH--HGENLWYRWGTNTS-LPTGKEVAESWYNENAKYSFATPG-FQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVL 693          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 59.6918 bits (143), Expect = 4.198e-9
Identity = 52/175 (29.71%), Postives = 72/175 (41.14%), Query Frame = 2
Query:  413 EEALQAHNRLRALHHSPK-----LTIDWELAKSAQAYAEKLAKTNTFSHSESN--GQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYK---------FGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGN---------FVIVGQYKPPGNYIGH--YKENVLSATGPP 856
            EE +Q HN+LR   H        +T D EL KSA+A+AE+      + H  +      G+NLA  +    G     A   Q+WYDE+KDY          +  E  +     H++Q+VW  T   G         N           +V  Y P GN+IG   YK     +  PP
Sbjct:   58 EEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEEC----IWEHGPTALLMSIGQNLAVHW----GRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPP 224          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 59.3066 bits (142), Expect = 4.901e-9
Identity = 52/175 (29.71%), Postives = 72/175 (41.14%), Query Frame = 2
Query:  413 EEALQAHNRLRALHHSPK-----LTIDWELAKSAQAYAEKLAKTNTFSHSESN--GQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYK---------FGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGN---------FVIVGQYKPPGNYIGH--YKENVLSATGPP 856
            EE +Q HN+LR   H        +T D EL KSA+A+AE+      + H  +      G+NLA  +    G     A   Q+WYDE+KDY          +  E  +     H++Q+VW  T   G         N           +V  Y P GN+IG   YK     +  PP
Sbjct:   58 EEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAEAWAEEC----IWEHGPTALLMSIGQNLAVHW----GRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPP 224          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 110.153 bits (274), Expect = 1.462e-28
Identity = 70/164 (42.68%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            K  SK  N E L+AHN  RA H  P L +  +L + AQ Y+E LA T    HS   S GQ GENLA +SY+       TG      WY EIK Y F ++    S  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENV     PPPK+
Sbjct:    3 KSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQ------TGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV-----PPPKK 154          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Crisp3 (cysteine-rich secretory protein 3 [Source:MGI Symbol;Acc:MGI:102552])

HSP 1 Score: 72.0182 bits (175), Expect = 5.656e-14
Identity = 54/152 (35.53%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLR---ALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS-----ESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGE-ETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSG--NFVIVGQYKPPGNYIGHY 823
            KS+ EE +  HN+LR   +   S  L ++W     AQ  A++ A   TFSHS      +N + GENL  S      Y+   ++  Q WY+E K   FG    QN S +GH +QVVWK       G A+       +  V +Y P  NY GHY
Sbjct:   36 KSVQEEIVSKHNQLRRKVSPSGSDLLNMEWNY--DAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMS-----SYLVPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHY 180          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Crisp1 (cysteine-rich secretory protein 1 [Source:MGI Symbol;Acc:MGI:102553])

HSP 1 Score: 70.4774 bits (171), Expect = 2.093e-13
Identity = 53/150 (35.33%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHH---SPKLTIDWELAKSAQAYAEKLAKTNTFSHS-----ESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKD--YKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSG--NFVIVGQYKPPGNYIG 817
            S+ EE +  HN+LR +     S  L ++W     AQ  A++ A   TFSHS      +N + GENL  S      Y+ + ++A Q WY+E KD  Y  G + Q +S +GH++QVVW  T     G A+       +  V  Y P GNY G
Sbjct:   37 SVQEEIVSKHNQLRRMVSPSGSDLLKMEWNY--DAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMS-----SYLASWSSAIQGWYNEYKDLTYDVGPK-QPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQG 178          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 63.929 bits (154), Expect = 1.624e-12
Identity = 35/86 (40.70%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  614 TGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            +G      WY EIK Y F ++    S  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENV     PPPK+
Sbjct:    4 SGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV-----PPPKK 83          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 59.3066 bits (142), Expect = 1.377e-9
Identity = 50/159 (31.45%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  422 LQAHNRLRALHHSPK---LTIDW--ELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQN-NSKIGHFSQVVWKGTKTAGFG-------RAQSSSGNFVIVGQYKPPGNYIGH--YKENVLSATGP 853
            +  HN+ RA    P    L + W  ELA  A+AYA+K      + H++  G+ GENL +   + EG       A  NW++E + Y F   T + N   GH++QVVW  T+  G G       +    +   ++V  Y+PPGN  G   Y+E    +  P
Sbjct:   39 VDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKC----VWGHNKERGRRGENLFAI--TDEG--MDVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCP 189          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9CYL5|GAPR1_MOUSE (Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus OX=10090 GN=Glipr2 PE=1 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 1.023e-27
Identity = 70/164 (42.68%), Postives = 90/164 (54.88%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            K  SK  N E L+AHN  RA H  P L +  +L + AQ Y+E LA T    HS   S GQ GENLA +SY+       TG      WY EIK Y F ++    S  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENV     PPPK+
Sbjct:    3 KSASKQFNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQ------TGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV-----PPPKK 154          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|Q9H4G4|GAPR1_HUMAN (Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR2 PE=1 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 5.016e-26
Identity = 68/164 (41.46%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGPPPKR 865
            K  SK  + E L+AHN  R  H  P L +   L + AQ Y+E LA T    HS   S GQ GENLA +SY+       TG      WY EIK+Y F ++    S  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN +  G ++ENVL     PPK+
Sbjct:    3 KSASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQ------TGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVL-----PPKK 154          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|P08299|PR1A_TOBAC (Pathogenesis-related protein 1A OS=Nicotiana tabacum OX=4097 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.132e-20
Identity = 54/146 (36.99%), Postives = 76/146 (52.05%), Query Frame = 2
Query:  383 STKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKI-GHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIG 817
            S   ++++  ++ L AHN  RA      LT D ++A  AQ YA +LA      HS  +GQYGENLA       G   T A A + W DE + Y     T    ++ GH++QVVW+ +   G  R Q ++G +V+   Y PPGNY G
Sbjct:   25 SHSCRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAEG----SGDFMTAAKAVEMWVDEKQYYDHDSNTCAQGQVCGHYTQVVWRNSVRVGCARVQCNNGGYVVSCNYDPPGNYRG 164          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|P47032|PRY1_YEAST (Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY1 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.905e-18
Identity = 59/141 (41.84%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  422 LQAHNRLRALH-HSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFG--RAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
            L  HN+ RALH  +P L+    LA  AQ YA+    + T +HS   G YGENLA  Y+        G AA   WY+EI +Y F      +S  GHF+QVVWK T   G G      + G++VI   Y P GNY G Y +NV
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHS--GGPYGENLALGYD--------GPAAVDAWYNEISNYDF-SNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVIC-SYDPAGNYEGEYADNV 295          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Match: sp|P09042|PR1C_TOBAC (Pathogenesis-related protein 1C OS=Nicotiana tabacum OX=4097 PE=2 SV=3)

HSP 1 Score: 83.9593 bits (206), Expect = 7.070e-18
Identity = 51/136 (37.50%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  413 EEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKI-GHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIG 817
            ++ L AHN  RA      LT D ++A  AQ YA +LA      HS  +GQYGENLA       G   T A A + W +E + Y     T    ++ GH++QVVW+ +   G  R Q ++G +++   Y PPGN IG
Sbjct:   35 QDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHS--HGQYGENLAWG----SGDFLTAAKAVEMWVNEKQYYAHDSNTCAQGQVCGHYTQVVWRNSVRVGCARVQCNNGGYIVSCNYDPPGNVIG 164          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: H2KNL7 (Golgi-associated plant pathogenesis-related protein 1 OS=Clonorchis sinensis OX=79923 GN=Glipr2 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 9.868e-39
Identity = 78/155 (50.32%), Postives = 105/155 (67.74%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPGNYIGHYKENVLSATGPPPK 862
            + LN+EA+ AHN+LRA H  PKLT+D ELA+ AQ +AE+LAKT    HS ++ ++GENLA   +S +    +G  ATQ WYDEI  +++ E+ Q  S  GHF+QV+WKGT+ AGFGRA SS G  + +VG+Y PPGN +G + ENV     P  K
Sbjct:    3 RQLNDEAIAAHNQLRAAHGCPKLTLDPELARGAQKWAEELAKTKRLQHS-NDKRFGENLAYQQSSVKA-ALSGQQATQMWYDEIHVHQYVEQFQPQS--GHFTQVIWKGTQKAGFGRASSSDGKSIYVVGRYTPPGNMVGKFCENVPRPIRPVEK 153          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: A0A068W9F9 (Venom allergen val protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000745000 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.145e-38
Identity = 78/144 (54.17%), Postives = 96/144 (66.67%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGN-FVIVGQYKPPGNYIGHYKENV 835
            LNEE +QAHN+LRALH    LT D +LAK AQ +AE L K N   HS +N  YGEN+A       G+ FTG  A+Q WY EIKDY F  +  +  K GHF+Q+VW  TK AGFG A+S+ G+  +IVGQYKPPGNY+G +K  V
Sbjct:    7 LNEECIQAHNKLRALHGCASLTYDAKLAKQAQKHAEYLLKQNKMEHS-TNRDYGENIALK-GGTPGFQFTGYDASQMWYSEIKDYDF--KGGDQLKCGHFTQLVWSDTKRAGFGVAKSAKGDKVIIVGQYKPPGNYMGEFKAKV 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: B3GUV1 (Golgi-associated plant pathogenesis-related protein OS=Schistosoma japonicum OX=6182 GN=EWB00_004227 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 9.795e-38
Identity = 80/156 (51.28%), Postives = 97/156 (62.18%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPGNYIGHYKENVLSATGPPPKREE 871
            LN EA+QAHN LRALH  PK++ D +LA  +Q +AE LA  N   HS+++G YGENLA    S  G    G  AT+NWYDEI  + F    QN    GHF+QV+WK T  AGFG A+S  G  V +VG+YKP GN IGHY +NV       P REE
Sbjct:    6 LNNEAIQAHNELRALHGCPKISYDSKLASDSQKWAEHLASINCLQHSKADG-YGENLAFQM-STAGASLNGREATRNWYDEISKHDF--NGQNQPGTGHFTQVIWKSTNKAGFGSAKSKDGMKVYVVGRYKPAGNVIGHYTDNVPRPKKNAPPREE 157          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: Q86EZ0 (Clone ZZD128 mRNA sequence OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.048e-37
Identity = 80/156 (51.28%), Postives = 97/156 (62.18%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFV-IVGQYKPPGNYIGHYKENVLSATGPPPKREE 871
            LN EA+QAHN LRALH  PK++ D +LA  +Q +AE LA  N   HS+++G YGENLA    S  G    G  AT+NWYDEI  + F    QN    GHF+QV+WK T  AGFG A+S  G  V +VG+YKP GN IGHY +NV       P REE
Sbjct:    6 LNNEAIQAHNELRALHGCPKISYDSKLASDSQKWAEHLASINCLQHSKADG-YGENLAFQM-STAGASLNGREATRNWYDEISKHDF--NGQNQPGTGHFTQVIWKSTNKAGFGSAKSKDGMKVYVVGRYKPAGNVIGHYTDNVPRPKKNAPPREE 157          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Match: A0A068Y9F8 (Venom allergen val protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000745000 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 7.348e-36
Identity = 75/144 (52.08%), Postives = 95/144 (65.97%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGN-FVIVGQYKPPGNYIGHYKENV 835
            LNEE ++AHN+LRALH    LT D +LAK AQ +AE L K N   HS +N  YGEN+A       G+ FTG  A+Q WY EI+ Y F  +  +  K GHF+Q+VW  TK AGFG A+S+ G+  +IVGQYKPPGNY+G +K  V
Sbjct:    7 LNEECIRAHNKLRALHGCAPLTYDAKLAKQAQKHAEYLLKQNKMEHS-TNRDYGENIALK-GGTPGFQFTGYDASQMWYSEIRAYDF--KGGDQLKCGHFTQLVWSDTKQAGFGVAKSAKGDKVIIVGQYKPPGNYMGEFKAKV 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000046499.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:22169:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000046499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 8.203e-31
Identity = 71/152 (46.71%), Postives = 90/152 (59.21%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
            S  EE LQ HN  R  H +P LTI  +L++SA+ +AE L    T  H  SN +YGENL  +++S  G   TG  A  +WY+EIKDY F      +S  GHF+QVVWK TK  G+G A      FV VGQY PPGN+   G +++NVL A  P
Sbjct:   15 SFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQH--SNREYGENLYYAFSS-GGKSLTGREAVDSWYNEIKDYNF-SRPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFV-VGQYLPPGNFTNPGAFEKNVLPAGTP 161          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000037136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:26526:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000037136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 2.901e-30
Identity = 70/151 (46.36%), Postives = 89/151 (58.94%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
              EE LQ HN  R  H +P LTI  +L++SA+ +AE L    T  H  SN +YGENL  +++S  G   TG  A  +WY+EIKDY F      +S  GHF+QVVWK TK  G+G A      FV VGQY PPGN+   G +++NVL A  P
Sbjct:   22 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQH--SNREYGENLYYAFSSG-GKSLTGREAVDSWYNEIKDYNF-SRPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFV-VGQYLPPGNFTNPGAFEKNVLPAGTP 167          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000051775.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:28035:32028:1 gene:ENSAMXG00000030558.1 transcript:ENSAMXT00000051775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 4.735e-30
Identity = 68/150 (45.33%), Postives = 90/150 (60.00%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATG 850
              EE LQ HN  R  H +P LTI  +L++SA+ +AE L    T  H  SN +YGENL  +++S  G   TG  A  +WY+E+KDY F      +S  GHF+QVVWK TK  G+G A      FV VGQY PPGN+   G +++NVL++ G
Sbjct:    5 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQH--SNREYGENLYYAFSSG-GKSLTGREAVDSWYNEVKDYNF-SRPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFV-VGQYLPPGNFTNPGAFEKNVLTSNG 149          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000045529.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:33202:35631:1 gene:ENSAMXG00000033350.1 transcript:ENSAMXT00000045529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.196e-29
Identity = 68/152 (44.74%), Postives = 89/152 (58.55%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
            S   E LQ HN  R  H +P LTI  +L +SA+++A+ L    T  H  SN +YGENL  +++S  G   TG  A  +WY+E+KDY F      +S  GHF+QVVWK TK  G+G A      FV VGQY PPGN+   G +++NVL A  P
Sbjct:    5 SFEVEFLQTHNTYRNKHGAPPLTISQDLCRSAKSWADYLLSIKTLQH--SNKEYGENLYYAFSSG-GKSLTGHEAVDSWYNEVKDYNF-SRPGFSSATGHFTQVVWKDTKEVGYGVATDGKTVFV-VGQYLPPGNFTNPGAFEKNVLPAGTP 151          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000056153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:17472:20230:1 gene:ENSAMXG00000040666.1 transcript:ENSAMXT00000056153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 3.508e-29
Identity = 69/151 (45.70%), Postives = 90/151 (59.60%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSATGP 853
              +E LQ+HN  R  H +  LTI  EL +SAQA+AE L    T  HS S G++GENL  +++S  G   TG  A  +WY+E+KDY +      +S  GHF+QVVWK TK  G+G A      FV VGQY PPGN+   G +++NVL A  P
Sbjct:   15 FEKEFLQSHNTYRNKHGAQPLTISRELCRSAQAWAEHLLSIKTLQHS-SGGKFGENLFYTWSS-GGKSLTGREAVDSWYNEVKDYNY-SRPGFSSGTGHFTQVVWKDTKELGYGVATDGKTVFV-VGQYLPPGNFTNPGAFEKNVLPAGTP 161          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002231.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002231.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 2.152e-15
Identity = 51/155 (32.90%), Postives = 77/155 (49.68%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLA-SSYNSRE--------GYVFTG-AAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATG 850
            + L+AHN  RA H +  L     L + A+A+AE L +     HS+++  +GENL      +RE        G    G    T++WY E+K Y F        K+G+  ++VW+ +++ G GRA S  G  V+V  Y PP + I    E VL+  G
Sbjct:    5 DLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTS--HGENLYYRPLGAREQGAEPGGTGLRLRGRKEVTEHWYSEVKHYDFSSPGYK-PKVGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDPPKD-IRQVAEEVLNVAG 155          

HSP 2 Score: 65.855 bits (159), Expect = 2.904e-12
Identity = 45/143 (31.47%), Postives = 68/143 (47.55%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGN--YIGHYKENVL 838
            + L  HNRLR +H +  L     L + A+A+A +LA++     S     +G+N+ + +    G +  G   T  WY +   Y +          G+FSQ+VW+ +   G G A    G FV V  Y P GN  Y   Y++NVL
Sbjct:  193 DVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNVWAKHIG-TGELPKGRKVTNCWYADRLAYDYNNPGFQQG-TGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVL 332          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002228.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 2.400e-15
Identity = 45/130 (34.62%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPP 802
            + L+AHN  RA H +  L     L + A+A+AE L +     HS+++  +GENL      +RE     G   T++WY E+K Y F        K+G+  ++VW+ +++ G GRA S  G  V+V  Y PP
Sbjct:   32 DLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTS--HGENLYYRPLGAREQ--APGKEVTEHWYSEVKHYDFSSPGYK-PKVGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDPP 156          

HSP 2 Score: 67.3958 bits (163), Expect = 1.064e-12
Identity = 45/144 (31.25%), Postives = 68/144 (47.22%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGEN-LASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGN--YIGHYKENVL 838
            + L  HNRLR +H +  L     L + A+A+A +LA++     S     +G+N +A ++      +  G   T  WY +   Y +          G+FSQ+VW+ +   G G A    G FV V  Y P GN  Y   Y++NVL
Sbjct:  224 DVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNTVAFAWVRYRMLITAGRKVTNCWYADRLAYDYNNPGFQQG-TGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVL 365          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002224.1 (pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002224.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 2.119e-12
Identity = 44/143 (30.77%), Postives = 63/143 (44.06%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGN--YIGHYKENVL 838
            + L  HNRLR +H +  L     L + A+A+A +LA++     S     +G+N      S           T  WY +   Y +          G+FSQ+VW+ +   G G A    G FV V  Y P GN  Y   Y++NVL
Sbjct:    1 DVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-RSHPTVPHGQNRCVRVGS-----IPRRKVTNCWYADRLAYDYNNPGFQQG-TGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVL 136          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: glipr2l (GLI pathogenesis-related 2, like [Source:ZFIN;Acc:ZDB-GENE-041010-53])

HSP 1 Score: 56.225 bits (134), Expect = 2.213e-10
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  398 SKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSES--NGQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKF 667
            SK    E L AHN  R  H    L++  ++ + AQ+YAE LA+T    HS     GQ GENLA +SY+     V       + WY EI++Y F
Sbjct:    6 SKEFARELLNAHNDYRKTHGVATLSLSSKMCREAQSYAESLARTRVLKHSSDTERGQCGENLAWASYDEPAKEV------AERWYAEIQNYNF 92          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.037e-7
Identity = 45/169 (26.63%), Postives = 71/169 (42.01%), Query Frame = 2
Query:  431 HNRLRALHHSPK-----LTIDWELAKSAQAYAEKLAKTNTFSHSESN--GQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSK---------IGHFSQVVWKGTKTAGFGRAQSSSGN---------FVIVGQYKPPGNYIGH--YKENVLSATGPP 856
            HNRLRA  H        ++ DWELA  A+A+    AK   + H  S+     G+NLA    S     +      Q W+DE + Y++ EE + + +           H++Q+VW  ++  G         +           +V  Y P GN+IG   Y++    +  PP
Sbjct:   13 HNRLRASVHPQAADMEHMSWDWELAGMAEAW----AKQCKWGHGPSDQLDAIGQNLAVYVGSERPLAYH----VQAWFDEEEWYQYPEEKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPP 173          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 87.8113 bits (216), Expect = 5.624e-20
Identity = 59/141 (41.84%), Postives = 74/141 (52.48%), Query Frame = 2
Query:  422 LQAHNRLRALH-HSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFG--RAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
            L  HN+ RALH  +P L+    LA  AQ YA+    + T +HS   G YGENLA  Y+        G AA   WY+EI +Y F      +S  GHF+QVVWK T   G G      + G++VI   Y P GNY G Y +NV
Sbjct:  167 LAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHS--GGPYGENLALGYD--------GPAAVDAWYNEISNYDF-SNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVIC-SYDPAGNYEGEYADNV 295          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 87.4261 bits (215), Expect = 4.264e-19
Identity = 63/166 (37.95%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  371 MGGCSTKPKSKS----LNEEALQAHNRLRALH-HSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYK-----FGEETQNNSKIGHFSQVVWKGTKTAGFG-RAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
            + GC    K+++       + L  HN+ RALH  +  LT    LA  AQ YA++   +   +HS+  G YGENLA       GY  TGA     WY EI  Y      F E T      GHF+QVVWK T   G G +   ++ N  IV  Y PPGNY+G + E V
Sbjct:    9 LLGCLVAVKAQTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSD--GPYGENLA------LGYTDTGAV--DAWYGEISKYNYSNPGFSEST------GHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEV 158          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 75.485 bits (184), Expect = 1.271e-15
Identity = 55/139 (39.57%), Postives = 69/139 (49.64%), Query Frame = 2
Query:  431 HNRLRALH-HSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSS--GNFVIVGQYKPPGNYIGHYKENVL 838
            HN  RALH  +  LT    LA  AQ YA+    +    HS   G YGENLA       GY  TG+     WY+EI  Y +     + S  GHF+QVVWKGT   G G        G+++I   YK  GN IG + +NV+
Sbjct:  200 HNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHS--GGPYGENLA------LGYGTTGSV--DAWYNEITSYDYSNPGFSESA-GHFTQVVWKGTSEVGCGLKSCGGEWGDYIIC-SYKAAGNVIGEFADNVM 326          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO34555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP06])

HSP 1 Score: 109.383 bits (272), Expect = 5.237e-29
Identity = 58/143 (40.56%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
               +  + HN  R  H + +L    +LA  A  +AE LA TN   HS    + GENLA +     GY   G  A + WYDE+KDY F E    N+K GHF+Q+VW+GTK  G  +  S+ G   +V +Y PPGN +G +KEN+
Sbjct:    1 FERDCFRQHNIYRHQHRACRLLWSADLASDAAEWAEHLASTNRLEHSPQK-ECGENLACA----GGYDLRGDKAAEMWYDEVKDYNF-ETLAYNAKCGHFTQLVWRGTKEIGVAKRVSADGTQFVVARYHPPGNVLGEFKENI 137          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO35383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP0])

HSP 1 Score: 107.457 bits (267), Expect = 3.520e-28
Identity = 60/147 (40.82%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  404 SLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHS--ESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVL 838
            S  ++ ++ HN LRA H +PK+T   +LAK AQA+A  +AK     HS  +S    GENL   + S  G +  G    + WY E+  YKFG+     S  GHF+QVVWKGTK      A+   G+  +VG+YKP GN +  + +NVL
Sbjct:    2 SFQKDCIEVHNELRAQHQAPKVTWSDQLAKDAQAWANHIAKNGRLEHSSPDSRPDQGENL---FMSSPGEINAGDVVDE-WYSEVSKYKFGKPGWQ-SGTGHFTQVVWKGTKEVAMASAEGPDGSVYVVGRYKPAGNVLTQFADNVL 143          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 106.686 bits (265), Expect = 7.340e-28
Identity = 62/140 (44.29%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  416 EALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
            + L+ HN  RA H +  L  +  LA  AQ++AE LA+ N   HS S  +YGE++A  Y S  G V TG  AT  WY E+  Y+F E    ++  GHF+QVVW G+   G G+A SSSG   +V +Y PPGN +G + ENV
Sbjct:    5 DILKTHNDYRAQHGTKALKWNARLASEAQSWAENLAQRNAIQHSSSR-EYGESIA--YMS--GAVLTGRKATDMWYGEVDKYRF-ENPGFSTSSGHFTQVVWAGSTEMGAGKATSSSGAHFVVARYTPPGNVMGQFPENV 138          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO45389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT35])

HSP 1 Score: 111.309 bits (277), Expect = 2.188e-27
Identity = 66/156 (42.31%), Postives = 91/156 (58.33%), Query Frame = 2
Query:  386 TKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEI--KDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVI---VGQYKPPGNYIGHYKENVL 838
            T PKS + +EEAL+AHNRLR +H  P +T+D EL+K AQA+AEK+AK    SH  + G  GEN   +    +    +  AA   WY+E+    Y FG E+   +  GHF+QVVWK +   GFG A+ +  NF     V +Y  PGNY   + +NV+
Sbjct:  199 TIPKSGA-DEEALKAHNRLRKVHGVPAMTLDKELSKKAQAWAEKIAKDGDGSHDNNRGNVGENWNIACRPEKK---SPTAAVVTWYNEVCKPGYTFGTESMGAA--GHFTQVVWKSSTKMGFGMAEGTFQNFPCVFSVARYDKPGNYANRFSKNVV 348          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Match: EDO48880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM7])

HSP 1 Score: 104.375 bits (259), Expect = 4.890e-27
Identity = 59/141 (41.84%), Postives = 81/141 (57.45%), Query Frame = 2
Query:  413 EEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
            +E L +HN  RA H +P L    +LA     +A+ LA+ NT  HS+  G+YGENLA +     GY  +G   T+ WYDEI+ Y+F      +S  GHF+QVVW G++  G  +A S +G    V +Y P GN IG + ENV
Sbjct:    7 KECLDSHNAYRAQHGAPPLKWSAKLASDCDKWAKDLARRNTMQHSK--GEYGENLAFA----SGYELSGGRTTEMWYDEIQKYRF-NNPGFSSGTGHFTQVVWVGSQEMGVAKAVSKNGAHYAVARYYPAGNVIGQFPENV 140          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000043877.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 107.071 bits (266), Expect = 2.023e-27
Identity = 66/155 (42.58%), Postives = 87/155 (56.13%), Query Frame = 2
Query:  380 CSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            CS     +   +E L AHN  RALH +P LT + EL   AQ +A+   +T+T  HS++  + GEN+     S    V TG  A   WY EIKDY F ++  + S  GHF+QVVWK +K  G G A      FV VGQY+PPGN+   G ++ NVL
Sbjct:    2 CSICFADEEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDT--EEGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNF-KKPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFV-VGQYRPPGNFTNPGQFEANVL 151          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000020413.2 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 103.99 bits (258), Expect = 1.950e-26
Identity = 64/149 (42.95%), Postives = 85/149 (57.05%), Query Frame = 2
Query:  398 SKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
             +   +E L AHN  RALH +P LT + EL   AQ +A+   +T+T  HS++  + GEN+     S    V TG  A   WY EIKDY F ++  + S  GHF+QVVWK +K  G G A      FV VGQY+PPGN+   G ++ NVL
Sbjct:    3 DEEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDT--EEGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNF-KKPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFV-VGQYRPPGNFTNPGQFEANVL 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028427.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 103.99 bits (258), Expect = 1.950e-26
Identity = 64/149 (42.95%), Postives = 85/149 (57.05%), Query Frame = 2
Query:  398 SKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
             +   +E L AHN  RALH +P LT + EL   AQ +A+   +T+T  HS++  + GEN+     S    V TG  A   WY EIKDY F ++  + S  GHF+QVVWK +K  G G A      FV VGQY+PPGN+   G ++ NVL
Sbjct:    3 DEEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDT--EEGENVFYKSGSPPVKV-TGKDAVDAWYSEIKDYNF-KKPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFV-VGQYRPPGNFTNPGQFEANVL 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:101165836])

HSP 1 Score: 103.219 bits (256), Expect = 5.092e-26
Identity = 63/157 (40.13%), Postives = 86/157 (54.78%), Query Frame = 2
Query:  389 KPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESN--GQYGENLA-SSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVLSA 844
            K  SK  +EE L+ HN  R  H +P+L +  +L+  A  YAE LA      HSE++  G  GENLA +SY+       TG   T  WY+E+K Y F       +  GHF+ +VWK TK  G G+A +S G+  +V +Y P GN    GH++ NVL A
Sbjct:    3 KSASKQFSEELLRCHNEYRKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARGSCGENLAWASYDQ------TGKDVTDRWYEEVKQYNF-SRPGFTTGTGHFTAMVWKNTKKLGVGKAVASDGSSFVVARYFPAGNITNQGHFENNVLPA 152          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031186.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101165896])

HSP 1 Score: 98.5969 bits (244), Expect = 2.084e-24
Identity = 60/148 (40.54%), Postives = 83/148 (56.08%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYI--GHYKENVL 838
            +   +E L+ HN  RALH +P LT + ++   AQ +A++  + +T  HSE+    GEN+     S    + TG  A   WY EIKDY F ++    S  GHF+QVVWK +K  G G A      FV VGQY+PPGN+   G ++ NVL
Sbjct:    4 RKFQQEFLETHNAYRALHGAPPLTYNSKMCGEAQKWADECLRIHTLGHSETKD--GENVFFKSGSPSVSI-TGKDAVDAWYSEIKDYNF-KKPGFKSGTGHFTQVVWKESKELGLGMATDGRMAFV-VGQYRPPGNFSNPGQFEANVL 146          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 442.58 bits (1137), Expect = 7.004e-157
Identity = 262/263 (99.62%), Postives = 262/263 (99.62%), Query Frame = 2
Query:  371 MGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNXXXXXXXXXXXXFLCCPMGXXXXXXXXXXXXXASNIKPVIGPKHKDDQMIXXXXXXXXXXXXXXXXXXXXYQTPNGETYERTKVTEGK 1159
            MGGCSTK KSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK
Sbjct:    1 MGGCSTKHKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK 263          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 414.461 bits (1064), Expect = 8.581e-146
Identity = 247/251 (98.41%), Postives = 248/251 (98.80%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNXXXXXXXXXXXXFLCCPMGXXXXXXXXXXXXXASNIKPVIGPKHKDDQMIXXXXXXXXXXXXXXXXXXXXYQTPNGETYERTKVTEGK 1159
            LN EAL+ HN LRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK
Sbjct:    8 LNNEALEKHNELRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK 258          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063568.1 (SMESG000063568.1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.067e-144
Identity = 244/253 (96.44%), Postives = 249/253 (98.42%), Query Frame = 2
Query:  401 KSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNXXXXXXXXXXXXFLCCPMGXXXXXXXXXXXXXASNIKPVIGPKHKDDQMIXXXXXXXXXXXXXXXXXXXXYQTPNGETYERTKVTEGK 1159
            + +NE ++  HN+LRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK
Sbjct:    8 QDVNESSINMHNKLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSPKSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPNGETYERTKVTEGK 260          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000063559.1 (SMESG000063559.1)

HSP 1 Score: 244.202 bits (622), Expect = 3.621e-79
Identity = 141/248 (56.85%), Postives = 169/248 (68.15%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENVLSATGPPPKREEPTFDVNQNXXXXXXXXXXXXFLCCPMGXXXXXXXXXXXXXASNIKPVIGPKHKDDQMIXXXXXXXXXXXXXXXXXXXXYQTPNGETYERTKVT 1150
            +NE AL+ HN+LRALH  P LTIDW LAK+AQ YAEKLAKTN+F HS+S G+YGENLASS+NS+ GYVF+G AATQNWYDEIKDYKF +ETQ N KIGHFSQVVWK TK AGFGRA+S++GNF+IVGQYKP GN++G +KEN+ S  G PPK  E       +   K            P+           S S S      G K KDDQ+IK++TK  T NGK  VE  +T+  P+G+TYE T  T
Sbjct:   10 VNESALKHHNKLRALHRVPNLTIDWNLAKTAQEYAEKLAKTNSFCHSKSEGKYGENLASSFNSKPGYVFSGEAATQNWYDEIKDYKFNQETQQNEKIGHFSQVVWKDTKAAGFGRAKSTNGNFIIVGQYKPAGNFLGKFKENIPSPIGAPPKLTEEKKSAASDPIPK----------STPVKTSRPVSSKPVSVSKS-----AGQKSKDDQLIKTTTKKSTINGKVSVETIQTFAKPDGKTYEVTTKT 242          
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Match: SMESG000070848.1 (SMESG000070848.1)

HSP 1 Score: 128.642 bits (322), Expect = 7.508e-35
Identity = 65/143 (45.45%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  407 LNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKLAKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFGEETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGHYKENV 835
             N E L+ HN LR LH++P +TI+  L   AQ +A  +A+T    HS+S+G+YGEN+ASS          G   T  WY EI DY F +E QN +K GHFSQVVWK +   GFG  +S++G +    +Y PPGN +G Y E+V
Sbjct:    7 FNTEGLETHNELRRLHNAPDMTINDLLMSDAQDWARHMAETMKLEHSKSDGKYGENIASSSKK-----LNGQEVTLMWYREIFDYNFNDEKQNLAKTGHFSQVVWKSSLEIGFGLEKSTNGMWYYCSRYLPPGNCVGKYLEHV 144          
The following BLAST results are available for this feature:
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR21.044e-2641.46GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
GLIPR23.924e-1835.76GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
CRISP21.092e-1031.76cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP21.092e-1031.76cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP23.809e-931.03cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C07A4.33.995e-1331.91pep chromosome:WBcel235:X:10174985:10175896:1 gene... [more]
F57B7.25.901e-1234.72pep chromosome:WBcel235:V:11441925:11443484:-1 gen... [more]
F57B7.28.043e-1235.11pep chromosome:WBcel235:V:11441925:11443603:-1 gen... [more]
F09B9.53.296e-1028.42pep chromosome:WBcel235:X:10154821:10156856:1 gene... [more]
scl-12.921e-932.34SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG314826.276e-3043.59gene:FBgn0051482 transcript:FBtr0081679[more]
CG42701.326e-2135.58gene:FBgn0031407 transcript:FBtr0077754[more]
CG169958.000e-1636.43gene:FBgn0031412 transcript:FBtr0077758[more]
CG340491.458e-1533.11gene:FBgn0054049 transcript:FBtr0302372[more]
CG42702.272e-1435.43gene:FBgn0031407 transcript:FBtr0077755[more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR855258.21.071e-2746.21pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33040981:33... [more]
glipr2l5.246e-2741.10GLI pathogenesis-related 2, like [Source:ZFIN;Acc:... [more]
CR855258.32.936e-2646.26pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
AL929549.24.659e-2646.21pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:3... [more]
im:71509889.108e-2642.57im:7150988 [Source:ZFIN;Acc:ZDB-GENE-050309-169][more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
echdc11.453e-3043.24ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;A... [more]
trappc34.903e-2438.18trafficking protein particle complex 3 [Source:Xen... [more]
trappc35.988e-2438.18trafficking protein particle complex 3 [Source:Xen... [more]
crispld24.198e-929.71cysteine-rich secretory protein LCCL domain contai... [more]
crispld24.901e-929.71cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr21.462e-2842.68GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Crisp35.656e-1435.53cysteine-rich secretory protein 3 [Source:MGI Symb... [more]
Crisp12.093e-1335.33cysteine-rich secretory protein 1 [Source:MGI Symb... [more]
Glipr21.624e-1240.70GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Pi161.377e-931.45peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CYL5|GAPR1_MOUSE1.023e-2742.68Golgi-associated plant pathogenesis-related protei... [more]
sp|Q9H4G4|GAPR1_HUMAN5.016e-2641.46Golgi-associated plant pathogenesis-related protei... [more]
sp|P08299|PR1A_TOBAC9.132e-2036.99Pathogenesis-related protein 1A OS=Nicotiana tabac... [more]
sp|P47032|PRY1_YEAST3.905e-1841.84Protein PRY1 OS=Saccharomyces cerevisiae (strain A... [more]
sp|P09042|PR1C_TOBAC7.070e-1837.50Pathogenesis-related protein 1C OS=Nicotiana tabac... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KNL79.868e-3950.32Golgi-associated plant pathogenesis-related protei... [more]
A0A068W9F93.145e-3854.17Venom allergen val protein OS=Echinococcus granulo... [more]
B3GUV19.795e-3851.28Golgi-associated plant pathogenesis-related protei... [more]
Q86EZ01.048e-3751.28Clone ZZD128 mRNA sequence OS=Schistosoma japonicu... [more]
A0A068Y9F87.348e-3652.08Venom allergen val protein OS=Echinococcus multilo... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000046499.18.203e-3146.71pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037136.12.901e-3046.36pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051775.14.735e-3045.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045529.12.196e-2944.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056153.13.508e-2945.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002231.12.152e-1532.90pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 ... [more]
ENSPMAT00000002228.12.400e-1534.62pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 ... [more]
ENSPMAT00000002224.12.119e-1230.77pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 ... [more]
glipr2l2.213e-1038.71GLI pathogenesis-related 2, like [Source:ZFIN;Acc:... [more]
ENSPMAT00000000374.11.037e-726.63pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY15.624e-2041.84Sterol binding protein involved in the export of a... [more]
PRY34.264e-1937.95Cell wall-associated protein involved in export of... [more]
PRY21.271e-1539.57Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345555.237e-2940.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353833.520e-2840.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488817.340e-2844.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453892.188e-2742.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488804.890e-2741.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043877.12.023e-2742.58Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000020413.21.950e-2642.95Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000028427.11.950e-2642.95Golgi-associated plant pathogenesis-related protei... [more]
glipr2l5.092e-2640.13GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000031186.12.084e-2440.54Golgi-associated plant pathogenesis-related protei... [more]
back to top
BLAST of Golgi-associated plant pathogenesis-related protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063568.17.004e-15799.62SMESG000063568.1[more]
SMESG000063568.18.581e-14698.41SMESG000063568.1[more]
SMESG000063568.11.067e-14496.44SMESG000063568.1[more]
SMESG000063559.13.621e-7956.85SMESG000063559.1[more]
SMESG000070848.17.508e-3545.45SMESG000070848.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034629 ID=SMED30034629|Name=Golgi-associated plant pathogenesis-related protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1192bp
AATAATAATAACAATAATAATAAATAATATTAATAATATTATCTTAGCAT
TAAATTTTTCAAATATTAAAAAACAGACATGAAAAATCTCGAATTGTTTT
TGTAAACTTTTAAAAAATTGTTTGTGCTAAATCCTTGAAAATTTTTAACT
ATTGATCTGTTATTAATTCTGTATTGATCTTTACGATATTTGGAGAGAGA
ATCAATCCTTGCGACCGCTTGTACTGATGTGATTCTTCCCATTTATCATT
AGCACACGGGAAATCTAATTCAAATGAGGTGATCGGGTGTTATGCGGTCA
TTTTCCTGTGTGTGCGTGATGCAGTTCACCTAATCGCTAATCATTTGATA
GGGCACTCTTGTGAACGACTATGGGAGGATGCAGCACCAAACCTAAAAGC
AAGTCTTTGAATGAAGAAGCTTTACAAGCTCATAATAGGCTTCGGGCACT
TCATCATTCTCCGAAATTAACCATCGACTGGGAGTTAGCAAAATCGGCTC
AGGCTTATGCTGAAAAACTCGCAAAAACTAATACATTTTCCCACTCAGAG
AGTAATGGGCAATATGGAGAAAATCTGGCATCGTCGTACAATTCTCGAGA
AGGATATGTTTTCACCGGAGCCGCTGCCACTCAGAACTGGTATGATGAAA
TAAAGGATTATAAATTCGGGGAGGAAACTCAAAATAATAGTAAAATTGGA
CATTTTAGTCAAGTGGTTTGGAAAGGCACGAAAACCGCAGGATTCGGTCG
AGCGCAATCAAGTTCAGGAAACTTTGTAATTGTTGGACAATACAAACCAC
CAGGAAATTATATTGGACATTATAAAGAAAATGTTCTATCAGCAACAGGA
CCACCTCCGAAAAGAGAAGAACCAACTTTTGATGTCAATCAAAACAAACC
CGACAAGGCTAAGAGTTCCCCGAAAAAGGCTTTTCTTTGTTGTCCAATGG
GCAAGAAATCAAAGTCTCCGAAATCTAGCCCGTCAAAATCAGCTTCGAAT
ATTAAACCCGTTATTGGGCCGAAACATAAAGATGATCAAATGATCAAAAG
TTCCACGAAAACAGTAACGACAAATGGAAAGAAAAAAGTCGAAGTCACTG
AGACATATCAAACGCCGAACGGTGAAACTTATGAGAGAACGAAGGTTACT
GAAGGTAAATAAAAAAACTGCAATTACTGCCACAGACAATAA
back to top

protein sequence of SMED30034629-orf-1

>SMED30034629-orf-1 ID=SMED30034629-orf-1|Name=SMED30034629-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MGGCSTKPKSKSLNEEALQAHNRLRALHHSPKLTIDWELAKSAQAYAEKL
AKTNTFSHSESNGQYGENLASSYNSREGYVFTGAAATQNWYDEIKDYKFG
EETQNNSKIGHFSQVVWKGTKTAGFGRAQSSSGNFVIVGQYKPPGNYIGH
YKENVLSATGPPPKREEPTFDVNQNKPDKAKSSPKKAFLCCPMGKKSKSP
KSSPSKSASNIKPVIGPKHKDDQMIKSSTKTVTTNGKKKVEVTETYQTPN
GETYERTKVTEGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR034113SCP_GAPR1-like
IPR001283CRISP-related
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 136..149
score: 45.71
coord: 109..125
score: 42.35
coord: 33..51
score: 34.9
coord: 86..99
score: 35.64
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 9..156
IPR014044CAP domainSMARTSM00198SCP_3coord: 12..149
e-value: 6.2E-34
score: 128.7
IPR014044CAP domainPFAMPF00188CAPcoord: 18..141
e-value: 2.3E-21
score: 76.9
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 6..159
e-value: 1.3E-42
score: 147.6
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 11..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..263
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 227..255
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..183
NoneNo IPR availablePANTHERPTHR10334:SF386GOLGI-ASSOCIATED PLANT PATHOGENESIS-RELATED PROTEIN 1coord: 9..156
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 110..120
IPR034113Golgi-associated plant pathogenesis-related protein 1, SCP domainCDDcd05382CAP_GAPR1-likecoord: 12..147
e-value: 1.40698E-58
score: 180.874