cytochrome c oxidase subunit III

Overview
Namecytochrome c oxidase subunit III (YP_008592431.1)
Smed IDSMED30034623
Length (bp)828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cytochrome c oxidase subunit III (SMED30034623) t-SNE clustered cells

Violin plots show distribution of expression levels for cytochrome c oxidase subunit III (SMED30034623) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cytochrome c oxidase subunit III (SMED30034623) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cytochrome c oxidase subunit III (SMED30034623) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034623

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30034623 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034623 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034623 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034623 dd_Smed_v4_258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034623 Contig38476uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30034623 Contig38476newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cytochrome c oxidase subunit III vs. Ensembl Human
Match: MT-CO3 (mitochondrially encoded cytochrome c oxidase III [Source:HGNC Symbol;Acc:HGNC:7422])

HSP 1 Score: 88.1965 bits (217), Expect = 4.798e-20
Identity = 101/266 (37.97%), Postives = 147/266 (55.26%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIV-VDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            H+V+ S WP   + + L++   L  + +F S     L L+    ++Y  + D+T ES   G  T  V  GL  G +LFI SEV FF GFF +++H+ L P+  +G  WPP    GI  ++P  +PLLNT +LL+SGV +T+ H+ ++ N           +R  +      T+  G+ F   Q SEY  S  +I   +YGS FF+ TGFHG HV++G   L++  +R     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    9 HMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPP---TGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMEN-----------NRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Celegans
Match: ctc-3 (Cytochrome c oxidase subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:P24891])

HSP 1 Score: 79.337 bits (194), Expect = 3.256e-17
Identity = 77/160 (48.12%), Postives = 99/160 (61.88%), Query Frame = 1
Query:  334 TWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGY 813
            TW P  F   +V+PFG+PLLNT++LLSSGV VT+ H+ +LSN      S T           YFT   GI     Q+ EY+ +  SI   V+GS+F+L TGFHG HV+ G + L+   LR+    F+   HLGLE +I YWHFVDVVWLFL+ FVYW+ Y
Sbjct:  111 TWSP--FGMHLVNPFGVPLLNTIILLSSGVTVTWAHHSLLSNK-----SCTNSMILTCLLAAYFT---GI-----QLMEYMEASFSIADGVFGSIFYLSTGFHGIHVLCGGLFLAFNFLRLLKNHFNYNHHLGLEFAILYWHFVDVVWLFLFVFVYWWSY 255          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Fly
Match: mt:CoIII (gene:FBgn0013676 transcript:FBtr0100868)

HSP 1 Score: 94.7449 bits (234), Expect = 1.123e-22
Identity = 106/266 (39.85%), Postives = 151/266 (56.77%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIVV-DPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            HLV  S WP   +   +  V  ++ + +      F L  I    +VY  + D++ E    G  T  V++GL  G +LFI SEV+FF  FF ++FH+ L+P++ +G +WPP    GI+  +PF +PLLNT +LL+SGV VT+ H+ ++ N           + +    G +FT+  GI F   Q  EYI +  +I  ++YGS FF+ TGFHG HV++G   L V LLR     FS   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:   10 HLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPM---GIISFNPFQIPLLNTAILLASGVTVTWAHHSLMEN-----------NHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWG 261          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Zebrafish
Match: mt-co3 (cytochrome c oxidase subunit III [Source:NCBI gene;Acc:140541])

HSP 1 Score: 82.8037 bits (203), Expect = 3.065e-18
Identity = 79/187 (42.25%), Postives = 106/187 (56.68%), Query Frame = 1
Query:  253 IRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            I SEV FF GFF +++H+ L P+  +G  WPP       +DPF +PLLNT +LL+SGV VT+ H+ ++              R         T+  G+ F + Q  EY  +  +I   VYGS FF+ TGFHG HV++G   L+V LLR     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:   87 ITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTGLT--TLDPFEVPLLNTAVLLASGVTVTWAHHSLMEG-----------ERKQAIQSLALTILLGLYFTALQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVLFHFTSDHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Xenopus
Match: chd6 (chromodomain helicase DNA binding protein 6 [Source:Xenbase;Acc:XB-GENE-5964535])

HSP 1 Score: 80.8777 bits (198), Expect = 2.489e-17
Identity = 103/266 (38.72%), Postives = 143/266 (53.76%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIV-VDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            H+V  S WP   + A L+L   L  + +F S     L LI    ++   + DI  E    G  T  V  GL  G +LFI SEV FF GFF +++++ L P+  +G  WPP    GI  ++PF +PLLNT +LL+SGV VT+ H+ ++             +R         T+  G+ F + Q  EY  +  +I   VYGS FF+ TGFHG HV++G + LSV  +R     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    9 HMVDPSPWPLTGAVAALLLTSGLAMWFHFGSLILLTLGLITMILTMIQWWRDIIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFIGFFWAFYNSSLAPTYELGECWPP---TGITPLNPFEVPLLNTAVLLASGVTVTWAHHSIMHG-----------NRKEAIQSLGLTILLGLYFTALQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSLFLSVCFIRQIQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Mouse
Match: mt-Co3 (mitochondrially encoded cytochrome c oxidase III [Source:MGI Symbol;Acc:MGI:102502])

HSP 1 Score: 85.5001 bits (210), Expect = 4.004e-19
Identity = 102/266 (38.35%), Postives = 146/266 (54.89%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIV-VDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            H+V  S WP   +++ L+L   L+ + ++ S     L L+    ++Y  + D+  E    G  T +V  GL  G +LFI SEV FF GFF +++H+ L P+  +G  WPP    GI  ++P  +PLLNT +LL+SGV +T+ H+ ++              R H+      T+  G+ F   Q SEY  +  SI   +YGS FF+ TGFHG HV++G   L V LLR     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    9 HMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPP---TGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEG-----------KRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWG 260          
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Match: sp|P48891|COX3_ALBCA (Cytochrome c oxidase subunit 3 OS=Albinaria caerulea OX=42349 GN=COIII PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.372e-22
Identity = 111/265 (41.89%), Postives = 149/265 (56.23%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            HLV  S WP + S +L  + + LI+Y+ F S Y     ++      Y  + DI  E+   G  T+ V  GL +G  LFI SEV FFF FF +YFH+ L PS+ +G+ WPP      V++ F +PLLNT +LL SGV +T+ H+ +    Y    S           G +FT+  G+ FL  Q  EY  +  SI   VYGS FF+ TGFHG HV++G + L V L+R  Y  FS   H+G   +  YWHFVDVVWLFLY  +YW+G
Sbjct:    7 HLVEYSPWPLLVSLSLTSMPLGLIYYIRFGSIYLLLYGMLLTSIIAYMWWRDIVREATYQGHHTTYVVKGLKLGMALFILSEVCFFFAFFWAYFHSSLAPSIEIGSVWPP--IGITVLNVFQVPLLNTSVLLLSGVSITWAHHALTEGKYYSTLS-----------GLFFTVLLGVYFLMLQYGEYNETSFSIADGVYGSTFFMATGFHGLHVMVGTLFLFVNLVRTYYYHFSTTHHVGFLAAAWYWHFVDVVWLFLYISIYWWG 258          
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Match: sp|P00417|COX3_DROME (Cytochrome c oxidase subunit 3 OS=Drosophila melanogaster OX=7227 GN=mt:CoIII PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.125e-21
Identity = 106/266 (39.85%), Postives = 151/266 (56.77%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIVV-DPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            HLV  S WP   +   +  V  ++ + +      F L  I    +VY  + D++ E    G  T  V++GL  G +LFI SEV+FF  FF ++FH+ L+P++ +G +WPP    GI+  +PF +PLLNT +LL+SGV VT+ H+ ++ N           + +    G +FT+  GI F   Q  EYI +  +I  ++YGS FF+ TGFHG HV++G   L V LLR     FS   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:   10 HLVDYSPWPLTGAIGAMTTVSGMVKWFHQYDISLFVLGNIITILTVYQWWRDVSREGTYQGLHTYAVTIGLRWGMILFILSEVLFFVSFFWAFFHSSLSPAIELGASWPPM---GIISFNPFQIPLLNTAILLASGVTVTWAHHSLMEN-----------NHSQTTQGLFFTVLLGIYFTILQAYEYIEAPFTIADSIYGSTFFMATGFHGIHVLIGTTFLLVCLLRHLNNHFSKNHHFGFEAAAWYWHFVDVVWLFLYITIYWWG 261          
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Match: sp|P26858|COX3_MARPO (Cytochrome c oxidase subunit 3 OS=Marchantia polymorpha OX=3197 GN=COX3 PE=3 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 3.086e-21
Identity = 83/188 (44.15%), Postives = 114/188 (60.64%), Query Frame = 1
Query:  253 IRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGI-VVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            I SEVMFF  FF ++FH+ L P+V +G  WPP    GI V+DP+G+P LNT++LLSSG  VT+ H+ +L+ +           +         T+F  ++F  FQ  EYI +  +I   +YGS FFL TGFHGFHV++G I L +  +R     F+   H G E +  YWHFVDVVWLFL+  +YW+G
Sbjct:   90 IVSEVMFFLAFFWAFFHSSLAPTVEIGAIWPP---KGISVLDPWGIPFLNTLILLSSGAAVTWAHHAILAGL-----------KQQAVYALIATVFLALVFTGFQGIEYIEAPFTISDGIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYLGHFTPKHHFGFEAAAFYWHFVDVVWLFLFVSIYWWG 263          
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Match: sp|O47491|COX3_METSE (Cytochrome c oxidase subunit 3 OS=Metridium senile OX=6116 GN=COIII PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 3.818e-21
Identity = 103/265 (38.87%), Postives = 150/265 (56.60%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            HLV  S WP+V +   L + +  + Y ++   +   +  I    ++   + D+  E+   G  T +V  GL  G LLFI SEV+FFF FF ++FH+ + P++ +G  WPP   N +  +PF +PLLNT +LLSSG  VT+ H+ ++S             +T    G   T+  G++F   Q  EY  +  +I  +VYGS FF+ TGFHG HV++G   L+V L R+ Y  F+   HLG E +  YWHFVDVVWLFLY  +YW+G
Sbjct:   10 HLVDPSPWPYVGACGALFITVGSVVYFHYSQTWVLLMGAITLSLTMIVWWRDVIREATFQGLHTMVVKQGLKYGMLLFILSEVLFFFSFFWAFFHSSIAPNIELGAVWPPQGINPL--NPFSVPLLNTAVLLSSGATVTWAHHALISG-----------KKTEAINGLTITVVLGLIFTGLQAMEYYEAPFAISDSVYGSTFFVATGFHGMHVIIGTTFLAVCLARLVYHQFTRHHHLGFEAASWYWHFVDVVWLFLYICIYWWG 261          
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Match: sp|P25003|COX3_PISOC (Cytochrome c oxidase subunit 3 OS=Pisaster ochraceus OX=7612 GN=COIII PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.908e-21
Identity = 111/266 (41.73%), Postives = 151/266 (56.77%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIV-VDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            HLV  S WP   + + L++   LI + +  S   F L  +    ++   + DI  E+   GF T  VS GL  G +LFI SEV  FF FF ++FH+ L P++ +G +WPP    GI  ++PF +PLLNT +LLSSGV VT+ H+ +LS            +R         T+F G+ F   Q  EY  S  +I  +VYGS FF+ TGFHG HV++G   L+V LLR+    FS+  H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    8 HLVDQSPWPLTGAISALMMTSGLILWFHINSTILFILGTVLLVLTIINWWRDIIREATFQGFHTLSVSNGLRYGMILFITSEVCLFFAFFWAFFHSSLAPTIELGVSWPP---TGITPINPFLVPLLNTAVLLSSGVTVTWAHHSILSG-----------NRVEAIQSLTLTVFLGVYFTILQAWEYFDSPFTIADSVYGSTFFVATGFHGLHVLIGTAFLAVCLLRLYNFHFSNHHHFGFEAASWYWHFVDVVWLFLYICIYWWG 259          
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Match: T1PUK4 (Cytochrome c oxidase subunit 3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX3 PE=3 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.057e-114
Identity = 263/274 (95.99%), Postives = 263/274 (95.99%), Query Frame = 1
Query:    1 YLYYFSCHLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESVDXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGTWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGYYIA 822
            YLYYFSCHLVRSSCWPFVTSYALLVLVISLIWYLNF SAYFF LALIFFFYSVYG FCDITTESVDGFTTSLVSLGLSVGFLLFI SEVMFFFGFF SYFHNCLNPSVFVGTWPPYLFNGIVVDPFGLPLLNTVLLLSSGV VTFCHYCVLSNVYLEL SPTRPSRTHLQ GYYFTLFYGILFLSFQISEYISSYISI STVYGSVFFLLTGFHGFHVVLGLILLSV LLRVDYTMFSDFQHLGLECSI YWHFVDVVWLFLYFFVYWYGYYIA
Sbjct:    1 YLYYFSCHLVRSSCWPFVTSYALLVLVISLIWYLNFSSAYFFWLALIFFFYSVYGWFCDITTESVDGFTTSLVSLGLSVGFLLFISSEVMFFFGFFWSYFHNCLNPSVFVGTWPPYLFNGIVVDPFGLPLLNTVLLLSSGVSVTFCHYCVLSNVYLELWSPTRPSRTHLQWGYYFTLFYGILFLSFQISEYISSYISINSTVYGSVFFLLTGFHGFHVVLGLILLSVSLLRVDYTMFSDFQHLGLECSIWYWHFVDVVWLFLYFFVYWYGYYIA 274          
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Match: A0A0B4VJT0 (Cytochrome c oxidase subunit 3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=COX3 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.524e-100
Identity = 249/266 (93.61%), Postives = 254/266 (95.49%), Query Frame = 1
Query:   25 LVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESVDXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGTWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGYYIA 822
            LVRSSCWPFVTSYALLVLV+SL+WYLNF SAYFF LALIFFFYSVYG  CDITTES+DGFTTSLVSLGLSVGFLLFI SEVMFFFGFF SYFHNCLNPSVF+GTWPPYLFNGIVVDPFGLPLLNTVLLLSSGV VTFCHYCVLSNVYLEL SPTRPSRTHLQ GYYFTLFYGILFLSFQISEY+SSYISI STVYGSVFFLLTGFHGFHVVLGLILLSV LLRVDYTMFSDFQHLGLECSI YWHFVDVVWLFLYFFVYWYGYYIA
Sbjct:    1 LVRSSCWPFVTSYALLVLVVSLLWYLNFSSAYFFWLALIFFFYSVYGWLCDITTESIDGFTTSLVSLGLSVGFLLFISSEVMFFFGFFWSYFHNCLNPSVFIGTWPPYLFNGIVVDPFGLPLLNTVLLLSSGVSVTFCHYCVLSNVYLELWSPTRPSRTHLQWGYYFTLFYGILFLSFQISEYVSSYISINSTVYGSVFFLLTGFHGFHVVLGLILLSVSLLRVDYTMFSDFQHLGLECSIWYWHFVDVVWLFLYFFVYWYGYYIA 266          
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Match: I1ZI96 (Cytochrome c oxidase subunit 3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 3.226e-81
Identity = 168/174 (96.55%), Postives = 168/174 (96.55%), Query Frame = 1
Query:  301 HNCLNPSVFVGTWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGYYIA 822
            HNCLNPSVFVGTWPPYLFNGIVVDPFGLPLLNTVLLLSSGV VTFCHYCVLSNVYLEL SPTRPSRTHLQ GYYFTLFYGILFLSFQISEYISSYISI STVYGSVFFLLTGFHGFHVVLGLILLSV LLRVDYTMFSDFQHLGLECSI YWHFVDVVWLFLYFFVYWYGYYIA
Sbjct:   12 HNCLNPSVFVGTWPPYLFNGIVVDPFGLPLLNTVLLLSSGVSVTFCHYCVLSNVYLELWSPTRPSRTHLQWGYYFTLFYGILFLSFQISEYISSYISINSTVYGSVFFLLTGFHGFHVVLGLILLSVSLLRVDYTMFSDFQHLGLECSIWYWHFVDVVWLFLYFFVYWYGYYIA 185          
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Match: A0A0F6Q2W5 (Cytochrome c oxidase subunit 3 (Fragment) OS=Stylochoplana maculata OX=1495083 GN=cox3 PE=3 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 9.818e-33
Identity = 127/265 (47.92%), Postives = 159/265 (60.00%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESVDXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGY 813
            HLV  S WP   S + L +    I++ +F +     L         +  F D+  E++ G+  S+V+ G   G +LFI SEVMFFF FF SYFHNC  P   +G  WPPY FN +V+DPF +PLLNTV+LLSSG  VT+ H+ ++S  Y            +   G + T   G  FL  Q +EY  S  SI STVYG+VFF+LTGFHGFHV +G ILL V  LR  Y  FS  QH+G E S  YWHFVDVVWLFLYFF+YWYG+
Sbjct:    6 HLVEVSPWPICASLSALGITFGSIYWWHFNNPNIVILGFALNILVAFCWFWDVIKENITGYHNSVVAWGFRFGMILFILSEVMFFFSFFWSYFHNCWGPQFELGYNWPPYGFNTVVIDPFSIPLLNTVILLSSGASVTWAHHSLVSQDY-----------DNGLIGLFLTAGLGAYFLFLQGNEYFLSPFSINSTVYGTVFFMLTGFHGFHVTIGTILLIVCFLRHFYVHFSSDQHVGFEASAWYWHFVDVVWLFLYFFIYWYGF 259          
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Match: A0A0N7HUP0 (Cytochrome c oxidase subunit 3 (Fragment) OS=Hoploplana elisabelloi (nomen nudum) OX=1714492 GN=cox3 PE=3 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.896e-33
Identity = 127/265 (47.92%), Postives = 163/265 (61.51%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESVDXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYGY 813
            HLV  S WP   S + L L    I++ ++ +       L+F     +  F D+  E++ G+  S+V  G   G +LFI SEV+FFF FF SYFHNC  P   +G +WPPY F+ +V+DPF +PLLNTV+LLSSG  VT+ H+ ++S  Y            +   G   T+F G  FL  Q +EY  S  SI STVYG+VFF+LTGFHGFHV +G ILL V LLR  +  FS  QH+G E S  YWHFVDVVWLFLYFF+YWYG+
Sbjct:    2 HLVEVSPWPLFASVSALGLTFGGIYWWHYNNTSIIIAGLLFNLLVSFCWFGDVIKENMGGYHNSVVMFGFRFGMILFILSEVLFFFSFFWSYFHNCWGPQAELGFSWPPYGFDNVVIDPFSIPLLNTVVLLSSGASVTWAHHALVSQKY-----------DNALLGLGITVFLGAYFLFLQGNEYFLSTFSINSTVYGTVFFMLTGFHGFHVTIGTILLLVCLLRHYFVHFSSNQHVGFEASAWYWHFVDVVWLFLYFFLYWYGF 255          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Sea Lamprey
Match: COX3 (cytochrome c oxidase subunit III [Source:NCBI gene;Acc:807805])

HSP 1 Score: 87.4261 bits (215), Expect = 1.233e-20
Identity = 106/265 (40.00%), Postives = 144/265 (54.34%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVG-TWPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            H+V  S WP   + A L++   L  + +  S     L LI    ++Y  + DI  E    G  TS V  GL  G +LFI SEV FF GFF +++H  L P+  +G TWPP   N +  +PF +PLLNT +LL+SGV VT+ H+ +           T  +RT        T+  G+ F + QI EY  +  ++   VYGS FF+ TGFHG HV++G + L   LLR     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    9 HMVDPSPWPLTGAGAALLMTSGLAMWFHKNSCILMTLGLILMLLTMYQWWRDIVREGTFLGHHTSPVQQGLRYGMILFIISEVCFFAGFFWAFYHASLAPTPELGLTWPPTGINPL--NPFEVPLLNTAVLLASGVSVTWAHHSI-----------TEKNRTETTQALTLTVLLGLYFTALQIMEYYETPFTMADGVYGSTFFVATGFHGLHVIIGSLFLLTCLLRHLQYHFTSKHHFGFEAAAWYWHFVDVVWLFLYISIYWWG 260          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Yeast
Match: COX3 (Subunit III of cytochrome c oxidase (Complex IV); Complex IV is the terminal member of the mitochondrial inner membrane electron transport chain; one of three mitochondrially-encoded subunits [Source:SGD;Acc:S000007283])

HSP 1 Score: 64.6994 bits (156), Expect = 1.117e-12
Identity = 69/187 (36.90%), Postives = 103/187 (55.08%), Query Frame = 1
Query:  253 IRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIVVDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            + SEV+ F G F +YFH+ ++P V +G  WPP       V P  LPLLNT++LLSSG  VT+ H+ +++            +R     G   T +  ++F++ Q  EY ++  +I   VYGSVF+  TG H  H+V+   +L V   R+     +   H+G E +I Y H +DV+WLFLY   YW+G
Sbjct:   95 VLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEA--VQPTELPLLNTIILLSSGATVTYSHHALIAG-----------NRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWG 268          
BLAST of cytochrome c oxidase subunit III vs. Ensembl Medaka
Match: COX3 (cytochrome c oxidase subunit III [Source:NCBI gene;Acc:805437])

HSP 1 Score: 85.1149 bits (209), Expect = 3.254e-19
Identity = 105/266 (39.47%), Postives = 141/266 (53.01%), Query Frame = 1
Query:   22 HLVRSSCWPFVTSYALLVLVISLIWYLNFRXXXXXXXXXXXXXXXVYG*FCDITTESV-DXXXXXXXXXXXXXXXXXXIRSEVMXXXXXXXXXXHNCLNPSVFVGT-WPPYLFNGIV-VDPFGXXXXXXXXXXSSGVRVTFCHYCVLSNVYLEL*SPTRPSRTHLQ*GYYFTLFYGILFLSFQXXXXXXXXXXXKSTVYGSVFFLLTGFHGFHXXXXXXXXXXXXXXXDYTMFSDFQHLGLECSI*YWHFVDVVWLFLYFFVYWYG 810
            H+V  S WP   + A L+L      +++F S     L L+    ++Y  + DI  E    G  T  V  GL  G +LFI SEV FF GFF +++H+ L P+  +G  WPP    GI  +DPF +PLLNT +LL+SGV VT+ H+ ++              R         T+  G  F   Q  EY  +  +I   VYGS FF+ TGFHG HV++G   L+V LLR     F+   H G E +  YWHFVDVVWLFLY  +YW+G
Sbjct:    9 HMVDPSPWPLTGAVAALLLTSGTAIWMHFNSLVLMTLGLVLLLLTMYQWWRDIIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPP---TGITTLDPFEVPLLNTAVLLASGVTVTWAHHSIMEG-----------QRKQAIQSLTLTILLGFYFTFLQAMEYFEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVQFHFTSEHHFGFEAAAWYWHFVDVVWLFLYISIYWWG 260          
The following BLAST results are available for this feature:
BLAST of cytochrome c oxidase subunit III vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MT-CO34.798e-2037.97mitochondrially encoded cytochrome c oxidase III [... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ctc-33.256e-1748.13Cytochrome c oxidase subunit 3 [Source:UniProtKB/... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt:CoIII1.123e-2239.85gene:FBgn0013676 transcript:FBtr0100868[more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-co33.065e-1842.25cytochrome c oxidase subunit III [Source:NCBI gene... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chd62.489e-1738.72chromodomain helicase DNA binding protein 6 [Sourc... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mt-Co34.004e-1938.35mitochondrially encoded cytochrome c oxidase III [... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48891|COX3_ALBCA1.372e-2241.89Cytochrome c oxidase subunit 3 OS=Albinaria caerul... [more]
sp|P00417|COX3_DROME1.125e-2139.85Cytochrome c oxidase subunit 3 OS=Drosophila melan... [more]
sp|P26858|COX3_MARPO3.086e-2144.15Cytochrome c oxidase subunit 3 OS=Marchantia polym... [more]
sp|O47491|COX3_METSE3.818e-2138.87Cytochrome c oxidase subunit 3 OS=Metridium senile... [more]
sp|P25003|COX3_PISOC4.908e-2141.73Cytochrome c oxidase subunit 3 OS=Pisaster ochrace... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1PUK42.057e-11495.99Cytochrome c oxidase subunit 3 (Fragment) OS=Schmi... [more]
A0A0B4VJT01.524e-10093.61Cytochrome c oxidase subunit 3 (Fragment) OS=Schmi... [more]
I1ZI963.226e-8196.55Cytochrome c oxidase subunit 3 OS=Schmidtea medite... [more]
A0A0F6Q2W59.818e-3347.92Cytochrome c oxidase subunit 3 (Fragment) OS=Stylo... [more]
A0A0N7HUP09.896e-3347.92Cytochrome c oxidase subunit 3 (Fragment) OS=Hoplo... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX31.233e-2040.00cytochrome c oxidase subunit III [Source:NCBI gene... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COX31.117e-1236.90Subunit III of cytochrome c oxidase (Complex IV); ... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cytochrome c oxidase subunit III vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
COX33.254e-1939.47cytochrome c oxidase subunit III [Source:NCBI gene... [more]
back to top
BLAST of cytochrome c oxidase subunit III vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30034623
GenBankYP_008592431.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034623 ID=SMED30034623|Name=cytochrome c oxidase subunit III|organism=Schmidtea mediterranea sexual|type=transcript|length=828bp
tatctgtattattttagttgtcatttggttcgtagtagttgttggccttt
tgttacttcttatgctttattagttttggttatttcgttgatttggtatt
taaattttagatctgcttattttttttgattggctttgattttctttttt
tattctgtgtatggttgattttgtgatattactacggagtctgttgatgg
ttttactactagtttggttagtttgggtttgagtgtaggctttttgttgt
ttattaggtctgaagttatgtttttttttggtttcttttgaagttatttt
cataattgtttgaatcctagtgttttcgtaggtacttggcctccatactt
gtttaatggtatagtagtagatccatttggattgcctttgttaaatactg
ttttgcttttatcttctggtgttagagttacattttgtcattattgtgtc
cttagtaatgtttatttagagctttgaagtccaactcgtccatctcgcac
acatttacaatgaggttattattttactcttttttatggtattttgtttc
tttcttttcagattagtgagtatatatctagttatattagtataaaaagt
actgtttatgggagtgtgttctttttattgactggctttcatggctttca
tgtggttttgggtttaattcttttatcggttaggttgttacgtgttgatt
acactatgttttctgattttcaacacttaggtttggagtgttctatatga
tattggcattttgttgatgttgtttggttgtttttgtatttttttgttta
ttggtatggttattatattgcttgataa
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013833Cyt_c_oxidase_su3_a-hlx
IPR000298Cyt_c_oxidase_su3_dom
Vocabulary: biological process
TermDefinition
GO:0022904respiratory electron transport chain
GO:0019646aerobic electron transport chain
GO:1902600hydrogen ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005739mitochondrion
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004129cytochrome-c oxidase activity
GO:0015002heme-copper terminal oxidase activity