Proteasome activator complex subunit 3

Overview
NameProteasome activator complex subunit 3
Smed IDSMED30034622
Length (bp)927
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proteasome activator complex subunit 3 (SMED30034622) t-SNE clustered cells

Violin plots show distribution of expression levels for Proteasome activator complex subunit 3 (SMED30034622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034622

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30034622h1SMcG0002069 Contig1900_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30034622h1SMcG0002069 Contig1900_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30034622h1SMcG0002069 Contig1900_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Match: PSME3 (proteasome activator subunit 3 [Source:HGNC Symbol;Acc:HGNC:9570])

HSP 1 Score: 107.457 bits (267), Expect = 1.589e-27
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:   53 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 191          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Match: PSME3 (proteasome activator subunit 3 [Source:HGNC Symbol;Acc:HGNC:9570])

HSP 1 Score: 106.301 bits (264), Expect = 4.294e-27
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:   48 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 186          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Match: PSME3 (proteasome activator subunit 3 [Source:HGNC Symbol;Acc:HGNC:9570])

HSP 1 Score: 106.301 bits (264), Expect = 1.510e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Match: PSME3 (proteasome activator subunit 3 [Source:HGNC Symbol;Acc:HGNC:9570])

HSP 1 Score: 105.916 bits (263), Expect = 2.873e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  120 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 258          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Match: PSME3 (proteasome activator subunit 3 [Source:HGNC Symbol;Acc:HGNC:9570])

HSP 1 Score: 99.3673 bits (246), Expect = 7.481e-24
Identity = 51/152 (33.55%), Postives = 89/152 (58.55%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRA----------LLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  +              + +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTPSGKGPHICFDLQVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 260          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Celegans
Match: Y66D12A.9 (pep chromosome:WBcel235:III:11568137:11573343:1 gene:WBGene00013435.1 transcript:Y66D12A.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y66D12A.9)

HSP 1 Score: 109.768 bits (273), Expect = 2.462e-28
Identity = 65/217 (29.95%), Postives = 116/217 (53.46%), Query Frame = 1
Query:  148 EIPQKILFINKLIRSEQFHPENLITELKAKNKKEMRFLKNAIIKARQNNRQADLXXXXXXXXVENPE-SPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            E P+K++  + L++S +   + L   L  K+      L   I  A      +D  +       E P+ +PI    S T+  N+ L  +M +V+P + + +     + +WI L +P I DGNNFGV +QEE +  + ++ES+  + LD  + YF  RGK++ K+ K+ +V D+ +AI + DE  +  +R  +  ++NH+ ++ ++ +KN  KI VPR 
Sbjct:   31 EFPKKVIEFDALLKSPKLSYDRLAEILPDKS------LNIPIPDALNGTTDSDEPAVKRQRVDEKPKGAPIFAFSSGTVPCNENLAQLMDLVRPKLRDAVEQCNNVKMWITLLIPRIEDGNNFGVGIQEETLSEVRNVESEAASFLDQMSRYFTTRGKLITKIAKYPHVDDYRRAILDMDEKQFINIRLVVLEMRNHFSTLHDMIMKNYEKIKVPRT 241          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Fly
Match: REG (gene:FBgn0029133 transcript:FBtr0310646)

HSP 1 Score: 103.219 bits (256), Expect = 1.049e-25
Identity = 47/140 (33.57%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  376 TIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            T+  NK L  ++ VVKP++ + + D   L +WI   +P+I DGNNFGV++QE+ +  + ++ES+     D  + YF  R K++ K+ K+ ++ D+ +A+ E DE  Y  L   +  ++N Y S+ ++ +KN+ K+  PR+
Sbjct:   99 TVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRS 238          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Fly
Match: REG (gene:FBgn0029133 transcript:FBtr0073730)

HSP 1 Score: 103.219 bits (256), Expect = 1.049e-25
Identity = 47/140 (33.57%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  376 TIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            T+  NK L  ++ VVKP++ + + D   L +WI   +P+I DGNNFGV++QE+ +  + ++ES+     D  + YF  R K++ K+ K+ ++ D+ +A+ E DE  Y  L   +  ++N Y S+ ++ +KN+ K+  PR+
Sbjct:   99 TVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRS 238          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Match: psme3 (proteasome activator subunit 3 [Source:ZFIN;Acc:ZDB-GENE-991110-19])

HSP 1 Score: 98.5969 bits (244), Expect = 9.382e-24
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  111 MKSNGKLVELIEKVKPEIRTLMEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASFLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 249          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Match: psme3 (proteasome activator subunit 3 [Source:ZFIN;Acc:ZDB-GENE-991110-19])

HSP 1 Score: 98.5969 bits (244), Expect = 9.382e-24
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  111 MKSNGKLVELIEKVKPEIRTLMEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASFLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 249          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Match: psme3 (proteasome activator subunit 3 [Source:ZFIN;Acc:ZDB-GENE-991110-19])

HSP 1 Score: 98.5969 bits (244), Expect = 1.181e-23
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  123 MKSNGKLVELIEKVKPEIRTLMEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASFLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 261          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Match: psme2 (proteasome activator subunit 2 [Source:ZFIN;Acc:ZDB-GENE-991110-16])

HSP 1 Score: 84.3445 bits (207), Expect = 1.201e-18
Identity = 43/149 (28.86%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            I+ N+ ++ ++ +VKP ++        +  WI   +P+I DGN+FGVA+QE+++  + ++++++         YF++RG  + K  K ++V D+   + E DE+ Y ++R  + +I+  Y  + +V  KN+ K+T P+ E+     SMY
Sbjct:   99 IKGNERIVKLLDIVKPEIMGLKETCITVSCWIAHLIPKIEDGNDFGVAIQEKILERITAVKTKVEGFQTNINKYFSERGDAVAKASKDTHVMDYRSLVHEKDEAAYSEIRVIVLDIRGFYAELYDVISKNLEKVTNPKGEEK---PSMY 244          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Match: psme1 (proteasome activator subunit 1 [Source:ZFIN;Acc:ZDB-GENE-991110-17])

HSP 1 Score: 84.3445 bits (207), Expect = 1.229e-18
Identity = 55/150 (36.67%), Postives = 85/150 (56.67%), Query Frame = 1
Query:  358 PMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNS 807
            P+  +ET++  KL+  I   ++ L  E L+ V    +WIQL+VP I DGNNFGVAVQE+V   + +  ++I       + Y+++RG  + K  K  +V DF Q + E D+  Y +LR  +  I+N Y  + +V  KN  KI  PR + +S
Sbjct:   95 PIACNETVE--KLIKQIKPEIQTLK-ECLNTVS---MWIQLQVPRIEDGNNFGVAVQEKVFELMTNTRTKIEGFQTQISKYYSERGDAVAKASKQPHVGDFRQLVHELDQHQYCELRIIVLEIRNTYAMLYDVITKNFDKIKKPRGDLSS 238          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Match: lctl (lactase like [Source:Xenbase;Acc:XB-GENE-991435])

HSP 1 Score: 106.301 bits (264), Expect = 1.582e-26
Identity = 52/142 (36.62%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNAQLVEIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Match: lctl (lactase like [Source:Xenbase;Acc:XB-GENE-991435])

HSP 1 Score: 105.916 bits (263), Expect = 1.704e-26
Identity = 52/142 (36.62%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:   99 LKSNAQLVEIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 237          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Match: lctl (lactase like [Source:Xenbase;Acc:XB-GENE-991435])

HSP 1 Score: 105.916 bits (263), Expect = 1.906e-26
Identity = 52/142 (36.62%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:   97 LKSNAQLVEIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 235          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Match: lctl (lactase like [Source:Xenbase;Acc:XB-GENE-991435])

HSP 1 Score: 105.916 bits (263), Expect = 2.004e-26
Identity = 52/142 (36.62%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  106 LKSNAQLVEIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 244          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Match: lctl (lactase like [Source:Xenbase;Acc:XB-GENE-991435])

HSP 1 Score: 105.531 bits (262), Expect = 2.358e-26
Identity = 52/142 (36.62%), Postives = 89/142 (62.68%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  102 LKSNAQLVEIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 240          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Match: Psme3 (proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) [Source:MGI Symbol;Acc:MGI:1096366])

HSP 1 Score: 106.301 bits (264), Expect = 1.037e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Match: Psme1 (proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [Source:MGI Symbol;Acc:MGI:1096367])

HSP 1 Score: 87.8113 bits (216), Expect = 7.626e-20
Identity = 44/142 (30.99%), Postives = 82/142 (57.75%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLI 813
            N+ ++ ++  +KP + +    +  +  W+QL++P I DGNNFGVAVQE+V   + ++ +++       + YF++RG  + K  K  +V D+ Q + E DE+ Y ++R  +  I+N Y  + ++ +KN  K+  PR E   +I
Sbjct:  107 NEKIVVLLQRLKPEIKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSERGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMI 248          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Match: Psme1 (proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [Source:MGI Symbol;Acc:MGI:1096367])

HSP 1 Score: 80.1073 bits (196), Expect = 3.511e-17
Identity = 45/142 (31.69%), Postives = 77/142 (54.23%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLI 813
            N+ ++ ++  +KP + +    +  +  W+QL++P I DGNNFGVAVQ      L    +QI       + YF++RG  + K  K  +V D+ Q + E DE+ Y ++R  +  I+N Y  + ++ +KN  K+  PR E   +I
Sbjct:  107 NEKIVVLLQRLKPEIKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQ------LEGFHTQI-------SKYFSERGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMI 235          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Match: Psme1 (proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) [Source:MGI Symbol;Acc:MGI:1096367])

HSP 1 Score: 79.7221 bits (195), Expect = 5.633e-17
Identity = 40/131 (30.53%), Postives = 77/131 (58.78%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKI 780
            N+ ++ ++  +KP + +    +  +  W+QL++P I DGNNFGVAVQE+V   + ++ +++       + YF++RG  + K  K  +V D+ Q + E DE+ Y ++R  +  I+N Y  + ++ +KN  K+
Sbjct:  107 NEKIVVLLQRLKPEIKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSERGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKL 237          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Match: Psme2 (proteasome (prosome, macropain) activator subunit 2 (PA28 beta) [Source:MGI Symbol;Acc:MGI:1096365])

HSP 1 Score: 77.7962 bits (190), Expect = 2.001e-16
Identity = 38/122 (31.15%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  460 LLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            ++ WIQ  +P+I DGN+FGVA+QE+V+  + ++++++       + YF++RG  + K  K ++V D+   + E DE+ Y  LR  + +++  Y  + ++   N+ KI  P+ E+     SMY
Sbjct:  113 VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKDTHVMDYRALVHERDEAAYGALRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEK---PSMY 231          
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Match: sp|P61291|PSME3_PIG (Proteasome activator complex subunit 3 OS=Sus scrofa OX=9823 GN=PSME3 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.251e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Match: sp|P61290|PSME3_MOUSE (Proteasome activator complex subunit 3 OS=Mus musculus OX=10090 GN=Psme3 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.251e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q4R4V3|PSME3_MACFA (Proteasome activator complex subunit 3 OS=Macaca fascicularis OX=9541 GN=PSME3 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.251e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Match: sp|P61289|PSME3_HUMAN (Proteasome activator complex subunit 3 OS=Homo sapiens OX=9606 GN=PSME3 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.251e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Match: sp|Q5RFD3|PSME3_PONAB (Proteasome activator complex subunit 3 OS=Pongo abelii OX=9601 GN=PSME3 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.327e-26
Identity = 52/142 (36.62%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKP---LMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N+ L+ I+  VKP   L+IE  + V+   +W+QL +P I DGNNFGV++QEE +  L ++ES+  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  109 LKSNQQLVDIIEKVKPEIRLLIEKCNTVK---MWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRS 247          
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Match: A0A0R3UIE4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7193 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.370e-29
Identity = 63/164 (38.41%), Postives = 102/164 (62.20%), Query Frame = 1
Query:  337 ENPESPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKN-SLISSMY 825
            E P   +P  ++E    N ++    ++VKPL+++   D + L +W+ L +P+I DGNNFGVAVQEEV+ +    E+ + + LD + DY   RGKI  K +K+  V  + +A+ E DE+ Y +LR TL++I+N+Y  + ++ +KNI KI  PR+E   S ++ MY
Sbjct:   67 EQPTGALPKSLAEA-STNPIISEAYNIVKPLLLQLGEDAQLLRMWVMLNIPKIEDGNNFGVAVQEEVMLDASRTETDVTSMLDFYCDYLVYRGKINTKRIKWPGVGAYAEALTELDETTYIRLRMTLQDIRNNYAHLYDLFMKNINKIRDPRHEGGMSAVNIMY 229          
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Match: A0A448X8S4 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS24466 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.870e-28
Identity = 56/146 (38.36%), Postives = 93/146 (63.70%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            N  +  +  +++P++++ + D + + +WIQL +P+I DGNNFGV+VQEEV+     IE++    LD F DY   R K++ K +K+S + D+ ++I E DE  + +LR TL + +N+Y  + ++  KN+ KI  PRN+  S IS MY
Sbjct:   79 NSAIDHVYRLLRPIIVQLIEDTQTVCMWIQLNIPKIEDGNNFGVSVQEEVLMEAHKIEAEASAMLDFFIDYTMLRAKLVSKTLKWSQICDYKRSIRELDEITFLRLRATLCDSRNYYTRLYDLLTKNVEKIRCPRNDSESQISIMY 224          
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Match: A0A0R3SQT0 (PA28_beta domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7458 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.580e-28
Identity = 59/149 (39.60%), Postives = 91/149 (61.07%), Query Frame = 1
Query:  349 SPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            S IP    E +  N  +I     VKP +++   D + L +W+ L +P+I DGNNFGV+VQEEV+ +    ES +   LD ++DY   RGKI  K++K+  V+ F  A+ E DE  + ++R TL++I+N+Y  + ++C KNI KI  PR+
Sbjct:   70 SKIPYSSIE-VASNSSVIEAYDTVKPFLLQLGEDAQLLRIWVALNIPKIEDGNNFGVSVQEEVMLDASKTESDVATILDFYSDYLLTRGKISTKIIKWPGVKAFTDALIELDEMTFVRIRMTLQDIRNNYARLYDLCTKNINKILNPRS 217          
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Match: A0A0R3TQZ6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9976 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 8.206e-28
Identity = 58/153 (37.91%), Postives = 93/153 (60.78%), Query Frame = 1
Query:  370 SETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKN-SLISSMY 825
            S+ I  N  +    + +KP +++   D + L +W+ L +P+I DGNNFGV+VQEEVI +    ES +  +LD ++DY   RGKI  K++K+  VR +  A+ E DE  Y +++ TL++I+N Y  + ++  KNI KI  PR+      ++SMY
Sbjct:   76 SKEITSNPTVTDAYNTIKPFLLQLNDDAQLLRMWVTLNIPKIEDGNNFGVSVQEEVILDASKTESDVVTNLDFYSDYLLTRGKISSKIIKWPGVRSYTDALIELDEMAYVRMKMTLQDIRNDYARLYDLYTKNIDKILNPRSSTGLEALNSMY 228          
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Match: A0A5J4NSK3 (Proteasome activator subunit 3 (PA28 gamma) OS=Paragonimus westermani OX=34504 GN=DEA37_0010393 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.023e-27
Identity = 55/146 (37.67%), Postives = 87/146 (59.59%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            N+++    + V+P +++ + D + L +WIQL +P I DGNNFGV+VQEEVI      E      LD F DY   R K+  K+ K+  + D+ +A+ + DE  + +LR   ++I+NHY  + ++  KN +K+  PRNE N  I+ MY
Sbjct:   83 NEIMEEAYTAVRPFVLQLIEDTQILRMWIQLSIPRIEDGNNFGVSVQEEVIMETAKAELDASAMLDFFGDYLMYRAKVASKVCKWPTITDYRRALTDADEGAFIRLRMNARDIRNHYSRLYDIYHKNALKLRSPRNETNGQINIMY 228          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Match: psme3 (proteasome activator subunit 3 [Source:NCBI gene;Acc:103031453])

HSP 1 Score: 98.2117 bits (243), Expect = 7.593e-24
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  102 MKSNGKLVDLIEKVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASYLDQISRYYITRAKLVSKVAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 240          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Match: psme3 (proteasome activator subunit 3 [Source:NCBI gene;Acc:103031453])

HSP 1 Score: 98.5969 bits (244), Expect = 7.790e-24
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  111 MKSNGKLVDLIEKVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASYLDQISRYYITRAKLVSKVAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 249          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Match: psme3 (proteasome activator subunit 3 [Source:NCBI gene;Acc:103031453])

HSP 1 Score: 97.4413 bits (241), Expect = 2.081e-23
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  119 MKSNGKLVDLIEKVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASYLDQISRYYITRAKLVSKVAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 257          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Match: psme2 (proteasome activator subunit 2 [Source:NCBI gene;Acc:103037889])

HSP 1 Score: 87.0409 bits (214), Expect = 9.653e-20
Identity = 44/149 (29.53%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            I+ N+ +I ++ +VKP +      +  +  WI   +P+I DGN+FGVAVQE+++  + ++++++         YF++RG  + K  K ++V D+   + E DE+ Y ++R  + +I+  Y  + ++  KN+ K+T P+ E+     SMY
Sbjct:   93 IKGNEKIIKLLDIVKPEITSLKETIITVACWISHLIPKIEDGNDFGVAVQEKILERIAAVKTKVEGFQTNINKYFSERGDAVAKASKDTHVMDYRALVHEKDEATYSEIRVIVLDIRGFYAELYDIISKNLEKVTNPKGEEK---PSMY 238          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Match: psme2 (proteasome activator subunit 2 [Source:NCBI gene;Acc:103037889])

HSP 1 Score: 87.0409 bits (214), Expect = 9.653e-20
Identity = 44/149 (29.53%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            I+ N+ +I ++ +VKP +      +  +  WI   +P+I DGN+FGVAVQE+++  + ++++++         YF++RG  + K  K ++V D+   + E DE+ Y ++R  + +I+  Y  + ++  KN+ K+T P+ E+     SMY
Sbjct:   93 IKGNEKIIKLLDIVKPEITSLKETIITVACWISHLIPKIEDGNDFGVAVQEKILERIAAVKTKVEGFQTNINKYFSERGDAVAKASKDTHVMDYRALVHEKDEATYSEIRVIVLDIRGFYAELYDIISKNLEKVTNPKGEEK---PSMY 238          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Sea Lamprey
Match: psme3 (proteasome activator subunit 3 [Source:ZFIN;Acc:ZDB-GENE-991110-19])

HSP 1 Score: 91.6633 bits (226), Expect = 5.358e-22
Identity = 46/139 (33.09%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            +Q N  L++++  +KP +   +     + +WIQL +P+I DGNNFGV+VQ   +       ++    L  F  Y+  R K++ K+ K+ +V D+ + + E DE  Y  LR  +  ++NHY+ + +V  KNI KI  PR+
Sbjct:  110 VQSNPKLVALIERIKPEIRTLMDKCNTVKMWIQLMIPKIEDGNNFGVSVQHSNVATSKYYCTRCSTRLLSFIRYYMSRAKLVSKVAKYPHVEDYRRTVDELDEKEYLSLRIIVSELRNHYVILHDVITKNIEKIKKPRS 248          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Nematostella
Match: EDO46178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQX5])

HSP 1 Score: 106.301 bits (264), Expect = 2.170e-27
Identity = 50/136 (36.76%), Postives = 81/136 (59.56%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            NK +  I+ ++KP +   +     + +WIQL +P I DGNNFGV++QEE +  +  IE +    LD    Y+  RGK++ K+VK+  ++D+ QA+FE DE  +  LR     ++NHY+ + +   KN+ KI  PR+
Sbjct:   87 NKFVQDIIELLKPKIQTLMEKCNLVKMWIQLLIPRIEDGNNFGVSIQEEALSEVQRIEGEAATFLDQIARYYVTRGKVVSKIVKYPQLQDYRQAVFELDEKEFISLRLCCCELRNHYLILHDTITKNMEKIKKPRS 222          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Nematostella
Match: EDO29241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T471])

HSP 1 Score: 51.6026 bits (122), Expect = 8.285e-9
Identity = 24/65 (36.92%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  406 IMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDY 600
            I+ ++KP +   +     + +WIQL +P I DGNNFGV++QEE +  +  IE +    LD    Y
Sbjct:    6 IIELLKPKIQTLMEKCNLVKMWIQLLIPRIEDGNNFGVSIQEEALSEVQRIEGEAATFLDQIARY 70          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Match: psme3 (proteasome activator subunit 3 [Source:NCBI gene;Acc:101169594])

HSP 1 Score: 98.2117 bits (243), Expect = 9.028e-24
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  111 MKSNGNLVDLIEKVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 249          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Match: psme3 (proteasome activator subunit 3 [Source:NCBI gene;Acc:101169594])

HSP 1 Score: 97.8265 bits (242), Expect = 1.048e-23
Identity = 45/139 (32.37%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRN 795
            ++ N  L+ ++  VKP +   +     + +W+QL +P I DGNNFGV++QEE +  L ++E +  + LD  + Y+  R K++ K+ K+ +V D+ + + E DE  Y  L+  +  ++N Y+++ ++ +KNI KI  PR+
Sbjct:  103 MKSNGNLVDLIEKVKPEIRTLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVEGEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLKIIVSELRNQYVTLHDMILKNIEKIKRPRS 241          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Match: psme2 (proteasome activator subunit 2 [Source:NCBI gene;Acc:101173098])

HSP 1 Score: 87.0409 bits (214), Expect = 1.004e-19
Identity = 44/149 (29.53%), Postives = 87/149 (58.39%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            I+ N+ +++++  VKP ++     +  +  WIQ  +P+I DGN+FGVA+QE+++  + ++++++         YF++RG  + K  K ++V D+   + E D + +  LR  L +I+  Y  + ++  KN+ K+T P+ E+    SSMY
Sbjct:   96 IKGNEKIMTLLERVKPEIVALRETIITVSCWIQHLIPKIEDGNDFGVAIQEKILERIAAVKTKVDGFQTNINKYFSERGDAVAKASKETHVMDYRSLVHEKDRALFSDLRVILLDIRGFYAELYDIINKNLEKVTNPKGEEK---SSMY 241          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Match: psme1 (proteasome activator subunit 1 [Source:NCBI gene;Acc:101157736])

HSP 1 Score: 86.2705 bits (212), Expect = 1.912e-19
Identity = 50/145 (34.48%), Postives = 82/145 (56.55%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLI 813
            I  N+ + S++  VKP +      +  + +W+QL++P I DGNNFGVAVQE+V   L S  ++I       + Y+++RG  + K  K  +V D+ Q + E D+  Y +LR  + +I+N Y  + ++  KN  KI  PR +  +LI
Sbjct:  105 IYSNERVESLLQEVKPEIQTLKEKLNTVSMWVQLQIPRIEDGNNFGVAVQEKVFELLTSTRTKIEAIQTQISKYYSERGDAVAKASKQPHVGDYRQLVHELDQYQYCELRLHILDIRNTYAVLFDIINKNYDKIKRPRGDGKALI 249          
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Match: psme1 (proteasome activator subunit 1 [Source:NCBI gene;Acc:101157736])

HSP 1 Score: 85.8853 bits (211), Expect = 2.545e-19
Identity = 50/145 (34.48%), Postives = 82/145 (56.55%), Query Frame = 1
Query:  379 IQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLI 813
            I  N+ + S++  VKP +      +  + +W+QL++P I DGNNFGVAVQE+V   L S  ++I       + Y+++RG  + K  K  +V D+ Q + E D+  Y +LR  + +I+N Y  + ++  KN  KI  PR +  +LI
Sbjct:   90 IYSNERVESLLQEVKPEIQTLKEKLNTVSMWVQLQIPRIEDGNNFGVAVQEKVFELLTSTRTKIEAIQTQISKYYSERGDAVAKASKQPHVGDYRQLVHELDQYQYCELRLHILDIRNTYAVLFDIINKNYDKIKRPRGDGKALI 234          
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Match: SMESG000021594.1 (SMESG000021594.1)

HSP 1 Score: 372.859 bits (956), Expect = 7.988e-132
Identity = 192/192 (100.00%), Postives = 192/192 (100.00%), Query Frame = 1
Query:  250 MRFLKNAIIKARQNNRQADLXXXXXXXXVENPESPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            MRFLKNAIIKARQNNRQADLSSSDDSSSVENPESPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY
Sbjct:    1 MRFLKNAIIKARQNNRQADLSSSDDSSSVENPESPIPMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 192          
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Match: SMESG000071933.1 (SMESG000071933.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.111e-33
Identity = 55/137 (40.15%), Postives = 94/137 (68.61%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNE 798
            NK++ S    +KP+++E + DV+ L +WIQL VP+I DGNNFGV++QE+V+  L  +ES++   LD F++Y   R K+L K  K+ NV DF  +  E+D+S   ++R  +++++N+Y  + ++ +KN+VK+  PRN+
Sbjct:   87 NKIITSFAEEIKPIILECIDDVQMLQMWIQLNVPKIEDGNNFGVSIQEKVLEKLSEVESELLVRLDFFSEYHYYRAKLLAKYYKYPNVVDFKVSAIEYDQSIIVQIRGIVEDVRNYYAILHDIFLKNLVKLKKPRND 223          
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Match: SMESG000055911.1 (SMESG000055911.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.111e-33
Identity = 55/137 (40.15%), Postives = 94/137 (68.61%), Query Frame = 1
Query:  388 NKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNE 798
            NK++ S    +KP+++E + DV+ L +WIQL VP+I DGNNFGV++QE+V+  L  +ES++   LD F++Y   R K+L K  K+ NV DF  +  E+D+S   ++R  +++++N+Y  + ++ +KN+VK+  PRN+
Sbjct:   87 NKIITSFAEEIKPIILECIDDVQMLQMWIQLNVPKIEDGNNFGVSIQEKVLEKLSEVESELLVRLDFFSEYHYYRAKLLAKYYKYPNVVDFKVSAIEYDQSIIVQIRGIVEDVRNYYAILHDIFLKNLVKLKKPRND 223          
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Match: SMESG000077571.1 (SMESG000077571.1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.339e-24
Identity = 51/140 (36.43%), Postives = 83/140 (59.29%), Query Frame = 1
Query:  406 IMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            +M +++P +   + +   + LWIQ  +P+I DGNNFGV +QEEV+G   SIE    N L+  + Y   R K+L K++KF N+ D+ + +   DE     LR  +  ++NHY  + ++  KN+ +I +PR+  N+ I SMY
Sbjct:   78 MMDILRPYITRLMEEALQVRLWIQFNIPKIEDGNNFGVGIQEEVLGEAVSIEKDASNFLEQMSRYHISRAKMLTKVIKFPNIMDYHECVKNADEMQAISLRYIVMEMRNHYAILHDMIKKNLERIKIPRS--NNTI-SMY 214          
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Match: SMESG000069494.1 (SMESG000069494.1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.398e-21
Identity = 48/143 (33.57%), Postives = 81/143 (56.64%), Query Frame = 1
Query:  397 LISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGNNFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRDFGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNSLISSMY 825
            L S+M ++KPL+   + +   + LWIQ  +P+I DGNNFGV++QEE +    +IE      L+  + Y   R ++L K+ KF  + D+   + + D      L+  +  ++NHY  + ++  KNI +I +PR + NS+  SMY
Sbjct:   66 LKSLMEILKPLITRLMDEALHVRLWIQFNIPKIEDGNNFGVSIQEEALSEAANIERDACAFLEQMSRYHVSRARVLSKVQKFPQIEDYRACVCDMDLKQEIGLKYIIMEMRNHYAILHDLINKNIDRIKIPRTD-NSI--SMY 205          
The following BLAST results are available for this feature:
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSME31.589e-2736.62proteasome activator subunit 3 [Source:HGNC Symbol... [more]
PSME34.294e-2736.62proteasome activator subunit 3 [Source:HGNC Symbol... [more]
PSME31.510e-2636.62proteasome activator subunit 3 [Source:HGNC Symbol... [more]
PSME32.873e-2636.62proteasome activator subunit 3 [Source:HGNC Symbol... [more]
PSME37.481e-2433.55proteasome activator subunit 3 [Source:HGNC Symbol... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y66D12A.92.462e-2829.95pep chromosome:WBcel235:III:11568137:11573343:1 ge... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
REG1.049e-2533.57gene:FBgn0029133 transcript:FBtr0310646[more]
REG1.049e-2533.57gene:FBgn0029133 transcript:FBtr0073730[more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psme39.382e-2432.37proteasome activator subunit 3 [Source:ZFIN;Acc:ZD... [more]
psme39.382e-2432.37proteasome activator subunit 3 [Source:ZFIN;Acc:ZD... [more]
psme31.181e-2332.37proteasome activator subunit 3 [Source:ZFIN;Acc:ZD... [more]
psme21.201e-1828.86proteasome activator subunit 2 [Source:ZFIN;Acc:ZD... [more]
psme11.229e-1836.67proteasome activator subunit 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lctl1.582e-2636.62lactase like [Source:Xenbase;Acc:XB-GENE-991435][more]
lctl1.704e-2636.62lactase like [Source:Xenbase;Acc:XB-GENE-991435][more]
lctl1.906e-2636.62lactase like [Source:Xenbase;Acc:XB-GENE-991435][more]
lctl2.004e-2636.62lactase like [Source:Xenbase;Acc:XB-GENE-991435][more]
lctl2.358e-2636.62lactase like [Source:Xenbase;Acc:XB-GENE-991435][more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psme31.037e-2636.62proteaseome (prosome, macropain) activator subunit... [more]
Psme17.626e-2030.99proteasome (prosome, macropain) activator subunit ... [more]
Psme13.511e-1731.69proteasome (prosome, macropain) activator subunit ... [more]
Psme15.633e-1730.53proteasome (prosome, macropain) activator subunit ... [more]
Psme22.001e-1631.15proteasome (prosome, macropain) activator subunit ... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61291|PSME3_PIG7.251e-2636.62Proteasome activator complex subunit 3 OS=Sus scro... [more]
sp|P61290|PSME3_MOUSE7.251e-2636.62Proteasome activator complex subunit 3 OS=Mus musc... [more]
sp|Q4R4V3|PSME3_MACFA7.251e-2636.62Proteasome activator complex subunit 3 OS=Macaca f... [more]
sp|P61289|PSME3_HUMAN7.251e-2636.62Proteasome activator complex subunit 3 OS=Homo sap... [more]
sp|Q5RFD3|PSME3_PONAB7.327e-2636.62Proteasome activator complex subunit 3 OS=Pongo ab... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UIE41.370e-2938.41Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A448X8S43.870e-2838.36Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A0R3SQT06.580e-2839.60PA28_beta domain-containing protein OS=Hymenolepis... [more]
A0A0R3TQZ68.206e-2837.91Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A5J4NSK31.023e-2737.67Proteasome activator subunit 3 (PA28 gamma) OS=Par... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psme37.593e-2432.37proteasome activator subunit 3 [Source:NCBI gene;A... [more]
psme37.790e-2432.37proteasome activator subunit 3 [Source:NCBI gene;A... [more]
psme32.081e-2332.37proteasome activator subunit 3 [Source:NCBI gene;A... [more]
psme29.653e-2029.53proteasome activator subunit 2 [Source:NCBI gene;A... [more]
psme29.653e-2029.53proteasome activator subunit 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psme35.358e-2233.09proteasome activator subunit 3 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO461782.170e-2736.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292418.285e-936.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psme39.028e-2432.37proteasome activator subunit 3 [Source:NCBI gene;A... [more]
psme31.048e-2332.37proteasome activator subunit 3 [Source:NCBI gene;A... [more]
psme21.004e-1929.53proteasome activator subunit 2 [Source:NCBI gene;A... [more]
psme11.912e-1934.48proteasome activator subunit 1 [Source:NCBI gene;A... [more]
psme12.545e-1934.48proteasome activator subunit 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Proteasome activator complex subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021594.17.988e-132100.00SMESG000021594.1[more]
SMESG000071933.13.111e-3340.15SMESG000071933.1[more]
SMESG000055911.13.111e-3340.15SMESG000055911.1[more]
SMESG000077571.13.339e-2436.43SMESG000077571.1[more]
SMESG000069494.12.398e-2133.57SMESG000069494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034622 ID=SMED30034622|Name=Proteasome activator complex subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=927bp
TGAATTGCAAACTATTGATCACATATTTTTCAGTCAATAAACTGATATCA
AAAAGTCATGTCAAACGAAAGGTTAGCCTCTCAACAGAGCGAACTTCAAG
ATTTCAAGAAGAACCTAAACTTGTCAAGTAAGTCATTACTGAAATTTGAA
ATTCCTCAAAAAATTCTCTTCATCAACAAGTTGATCCGTTCCGAGCAATT
TCATCCTGAAAATCTGATAACCGAACTGAAGGCTAAAAATAAAAAAGAAA
TGAGATTTTTGAAAAATGCAATAATCAAGGCGAGACAAAACAATCGCCAA
GCCGACTTATCGTCAAGTGACGACTCCAGCTCAGTTGAGAATCCTGAATC
CCCTATCCCAATGGATATCAGTGAAACAATTCAGCCAAATAAATTACTGA
TTAGTATAATGAGTGTAGTTAAACCTTTAATGATTGAGAACCTTCATGAT
GTCAGAGCTTTGTTGTTGTGGATCCAGTTAAAAGTTCCTGAAATTGCAGA
CGGAAATAATTTCGGAGTTGCAGTCCAAGAGGAGGTGATTGGTAATTTGG
GGTCAATTGAATCACAAATCTTTAATGACCTGGACATGTTTACGGATTAT
TTCAATCAACGCGGAAAAATACTTATCAAACTTGTTAAATTTTCCAACGT
TCGTGATTTTGGTCAAGCGATTTTCGAACATGACGAATCATTTTACTACA
AGCTGCGGGAAACCCTGAAGAACATCCAGAACCATTATATGTCGATGCAG
AATGTCTGCGTAAAGAACATTGTCAAGATCACTGTACCGAGAAATGAAAA
GAATTCCTTAATATCTTCTATGTACTGATATTATCAGCTGCATACGGTAC
ACGATTTAAACTTGAGAAATTTATTTGTTGATCATATTTCCTTTTGCAAT
TCAATAAATTTTTCTTTTACAAAAAAA
back to top

protein sequence of SMED30034622-orf-1

>SMED30034622-orf-1 ID=SMED30034622-orf-1|Name=SMED30034622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=257bp
MSNERLASQQSELQDFKKNLNLSSKSLLKFEIPQKILFINKLIRSEQFHP
ENLITELKAKNKKEMRFLKNAIIKARQNNRQADLSSSDDSSSVENPESPI
PMDISETIQPNKLLISIMSVVKPLMIENLHDVRALLLWIQLKVPEIADGN
NFGVAVQEEVIGNLGSIESQIFNDLDMFTDYFNQRGKILIKLVKFSNVRD
FGQAIFEHDESFYYKLRETLKNIQNHYMSMQNVCVKNIVKITVPRNEKNS
LISSMY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036997PA28_C_sf
IPR003185Proteasome_activ_PA28_N
IPR036252Proteasome_activ_sf
IPR003186PA28_C
IPR009077Proteasome_activ_PA28
Vocabulary: cellular component
TermDefinition
GO:0008537proteasome activator complex
GO:0000502proteasome complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 58..78
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..99
NoneNo IPR availablePANTHERPTHR10660:SF2LD45860Pcoord: 6..249
IPR036997Proteasome activator PA28, C-terminal domain superfamilyGENE3DG3DSA:1.20.120.180coord: 107..245
e-value: 6.5E-38
score: 131.6
IPR003185Proteasome activator PA28, N-terminal domainPFAMPF02251PA28_alphacoord: 9..53
e-value: 1.1E-4
score: 22.1
IPR003186Proteasome activator PA28, C-terminal domainPFAMPF02252PA28_betacoord: 108..249
e-value: 2.3E-40
score: 137.6
IPR009077Proteasome activator PA28PANTHERPTHR10660PROTEASOME REGULATOR PA28coord: 6..249
IPR036252Proteasome activator superfamilySUPERFAMILYSSF47216Proteasome activatorcoord: 9..246